Die Suche nach Genen in Bakteriengenomen. BWInf-Workshop März Prof. Dr. Sven Rahmann AG Bioinformatik Informatik XI, TU Dortmund

Größe: px
Ab Seite anzeigen:

Download "Die Suche nach Genen in Bakteriengenomen. BWInf-Workshop 22.-23. März 2011. Prof. Dr. Sven Rahmann AG Bioinformatik Informatik XI, TU Dortmund"

Transkript

1 Die Suche nach Genen in Bakteriengenomen BWInf-Workshop März 2011 Prof. Dr. Sven Rahmann AG Bioinformatik Informatik XI, TU Dortmund 1

2 Bioinformatik was ist das? Aufgabe: Analyse (molekular)biologischer Daten mit Methoden der Informatik Teilgebiet: Sequenzanalyse Analyse von DNA-, RNA-, Proteinsequenzen Speziell an der Universität: Erforschung und Entwicklung neuer solcher Methoden 2

3 Das zentrale Dogma der Molekularbiologie: Informationsverarbeitung in der Zelle DNA enthält Erbinformation (bei Viren oft RNA) Diese wird abgelesen (Transkription) in mrna Anhand der mrna-sequenz wird ein Proteinmolekül erstellt (Translation) Proteine führen Funktionen in der Zelle aus. Der Informationsfluss ist also DNA -> RNA -> Protein. (Diese Sichtweise ist nicht immer korrekt.) 3

4 DNA-Struktur: Biopolymer aus 4 Basen 4

5 DNA-Struktur: Biopolymer aus 4 Basen Darstellung von DNA-Sequenzen als Zeichenketten (Strings) Alphabet: 4 Buchstaben {A,C,G,T} Länge: Millionen bis Milliarden Zeichen (Einheit: nt, bp) Algorithmen auf Zeichenketten erlauben Analyse von Genomen. 5

6 Transkription von DNA in messenger RNA (mrna) 6

7 Proteine sind Ketten von Aminosäuren 7

8 21 Aminosäuren Illustration: Dan Cojocari, Toronto 8

9 Translation von mrna in Protein am Ribosom 9

10 Genetischer Code: 3 nt => 1 aa Formaler Übersetzungsprozess Lies jeweils 3 nt Suche dazu die passende Aminosäure Hänge diese aneinander, bis die DNA-Sequenz erschöpft ist. Beachte auch: Start, Stopp Base1 Base2 Base3 AA = = = = TTTTTTTTTTTTTTTT TTTTCCCCAAAAGGGG TCAGTCAGTCAGTCAG FFLLSSSSYY**CC*W CCCCCCCCCCCCCCCC TTTTCCCCAAAAGGGG TCAGTCAGTCAGTCAG LLLLPPPPHHQQRRRR AAAAAAAAAAAAAAAA TTTTCCCCAAAAGGGG TCAGTCAGTCAGTCAG IIIMTTTTNNKKSSRR GGGGGGGGGGGGGGGG TTTTCCCCAAAAGGGG TCAGTCAGTCAGTCAG 10 VVVVAAAADDEEGGGG

11 Offene Leserahmen (open reading frames, ORFs) Eine DNA-Sequenz kann auf 6 Arten interpretiert werden (Leseraster). 3 Startpositionen 2 Richtungen Protein-kodierende Bereiche (inkorrekterweise "Gene" genannt) beginnen mit Startcodon enthalten darauf folgend viele "normale" Codons enden mit Stopp-Codon Name für eine solche Struktur: ORF Jedes Gen ist ein ORF, aber nicht umgekehrt ORFs finden ist leicht, Gene finden schwierig. Aufgabe: Finde alle ORFs in allen Leserastern in einem Bakteriengenom. 11

12 Beispiel: Übersetzung DNA -> Protein (Nichtstrukturprotein NS1 des H1N1-Grippevirus, Patient aus Puerto Rico im Jahr 1934) ATGGATCCAAACACTGTGTCAAGCTTTCAGGTAGATTGCTTTCTTTGGCATGTCCGCAAACGAGTTGCAG ACCAAGAACTAGGTGATGCCCCATTCCTTGATCGGCTTCGCCGAGATCAGAAATCCCTAAGAGGAAGGGG CAGCACTCTTGGTCTGGACATCGAGACAGCCACACGTGCTGGAAAGCAGATAGTGGAGCGGATTCTGAAA GAAGAATCCGATGAGGCACTTAAAATGACCATGGCCTCTGTACCTGCGTCGCGTTACCTAACCGACATGA CTCTTGAGGAAATGTCAAGGGAATGGTCCATGCTCATACCCAAGCAGAAAGTGGCAGGCCCTCTTTGTAT CAGAATGGACCAGGCGATCATGGATAAAAACATCATACTGAAAGCGAACTTCAGTGTGATTTTTGACCGG CTGGAGACTCTAATATTGCTAAGGGCTTTCACCGAAGAGGGAGCAATTGTTGGCGAAATTTCACCATTGC CTTCTCTTCCAGGACATACTGCTGAGGATGTCAAAAATGCAGTTGGAGTCCTCATCGGAGGACTTGAATG GAATGATAACACAGTTCGAGTCTCTGAAACTCTACAGAGATTCGCTTGGAGAAGCAGTAATGAGAATGGG AGACCTCCACTCACTCCAAAACAGAAACGAGAAATGGCGGGAACAATTAGGTCAGAAGTTTGA MDPNTVSSFQVDCFLWHVRKRVADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILKE ESDEALKMTMASVPASRYLTDMTLEEMSREWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLE TLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEWNDNTVRVSETLQRFAWRSSNENGRPP LTPKQKREMAGTIRSEV. 12

13 Aufgabe Gegeben: Bakteriengenom (mehrere Millionen bp) Dateiformat wird noch erläutert Gesucht: Liste aller ORFs (Start- und Endposition, Strang), evtl. deren Eigenschaften (Länge, Bewertung) Vorgehen: Diskussion verschiedener algorithmischer Strategien Bewertung der Effizienz Aufteilung in Unterprobleme Implementierung in Python Test, Anwendung auf Genome Projektpräsentation 13

14 Übungen Wie lautet die Aminosäuresequenz zu ATGCTTGGG? GAGATTAC? Wie lauten die Aminosäuresequenzen in allen 6 Leserastern? Wie viele Möglichkeiten gibt es, diese Aminosäuresequenz zu erzeugen? ILSW Base1 Base2 Base3 AA = = = = TTTTTTTTTTTTTTTT TTTTCCCCAAAAGGGG TCAGTCAGTCAGTCAG FFLLSSSSYY**CC*W CCCCCCCCCCCCCCCC TTTTCCCCAAAAGGGG TCAGTCAGTCAGTCAG LLLLPPPPHHQQRRRR AAAAAAAAAAAAAAAA TTTTCCCCAAAAGGGG TCAGTCAGTCAGTCAG IIIMTTTTNNKKSSRR GGGGGGGGGGGGGGGG TTTTCCCCAAAAGGGG TCAGTCAGTCAGTCAG 14 VVVVAAAADDEEGGGG

15 Wie bringe ich den genetischen Code dem Computer bei? Hängt von der Programmiersprache ab. Hier am Beispiel von Python (www.python.org): Erstelle ein "Wörterbuch" (engl. dictionary), in Python: dict. Dessen Name sei 'aa' (für amino acids). Mit aa["atg"] erhält man die Aminosäure zum Codon ATG. Das ist langweilige Tipparbeit... aa = dict( ATA="I", ATC="I", ATT="I", ATG="M",...) 15

16 Wie bringe ich den genetischen Code dem Computer bei? Jetzt benötigen wir: Funktion, die eine Sequenz in Tripel zerlegt. Funktion, die zu einer DNA-Sequenz eine Folge von Aminosäuren erstellt Funktion, die die Folge von Aminosäuren zu einem Protein verbindet Erzeugung aller Tripel einer Sequenz: def triples(seq): """gibt zu einer Sequenz 'seq' alle Tripel zurueck.""" it = iter(seq) # Iterator der Sequenz while it: yield (next(it),next(it),next(it)) 16

17 Erklärungen zu triples() def definiert eine neue Funktion. Ihr Name ist triples Sie hat ein Argument; das heißt seq. Die Zeile mit den """... """ ist ein Kommentar (Hilfe) zur Funktion. iter() liefert einen Iterator. Ein Iterator ist ein Objekt, das über ein anderes Objekt iteriert, d.h. alle Elemente dieses Objektes nacheinander besucht. Dies geschieht solange wie der Iterator noch nicht erschöpft ist (while it) Auf das jeweils nächste Element wird mit next() zugegriffen. Dies geschieht immer 3x, so dass ein Tripel erzeugt wird Die yield-anweisung unterbricht die Funktion und liefert ein Tripel zurück. def triples(seq): """gibt zu einer Sequenz 'seq' alle Tripel zurueck.""" it = iter(seq) # Iterator der Sequenz while it: 17 yield (next(it),next(it),next(it))

18 Übung Was passiert (irgendwann), wenn die Länge der Sequenz seq kein Vielfaches von 3 ist? def triples(seq): """gibt zu einer Sequenz 'seq' alle Tripel zurueck.""" it = iter(seq) # Iterator der Sequenz while it: yield (next(it),next(it),next(it)) 18

19 Wie bringe ich den genetischen Code dem Computer bei? Wir benötigen: Funktion, die eine Sequenz in Tripel zerlegt. Funktion, die zu einer DNA-Sequenz eine Folge von Aminosäuren erstellt Funktion, die die Folge von Aminosäuren zu einem Protein verbindet Erzeugung der Folge der Aminosäuren: def aminoacids(dna): """gibt Aminosaeuren zur DNA-Sequenz 'dna' zurueck.""" for t in triples(dna): codon = "".join(t) yield aa[codon] 19

20 Erklärungen zu aminoacids() Die Funktion aminoacids() bekommt eine DNA-Sequenz übergeben. Wir iterieren über alle Tripel mit Hilfe der definierten Funktion triples(). Da triples() eine yield-anweisung enthält, ist sie eine Generator-Funktion. Deswegen kann man sie als "Container" in einer for-schleife verwenden. Wann immer triples() ein neues Tripel erzeugt hat, wird der Rumpf der forschleife ausgeführt; das Tripel heißt hier t. Um im genetischen Code die zugehörige Aminosäure zu finden, muss aus dem Tripel (z.b. ("A","G","T")) erst das Codon (z.b. "AGT") erstellt werden. Dies geschieht mit Hilfe der join-methode. Die Aminosäure wird im genetischen Code (aa) nachgeschlagen. Auch aminoacids() ist eine Generator-Funktion. Sie liefert nacheinander die Aminosäuren an die aufrufende Routine. def aminoacids(dna): """gibt Aminosaeuren zur DNA-Sequenz 'dna' zurueck.""" for t in triples(dna): codon = "".join(t) 20 yield aa[codon]

21 Wie bringe ich den genetischen Code dem Computer bei? Wir benötigen: Funktion, die eine Sequenz in Tripel zerlegt. Funktion, die zu einer DNA-Sequenz eine Folge von Aminosäuren erstellt Funktion, die die Folge von Aminosäuren zu einem Protein verbindet def protein(dna): return "".join(aminoacids(dna)) Wir müssen die Folge der Aminosäuren zu einer Zeichenkette verbinden. Dies geschieht wieder mit der join-methode und dem leeren String als Verbinder. Die return-anweisung liefert den Ausdruck dahinter zurück und beendet die Funktion. 21

Algorithmen auf Sequenzen 12.04.2010

Algorithmen auf Sequenzen 12.04.2010 Algorithmen auf Sequenzen 12.04.2010 Prof. Dr. Sven Rahmann 1 Team Prof. Dr. Sven Rahmann Dipl.-Inform Tobias Marschall (Skript) Zeit Mo 8:30-10; Übungen Mi 8:30-10 ca. alle 2 Wochen (Plan!) Ort OH14,

Mehr

Rekonstruktion biologischer Netzwerke (mit probabilistischen Methoden) Einführung 11.10.2010

Rekonstruktion biologischer Netzwerke (mit probabilistischen Methoden) Einführung 11.10.2010 Rekonstruktion biologischer Netzwerke (mit probabilistischen Methoden) Einführung 11.10.2010 Prof. Dr. Sven Rahmann 1 Team Prof. Dr. Sven Rahmann Zeit Mo 10-12; Do 8:30-10 Ort OH14, R104 Alle Informationen

Mehr

DATENQUALITÄT IN GENOMDATENBANKEN

DATENQUALITÄT IN GENOMDATENBANKEN DATENQUALITÄT IN GENOMDATENBANKEN Alexander Fehr 28. Januar 2004 Gliederung Motivation Biologische Grundkonzepte Genomdaten Datenproduktion und Fehler Data Cleansing 2 Motivation (1) Genomdatenbanken enthalten

Mehr

Biologie I/B: Klassische und molekulare Genetik, molekulare Grundlagen der Entwicklung Theoretische Übungen SS 2014

Biologie I/B: Klassische und molekulare Genetik, molekulare Grundlagen der Entwicklung Theoretische Übungen SS 2014 Biologie I/B: Klassische und molekulare Genetik, molekulare Grundlagen der Entwicklung Theoretische Übungen SS 2014 Fragen für die Übungsstunde 8 (14.07-18.07.) 1) Von der DNA-Sequenz zum Protein Sie können

Mehr

Bioinformatik für Biochemiker

Bioinformatik für Biochemiker Bioinformatik für Biochemiker Oliver Kohlbacher, Steffen Schmidt SS 2010 3. Strings, Sequenzen und Python Abt. Simulation biologischer Systeme WSI/ZBIT, Eberhard Karls Universität Tübingen Übersicht Strings

Mehr

Evolution & Genetik (Beispiel Hämoglobin) Prof. Dr. Antje Krause FH Bingen 06721 / 409 253 akrause@fh-bingen.de

Evolution & Genetik (Beispiel Hämoglobin) Prof. Dr. Antje Krause FH Bingen 06721 / 409 253 akrause@fh-bingen.de Evolution & Genetik (Beispiel Hämoglobin) Prof. Dr. Antje Krause FH Bingen 06721 / 409 253 akrause@fh-bingen.de DNA (Desoxyribonukleinsäure) 5 3 CGATGTACATCG GCTACATGTAGC 3 5 Doppelhelix Basen: Adenin,

Mehr

Dr. Jens Kurreck. Otto-Hahn-Bau, Thielallee 63, Raum 029 Tel.: 83 85 69 69 Email: jkurreck@chemie.fu-berlin.de

Dr. Jens Kurreck. Otto-Hahn-Bau, Thielallee 63, Raum 029 Tel.: 83 85 69 69 Email: jkurreck@chemie.fu-berlin.de Dr. Jens Kurreck Otto-Hahn-Bau, Thielallee 63, Raum 029 Tel.: 83 85 69 69 Email: jkurreck@chemie.fu-berlin.de Prinzipien genetischer Informationsübertragung Berg, Tymoczko, Stryer: Biochemie 5. Auflage,

Mehr

Beispiel 19. December 4, 2009

Beispiel 19. December 4, 2009 Beispiel 9 December 4, 2009 Computermathematik (für Informatik) 4. Übungsblatt (Musterlösung) 2. 2. 2009 Die heutigen Übungen sollen mit dem Computeralgebrasystem Sage gelöst werden. Die Lösung der Beispiele

Mehr

Die DNA Replikation. Exakte Verdopplung des genetischen Materials. Musterstrang. Neuer Strang. Neuer Strang. Eltern-DNA-Doppelstrang.

Die DNA Replikation. Exakte Verdopplung des genetischen Materials. Musterstrang. Neuer Strang. Neuer Strang. Eltern-DNA-Doppelstrang. Die DNA Replikation Musterstrang Neuer Strang Eltern-DNA-Doppelstrang Neuer Strang Musterstrang Exakte Verdopplung des genetischen Materials Die Reaktion der DNA Polymerase 5`-Triphosphat Nächstes Desoxyribonucleosidtriphosphat

Mehr

Python im Bioinformatiker-Alltag

Python im Bioinformatiker-Alltag Python im Bioinformatiker-Alltag Marcel Martin Bioinformatik für Hochdurchsatztechnologien, TU Dortmund 6. Oktober 2011 1 von 27 Worum gehts? Bioinformatik Löst Probleme in Biologie oder Medizin Teilbereich

Mehr

Modul 8: Bioinformatik A. Von der DNA zum Protein Proteinsynthese in silicio

Modul 8: Bioinformatik A. Von der DNA zum Protein Proteinsynthese in silicio Modul 8: Bioinformatik A. Von der DNA zum Protein Proteinsynthese in silicio Ein Wissenschaftler erhält nach einer Sequenzierung folgenden Ausschnitt aus einer DNA-Sequenz: 5 ctaccatcaa tccggtaggt tttccggctg

Mehr

Bioinformatik: Hype oder Hoffnung?

Bioinformatik: Hype oder Hoffnung? Bioinformatik: Hype oder Hoffnung? Florian Markowetz Max-Planck-Institut für Molekulare Genetik Computational Molecular Biology Berlin Career Nights AKG Bensheim, 28. Januar 2005 1 Florian Markowetz, Bioinformatik:

Mehr

Überblick von DNA zu Protein. Biochemie-Seminar WS 04/05

Überblick von DNA zu Protein. Biochemie-Seminar WS 04/05 Überblick von DNA zu Protein Biochemie-Seminar WS 04/05 Replikationsapparat der Zelle Der gesamte Replikationsapparat umfasst über 20 Proteine z.b. DNA Polymerase: katalysiert Zusammenfügen einzelner Bausteine

Mehr

Das zentrale Dogma der Molekularbiologie:

Das zentrale Dogma der Molekularbiologie: Das zentrale Dogma der Molekularbiologie: DNA Transkription RNA Translation Protein 1 Begriffserklärungen GENOM: Ist die allgemeine Bezeichnung für die Gesamtheit aller Gene eines Organismus GEN: Ist ein

Mehr

Wiederholunng. Klassische Genetik

Wiederholunng. Klassische Genetik Wiederholunng Klassische Genetik Mendelsche Regeln Uniformitätsregel Spaltungsregel Freie Kombinierbarkeit Koppelung von Genen Polygene: mehre Gene für ein Merkmal Pleiotropie: 1 Gen steuert mehrere Merkmale

Mehr

Kontrollstrukturen, Pseudocode und Modulo-Rechnung

Kontrollstrukturen, Pseudocode und Modulo-Rechnung Kontrollstrukturen, Pseudocode und Modulo-Rechnung CoMa-Übung III TU Berlin 29.10.2012 CoMa-Übung III (TU Berlin) Kontrollstrukturen, Pseudocode und Modulo-Rechnung 29.10.2012 1 / 1 Themen der Übung 1

Mehr

VBA-Programmierung: Zusammenfassung

VBA-Programmierung: Zusammenfassung VBA-Programmierung: Zusammenfassung Programmiersprachen (Definition, Einordnung VBA) Softwareentwicklung-Phasen: 1. Spezifikation 2. Entwurf 3. Implementierung Datentypen (einfach, zusammengesetzt) Programmablaufsteuerung

Mehr

Bioinformatik. Zeichenketten und Stringalgorithmen. Ulf Leser Wissensmanagement in der. Bioinformatik

Bioinformatik. Zeichenketten und Stringalgorithmen. Ulf Leser Wissensmanagement in der. Bioinformatik Bioinformatik Zeichenketten und Stringalgorithmen Ulf Leser Wissensmanagement in der Bioinformatik Inhalt dieser Vorlesung Warum Stringmatching? Strings und Matching Naiver Algorithmus Ulf Leser: Bioinformatik

Mehr

Formale Sprachen und Grammatiken

Formale Sprachen und Grammatiken Formale Sprachen und Grammatiken Jede Sprache besitzt die Aspekte Semantik (Bedeutung) und Syntax (formaler Aufbau). Die zulässige und korrekte Form der Wörter und Sätze einer Sprache wird durch die Syntax

Mehr

1. Beschriften Sie in der Abbildung die verschiedenen Bereiche auf der DNA und beschreiben Sie ihre Funktion! nicht-codogener Strang.

1. Beschriften Sie in der Abbildung die verschiedenen Bereiche auf der DNA und beschreiben Sie ihre Funktion! nicht-codogener Strang. ARBEITSBLATT 1 Transkription 1. Beschriften Sie in der Abbildung die verschiedenen Bereiche auf der DNA und beschreiben Sie ihre Funktion! Bindungsstelle für RNA-Polymerase RNA-Polymerase nicht-codogener

Mehr

Expression der genetischen Information Skript: Kapitel 5

Expression der genetischen Information Skript: Kapitel 5 Prof. A. Sartori Medizin 1. Studienjahr Bachelor Molekulare Zellbiologie FS 2013 12. März 2013 Expression der genetischen Information Skript: Kapitel 5 5.1 Struktur der RNA 5.2 RNA-Synthese (Transkription)

Mehr

Musterlösung - Übung 5 Vorlesung Bio-Engineering Sommersemester 2008

Musterlösung - Übung 5 Vorlesung Bio-Engineering Sommersemester 2008 Aufgabe 1: Prinzipieller Ablauf der Proteinbiosynthese a) Erklären Sie folgende Begriffe möglichst in Ihren eigenen Worten (1 kurzer Satz): Gen Nukleotid RNA-Polymerase Promotor Codon Anti-Codon Stop-Codon

Mehr

Aufbau und Funktion des Genoms: Von der Genstruktur zur Funktion

Aufbau und Funktion des Genoms: Von der Genstruktur zur Funktion Assoc. Prof. PD Mag. Dr. Aufbau und Funktion des Genoms: Von der Genstruktur zur Funktion Wien, 2013 Währinger Straße 10, A-1090 Wien helmut.dolznig@meduniwien.ac.at www.meduniwien.ac.at/medizinische-genetik

Mehr

PIWIN 1 Übung Blatt 5

PIWIN 1 Übung Blatt 5 Fakultät für Informatik Wintersemester 2008 André Gronemeier, LS 2, OH 14 Raum 307, andre.gronemeier@cs.uni-dortmund.de PIWIN 1 Übung Blatt 5 Ausgabedatum: 19.12.2008 Übungen: 12.1.2009-22.1.2009 Abgabe:

Mehr

Alignment-Verfahren zum Vergleich biologischer Sequenzen

Alignment-Verfahren zum Vergleich biologischer Sequenzen zum Vergleich biologischer Sequenzen Hans-Joachim Böckenhauer Dennis Komm Volkshochschule Zürich. April Ein biologisches Problem Fragestellung Finde eine Methode zum Vergleich von DNA-Molekülen oder Proteinen

Mehr

Bei der Translation wird die Aminosäuresequenz eines Polypeptids durch die Sequenz der Nukleotide in einem mrna- Molekül festgelegt

Bei der Translation wird die Aminosäuresequenz eines Polypeptids durch die Sequenz der Nukleotide in einem mrna- Molekül festgelegt Bei der Translation wird die Aminosäuresequenz eines Polypeptids durch die Sequenz der Nukleotide in einem mrna- Molekül festgelegt 5 mrna Nukleotid 3 N-Terminus Protein C-Terminus Aminosäure Es besteht

Mehr

Bioinformatik I (Einführung)

Bioinformatik I (Einführung) Kay Diederichs, Sommersemester 2015 Bioinformatik I (Einführung) Algorithmen Sequenzen Strukturen PDFs unter http://strucbio.biologie.unikonstanz.de/~dikay/bioinformatik/ Klausur: Fr 17.7. 10:00-11:00

Mehr

8. Translation. Konzepte: Translation benötigt trnas und Ribosomen. Genetischer Code. Initiation - Elongation - Termination

8. Translation. Konzepte: Translation benötigt trnas und Ribosomen. Genetischer Code. Initiation - Elongation - Termination 8. Translation Konzepte: Translation benötigt trnas und Ribosomen Genetischer Code Initiation - Elongation - Termination 1. Welche Typen von RNAs gibt es und welches sind ihre Funktionen? mouse human bacteria

Mehr

Grafische Interaktionssysteme/ dynamische Visualisierung des endlichen Automaten

Grafische Interaktionssysteme/ dynamische Visualisierung des endlichen Automaten Sprachliche Informationsverarbeitung 29.01.2007 HS Intelligente Systeme Prof. Dr. J. Rolshoven (WS 06/07) Grafische Interaktionssysteme/ dynamische Visualisierung des endlichen Automaten Referentin: Melinda

Mehr

1. Der Begriff Informatik 2. Syntax und Semantik von Programmiersprachen. I.2. I.2. Grundlagen von von Programmiersprachen.

1. Der Begriff Informatik 2. Syntax und Semantik von Programmiersprachen. I.2. I.2. Grundlagen von von Programmiersprachen. 1. Der Begriff Informatik 2. Syntax und Semantik von Programmiersprachen I.2. I.2. Grundlagen von von Programmiersprachen. - 1 - 1. Der Begriff Informatik "Informatik" = Kunstwort aus Information und Mathematik

Mehr

Grundlagen der Molekulargenetik

Grundlagen der Molekulargenetik Mathematik und Naturwissenschaften Psychologie Differentielle- & Persönlichkeitspsychologie Grundlagen der Molekulargenetik Dresden, 11.11.2010 Charlotte Bauer Gliederung 1. Speicherung genetischer Information

Mehr

Von der DNA zum Eiweißmolekül Die Proteinbiosynthese. Ribosom

Von der DNA zum Eiweißmolekül Die Proteinbiosynthese. Ribosom Von der DNA zum Eiweißmolekül Die Proteinbiosynthese Ribosom Wiederholung: DNA-Replikation und Chromosomenkondensation / Mitose Jede Zelle macht von Teilung zu Teilung einen Zellzyklus durch, der aus einer

Mehr

Lehrstuhl Informatik VI Grundzüge der Informatik * WS 2008/2009 Prof. Dr. Joachim Biskup

Lehrstuhl Informatik VI Grundzüge der Informatik * WS 2008/2009 Prof. Dr. Joachim Biskup Universität Dortmund Lehrstuhl Informatik VI Grundzüge der Informatik * WS 28/29 Prof. Dr. Joachim Biskup Leitung der Übungen: Arno Pasternak Lösungs-Ideen Übungsblatt 6 A: Grammatiken, Syntaxdiagramme

Mehr

Algorithmik II. SS 2003 Prof. Dr. H. Stoyan Lehrstuhl für Informatik 8 ( Künstliche Intelligenz) Email: stoyan@informatik.uni-erlangen.

Algorithmik II. SS 2003 Prof. Dr. H. Stoyan Lehrstuhl für Informatik 8 ( Künstliche Intelligenz) Email: stoyan@informatik.uni-erlangen. Algorithmik II SS 2003 Prof. Dr. H. Stoyan Lehrstuhl für Informatik 8 ( Künstliche Intelligenz) Email: stoyan@informatik.uni-erlangen.de Homepage der Vorlesung Vorbemerkungen I http://www8.informatik.uni-erlangen.de/immd8

Mehr

Einführung in Python Übung 1

Einführung in Python Übung 1 Einführung in Python Übung 1 Rebecca Breu, Bastian Tweddell Oktober 2007 Login: XXXloginXXX Passwort: XXXpasswortXXX Bitte das Passwort ändern (passwd)! Datentypen I Aufgabe 1 (Erste Schritte, Zahlen)

Mehr

Verbesserte Basenpaarung bei DNA-Analysen

Verbesserte Basenpaarung bei DNA-Analysen Powered by Seiten-Adresse: https://www.gesundheitsindustriebw.de/de/fachbeitrag/aktuell/verbesserte-basenpaarungbei-dna-analysen/ Verbesserte Basenpaarung bei DNA-Analysen Ein Team aus der Organischen

Mehr

Objektorientierte Programmierung

Objektorientierte Programmierung Universität der Bundeswehr Fakultät für Informatik Institut 2 Priv.-Doz. Dr. Lothar Schmitz FT 2006 Übungsblatt 5 Lösungsvorschlag Objektorientierte Programmierung 22. 05. 2006 Lösung 9 (SMS-Eingabe am

Mehr

Einführung in die Bioinformatik

Einführung in die Bioinformatik Einführung in die Bioinformatik Kay Nieselt SS 011 9. It s hip to chip - von Microarrays zu personalisierter Medizin WSI/ZBIT, Eberhard Karls Universität Tübingen Das menschliche Genom (.000.000.000 Basenpaare)

Mehr

Genetik - The Human Genome Project. Überblick über die Genetik. Die gesamte Erbinformation eines Menschen befindet sich in jedem Zellkern

Genetik - The Human Genome Project. Überblick über die Genetik. Die gesamte Erbinformation eines Menschen befindet sich in jedem Zellkern Genetik - The Human Genome Project Überblick über die Genetik Die gesamte Erbinformation eines Menschen befindet sich in jedem Zellkern seines Körpers. 1 2 Im Organismus müsssen nun ständig Enzyme u. a.

Mehr

Aufbau, Struktur, Funktion von DNA, RNA und Proteinen

Aufbau, Struktur, Funktion von DNA, RNA und Proteinen Aufbau, Struktur, Funktion von DNA, RNA und Proteinen Mitarbeiterseminar der Medizinischen Fakultät Ruhr-Universität Bochum Andreas Friebe Abteilung für Pharmakologie und Toxikologie Aufbau, Struktur,

Mehr

Programmiersprachen Einführung in C. Unser erstes C-Programm. Unser erstes C-Programm. Unser erstes C-Programm. Unser erstes C-Programm

Programmiersprachen Einführung in C. Unser erstes C-Programm. Unser erstes C-Programm. Unser erstes C-Programm. Unser erstes C-Programm Programmiersprachen Einführung in C Teil 2: Prof. Dr. int main (int argc, char *argv[]) int sum = 0; for (i = 0; i

Mehr

Kapitel 3 Das Projekt Bankkonto Seite 1

Kapitel 3 Das Projekt Bankkonto Seite 1 Kapitel 3 Das Projekt Bankkonto Seite 1 3 Das Projekt Bankkonto Nun wirst du dich etwas gründlicher mit dem Quelltext einer Klasse beschäftigen. Du lernst, wie zwei Objekte eine gemeinsame Aufgabe erledigen.

Mehr

Datenspeicherung und Datenfluß in der Zelle - Grundlagen der Biochemie

Datenspeicherung und Datenfluß in der Zelle - Grundlagen der Biochemie Datenspeicherung und Datenfluß in der Zelle - Grundlagen der Biochemie Datenspeicherung und Datenfluß der Zelle Transkription DNA RNA Translation Protein Aufbau I. Grundlagen der organischen Chemie und

Mehr

SAGE-Crashkurs SoSe 2009

SAGE-Crashkurs SoSe 2009 SAGE-Crashkurs SoSe 2009 Lars Fischer (lars. fischer (an der) uni - siegen. de) Diese Zusammenstellung erläutert die wichtigsten Dinge, um SAGE in der Zahlentheorie- Vorlesung zum Lösen der ersten Übungsblätter

Mehr

Übung 9. Quellcode Strukturieren Rekursive Datenstrukturen Uebung 9

Übung 9. Quellcode Strukturieren Rekursive Datenstrukturen Uebung 9 Informatik I 2 Übung 9 Quellcode Strukturieren Rekursive Datenstrukturen Uebung 9 Quellcode Strukturieren Wenn alle Funktionen in einer Datei zusammengefasst sind wird es schnell unübersichtlich Mehrere

Mehr

Einführung in die Programmierung mit Java

Einführung in die Programmierung mit Java Einführung in die Programmierung mit Java Martin Wirsing 2 Ziele Begriffsbildungen: Informatik, Algorithmus, Programm... Warum Java als Programmiersprache verwenden? Ein einfaches Java-Programm erstellen,

Mehr

Assertions (Zusicherungen)

Assertions (Zusicherungen) April 10, 2005 Oberseminar Software-Entwicklung Inhalt 1. Einführung (Motivation, Tony Hoare, Programmverifikation) 2. Design by Contract (Idee, Eiffel) 3. Praxis: Programming by Contract for Python 4.

Mehr

RNA und Expression RNA

RNA und Expression RNA RNA und Expression Biochemie RNA 1) Die Transkription. 2) RNA-Typen 3) RNA Funktionen 4) RNA Prozessierung 5) RNA und Proteinexpression/Regelung 1 RNA-Typen in E. coli Vergleich RNA-DNA Sequenz 2 Die Transkriptions-Blase

Mehr

Kursinhalte der Weiterbildung Molekulare Biotechnologie (MNr.: 237 / 0411 / 2010)

Kursinhalte der Weiterbildung Molekulare Biotechnologie (MNr.: 237 / 0411 / 2010) Kursinhalte der Weiterbildung Molekulare Biotechnologie (MNr.: 237 / 0411 / 2010) Schwerpunkte im Bereich BIOANALYTIK Polyacrylamidelektrophorese von Nukleinsäuren im Vertikalsystem Agarosegelelektrophorese

Mehr

Die kleinsten Viren kommen daher mit einem sehr geringen Informationsgehalt von nur 4 Genen aus, von denen

Die kleinsten Viren kommen daher mit einem sehr geringen Informationsgehalt von nur 4 Genen aus, von denen Aus der Reihe Daniels Genetik-Kompendium Erstellt von Daniel Röthgens Inhalt 1. Einleitung 2. RNA-Viren 3. DNA-Viren 1. Einleitung Im folgenden werden einige für die Genetik bedeutungsvolle Viren vorgestellt.

Mehr

Was sagen mir meine Gene? Individuelle Gendiagnostik Pro und Contra

Was sagen mir meine Gene? Individuelle Gendiagnostik Pro und Contra Was sagen mir meine Gene? Individuelle Gendiagnostik Pro und Contra Theo Dingermann und Ilse Zündorf, Frankfurt/Main Wie sehr wir im Gen-Zeitalter angekommen sind, haben wahrscheinlich viele noch gar nicht

Mehr

Sprachbeschreibung und Erweiterung

Sprachbeschreibung und Erweiterung Sprachbeschreibung und Erweiterung Worte, Sprachen, reguläre Ausdrücke, Automaten, BNF, Grammatik, Syntax- Diagramme, Spracherweiterungen do, for, break, switch Formale Beschreibung von Programmiersprachen

Mehr

Klausur zum Modul Molekularbiologie ILS, SS 2010 Freitag 6. August 10:00 Uhr

Klausur zum Modul Molekularbiologie ILS, SS 2010 Freitag 6. August 10:00 Uhr Klausur zum Modul Molekularbiologie ILS, SS 2010 Freitag 6. August 10:00 Uhr Name: Matrikel-Nr.: Code Nummer: Bitte geben Sie Ihre Matrikel-Nr. und Ihren Namen an. Die Code-Nummer erhalten Sie zu Beginn

Mehr

DNA Replikation ist semikonservativ. Abb. aus Stryer (5th Ed.)

DNA Replikation ist semikonservativ. Abb. aus Stryer (5th Ed.) DNA Replikation ist semikonservativ Entwindung der DNA-Doppelhelix durch eine Helikase Replikationsgabel Eltern-DNA Beide DNA-Stränge werden in 5 3 Richtung synthetisiert DNA-Polymerasen katalysieren die

Mehr

Was ist ein genetischer Fingerabdruck?

Was ist ein genetischer Fingerabdruck? Was ist ein genetischer Fingerabdruck? Genetischer Fingerabdruck od. DNA-Fingerprint ist ein molekularbiologisches Verfahren zur individuellen Identifizierung von Lebewesen Der genetische Fingerabdruck

Mehr

Einführung in die C-Programmierung

Einführung in die C-Programmierung Einführung in die C-Programmierung Warum C? Sehr stark verbreitet (Praxisnähe) Höhere Programmiersprache Objektorientierte Erweiterung: C++ Aber auch hardwarenahe Programmierung möglich (z.b. Mikrokontroller).

Mehr

Einführung in die Informatik 1

Einführung in die Informatik 1 Einführung in die Informatik 1 Datenorganisation und Datenstrukturen Sven Kosub AG Algorithmik/Theorie komplexer Systeme Universität Konstanz E 202 Sven.Kosub@uni-konstanz.de Sprechstunde: Freitag, 12:30-14:00

Mehr

Objektorientierte Programmierung

Objektorientierte Programmierung Universität der Bundeswehr Fakultät für Informatik Institut 2 Priv.-Doz. Dr. Lothar Schmitz FT 2006 Zusatzaufgaben Lösungsvorschlag Objektorientierte Programmierung Lösung 22 (Java und UML-Klassendiagramm)

Mehr

368 4 Algorithmen und Datenstrukturen

368 4 Algorithmen und Datenstrukturen Kap04.fm Seite 368 Dienstag, 7. September 2010 1:51 13 368 4 Algorithmen und Datenstrukturen Java-Klassen Die ist die Klasse Object, ein Pfeil von Klasse A nach Klasse B bedeutet Bextends A, d.h. B ist

Mehr

Suchen in Listen und Hashtabellen

Suchen in Listen und Hashtabellen Kapitel 12: Suchen in Listen und Hashtabellen Einführung in die Informatik Wintersemester 2007/08 Prof. Bernhard Jung Übersicht Einleitung Lineare Suche Binäre Suche (in sortierten Listen) Hashverfahren

Mehr

Java programmieren: Konsolen-Programme

Java programmieren: Konsolen-Programme Java programmieren: Es war einmal vor langer Zeit in einer weit entfernten Galaxis ok, das ist etwas übertrieben. In den Anfängen der Personal Computer in den 1980er sahen Computer noch etwa so aus: Diese

Mehr

Quines. Florian Pommerening. 19. Juli 2009

Quines. Florian Pommerening. 19. Juli 2009 Quines Florian Pommerening 19. Juli 2009 Seminar: Selbstbezüglichkeit Arbeitsgruppe für Grundlagen der Künstlichen Intelligenz Institut für Informatik Universität Freiburg Sommersemester 2009 1 EINLEITUNG

Mehr

Algorithmische Bioinformatik

Algorithmische Bioinformatik Algorithmische Bioinformatik Biologische Daten als Strings Ulf Leser Wissensmanagement in der Bioinformatik Ziele für heute Wert von Reduktionismus: Genome als Strings Reinschmecken in Stringmatching Erster

Mehr

Bioinformatik. Zeichenketten und Stringalgorithmen. Ulf Leser Wissensmanagement in der. Bioinformatik

Bioinformatik. Zeichenketten und Stringalgorithmen. Ulf Leser Wissensmanagement in der. Bioinformatik Bioinformatik Zeichenketten und Stringalgorithmen Ulf Leser Wissensmanagement in der Bioinformatik Inhalt dieser Vorlesung Warum Stringmatching? Strings und Matching Naiver Algorithmus Ulf Leser: Algorithmische

Mehr

Einblicke in das menschliche Erbgut (Genom) am Computer

Einblicke in das menschliche Erbgut (Genom) am Computer Einblicke in das menschliche Erbgut (Genom) am Computer Prof. Dr. Antje Krause FH Bingen 06721 / 409 253 akrause@fh-bingen.de Binger Nacht der Wissenschaft - 16.04.2010 Das menschliche Genom ist entschlüsselt

Mehr

Sortieralgorithmen. Inhalt: InsertionSort BubbleSort QuickSort. Marco Block

Sortieralgorithmen. Inhalt: InsertionSort BubbleSort QuickSort. Marco Block Inhalt: InsertionSort BubbleSort QuickSort Block M.: "Java-Intensivkurs - In 14 Tagen lernen Projekte erfolgreich zu realisieren", Springer-Verlag 2007 InsertionSort I Das Problem unsortierte Daten in

Mehr

IT-Basics 2. DI Gerhard Fließ

IT-Basics 2. DI Gerhard Fließ IT-Basics 2 DI Gerhard Fließ Wer bin ich? DI Gerhard Fließ Telematik Studium an der TU Graz Softwareentwickler XiTrust www.xitrust.com www.tugraz.at Worum geht es? Objektorientierte Programmierung Konzepte

Mehr

Klonierung von S2P Rolle der M19-Zellen. POL-Seminar der Biochemie II 13.02.2007 Sebastian Gabriel

Klonierung von S2P Rolle der M19-Zellen. POL-Seminar der Biochemie II 13.02.2007 Sebastian Gabriel Klonierung von S2P Rolle der M19-Zellen POL-Seminar der Biochemie II 13.02.2007 Sebastian Gabriel Inhalt 1. Was ist eine humane genomische DNA-Bank? 2. Unterschied zwischen cdna-bank und genomischer DNA-Bank?

Mehr

Informatik I. Informatik I. 6.1 Programme. 6.2 Programme schreiben. 6.3 Programme starten. 6.4 Programme entwickeln. 6.1 Programme.

Informatik I. Informatik I. 6.1 Programme. 6.2 Programme schreiben. 6.3 Programme starten. 6.4 Programme entwickeln. 6.1 Programme. Informatik I 05. November 2013 6. Python-, kommentieren, starten und entwickeln Informatik I 6. Python-, kommentieren, starten und entwickeln Bernhard Nebel Albert-Ludwigs-Universität Freiburg 05. November

Mehr

Informatik. Studiengang Chemische Technologie. Michael Roth WS 2012/2013. michael.roth@h-da.de. Hochschule Darmstadt -Fachbereich Informatik-

Informatik. Studiengang Chemische Technologie. Michael Roth WS 2012/2013. michael.roth@h-da.de. Hochschule Darmstadt -Fachbereich Informatik- Informatik Studiengang Chemische Technologie Michael Roth michael.roth@h-da.de Hochschule Darmstadt -Fachbereich Informatik- WS 2012/2013 Inhalt Teil VII Einstieg in Java I Michael Roth (h_da) Informatik

Mehr

Applied Bioinformatics. maria.fischer@i-med.ac.at http://icbi.at/courses/bioinformatics_ex

Applied Bioinformatics. maria.fischer@i-med.ac.at http://icbi.at/courses/bioinformatics_ex Applied Bioinformatics SS 2013 maria.fischer@i-med.ac.at http://icbi.at/courses/bioinformatics_ex Organisatorisches Termine Mo 18.03.2013 RR19 9:00 Di 19.03.2013 RR19 9:00 Mi 20.03.2013 RR19 9:00 Übungsziele

Mehr

Informatik II Greedy-Algorithmen

Informatik II Greedy-Algorithmen 7/7/06 lausthal Erinnerung: Dynamische Programmierung Informatik II reedy-algorithmen. Zachmann lausthal University, ermany zach@in.tu-clausthal.de Zusammenfassung der grundlegenden Idee: Optimale Sub-Struktur:

Mehr

Vom Gen zum Protein. Zusammenfassung Kapitel 17. Die Verbindung zwischen Gen und Protein. Gene spezifizieren Proteine

Vom Gen zum Protein. Zusammenfassung Kapitel 17. Die Verbindung zwischen Gen und Protein. Gene spezifizieren Proteine Zusammenfassung Kapitel 17 Vom Gen zum Protein Die Verbindung zwischen Gen und Protein Gene spezifizieren Proteine Zellen bauen organische Moleküle über Stoffwechselprozesse auf und ab. Diese Prozesse

Mehr

Molekulargenetik 1. 1.1 DNA-Struktur. 1.1.1 Nukleotide

Molekulargenetik 1. 1.1 DNA-Struktur. 1.1.1 Nukleotide O:/Wiley/Reihe_verdammt_klever/Fletcher/3d/c01.3d from 15.08.2013 17:16:38 1 Molekulargenetik 1 In diesem Kapitel geht es um diese Themen: DNA-Struktur Gene Der genetische Code Von der DNA zum Protein

Mehr

Betreutes Programmieren Vorlesung Informatik II, Blatt 7 Musterlösung

Betreutes Programmieren Vorlesung Informatik II, Blatt 7 Musterlösung SS 2011 Fakultät für Angewandte Informatik Lehrprofessur für Informatik 15.06.2011 Prof. Dr. Robert Lorenz Betreutes Programmieren Vorlesung Informatik II, Blatt 7 Musterlösung Programmieraufwand für geübte

Mehr

Grundideen der Gentechnik

Grundideen der Gentechnik Grundideen der Gentechnik Die Gentechnik kombiniert Biotechnik und Züchtung. Wie in der Züchtung wird die Erbinformation eines Lebewesen verändert. Dabei nutzte man in den Anfängen der Gentechnik vor allem

Mehr

Programmiersprachen in der Bioinformatik

Programmiersprachen in der Bioinformatik Programmiersprachen in der Bioinformatik Bioinformatik In der Biologie immer größere Datenmengen (z.b. Genome, Proteinsequenzen) Sequenzanalyse, Strukturvorhersage Informationen in Datenbanken abrufbar

Mehr

Kapiteltests zum Leitprogramm Binäre Suchbäume

Kapiteltests zum Leitprogramm Binäre Suchbäume Kapiteltests zum Leitprogramm Binäre Suchbäume Björn Steffen Timur Erdag überarbeitet von Christina Class Binäre Suchbäume Kapiteltests für das ETH-Leitprogramm Adressaten und Institutionen Das Leitprogramm

Mehr

5 DATEN. 5.1. Variablen. Variablen können beliebige Werte zugewiesen und im Gegensatz zu

5 DATEN. 5.1. Variablen. Variablen können beliebige Werte zugewiesen und im Gegensatz zu Daten Makro + VBA effektiv 5 DATEN 5.1. Variablen Variablen können beliebige Werte zugewiesen und im Gegensatz zu Konstanten jederzeit im Programm verändert werden. Als Variablen können beliebige Zeichenketten

Mehr

Grundlagen der Informatik I Informationsdarstellung

Grundlagen der Informatik I Informationsdarstellung Grundlagen der Informatik I Informationsdarstellung Einführung in die Informatik, Gumm, H.-P./Sommer, M. Themen der heutigen Veranstaltung. ASCIi Code 2. Zeichenketten 3. Logische Operationen 4. Zahlendarstellung

Mehr

Eine neue RNA-Welt. Uralte RNA-Welt Am Anfang der Entstehung des Lebens. Bekannte RNA-Welt Protein-Synthese. Neue RNA-Welt Regulatorische RNA-Moleküle

Eine neue RNA-Welt. Uralte RNA-Welt Am Anfang der Entstehung des Lebens. Bekannte RNA-Welt Protein-Synthese. Neue RNA-Welt Regulatorische RNA-Moleküle RNAs Eine neue RNA-Welt 1. Uralte RNA-Welt Am Anfang der Entstehung des Lebens Bekannte RNA-Welt Protein-Synthese Neue RNA-Welt Regulatorische RNA-Moleküle 2. Eine neue RNA-Welt die Anzahl der nicht-kodierenden

Mehr

Einführung in die Programmierung mit Java

Einführung in die Programmierung mit Java Einführung in die Programmierung mit Martin Wirsing 2 Ziele Begriffsbildungen: Informatik, Algorithmus, Programm... Warum als Programmiersprache verwenden? Ein einfaches -Programm erstellen, übersetzen

Mehr

MOL.504 Analyse von DNA- und Proteinsequenzen

MOL.504 Analyse von DNA- und Proteinsequenzen MOL.504 Analyse von DNA- und Proteinsequenzen Kurs 1 Monika Oberer, Karl Gruber MOL.504 Modul-Übersicht Einführung, Datenbanken BLAST-Suche, Sequenzalignment Proteinstrukturen Virtuelles Klonieren Abschlusstest

Mehr

Fakultät Angewandte Informatik Programmierung verteilter Systeme 28.11.2011. Übungen zur Vorlesung Informatik II, Blatt 6

Fakultät Angewandte Informatik Programmierung verteilter Systeme 28.11.2011. Übungen zur Vorlesung Informatik II, Blatt 6 WS 2011/12 Fakultät Angewandte Informatik Programmierung verteilter Systeme 28.11.2011 Prof. Dr. Bernhard Bauer Übungen zur Vorlesung Informatik II, Blatt 6 Abgabe: Montag, 05.12.2011, 12.00 Uhr, Informatik

Mehr

Antwort: 2.Uracil. Antwort: 2. durch Wasserstoffverbindungen. Adenin, Cystein und Guanin kommen alle in der RNA und DNA vor.

Antwort: 2.Uracil. Antwort: 2. durch Wasserstoffverbindungen. Adenin, Cystein und Guanin kommen alle in der RNA und DNA vor. Antwort: 2.Uracil Adenin, Cystein und Guanin kommen alle in der RNA und DNA vor. Thymin kommt nur in der DNA vor; Uracil nimmt seinen Platz in den RNA- Molekülen ein. Antwort: 2. durch Wasserstoffverbindungen

Mehr

Frage 1 A: Wieviele Codone des "Universellen genetisches Codes" kodieren:

Frage 1 A: Wieviele Codone des Universellen genetisches Codes kodieren: Frage 1 A: Wieviele Codone des "Universellen genetisches Codes" kodieren: Aminosäuren Translationsstart Translationsstop? B: Welche biochemische Reaktion wird von Aminoazyl-tRNA-Synthetasen katalysiert?

Mehr

Proteinbiosynthese. Prof. Dr. Albert Duschl

Proteinbiosynthese. Prof. Dr. Albert Duschl Proteinbiosynthese Prof. Dr. Albert Duschl DNA/RNA/Protein Im Bereich von Genen sind die beiden Stränge der DNA nicht funktionell äquivalent, weil nur einer der beiden Stränge transkribiert, d.h. in RNA

Mehr

Q1 B1 KW 49. Genregulation

Q1 B1 KW 49. Genregulation Q1 B1 KW 49 Genregulation Transkription Posttranskription elle Modifikation Genregulation bei Eukaryoten Transkriptionsfaktoren (an TATA- Box) oder Silencer (verringert Transkription) und Enhancer (erhöht

Mehr

Entwurf von Algorithmen - Kontrollstrukturen

Entwurf von Algorithmen - Kontrollstrukturen Entwurf von Algorithmen - Kontrollstrukturen Eine wichtige Phase in der Entwicklung von Computerprogrammen ist der Entwurf von Algorithmen. Dieser Arbeitsschritt vor dem Schreiben des Programmes in einer

Mehr

Steuern des GSR-Interface mit QBasic

Steuern des GSR-Interface mit QBasic Steuern des GSR-Interface mit QBasic Erstellt von Jochen Sendler, Geschwister-Scholl-Realschule Mannheim Inhaltsverzeichnis 1. Die Programmiersprache QBasic 3 2. Starten von QBasic 3 3. Ansteuern einzelner

Mehr

Kontrollstrukturen - Universität Köln

Kontrollstrukturen - Universität Köln Kontrollstrukturen - Universität Köln Mario Manno Kontrollstrukturen - Universität Köln p. 1 Was sind Sprachen Auszeichnungssprachen HTML, XML Programmiersprachen ASM, Basic, C, C++, Haskell, Java, Pascal,

Mehr

PIWIN I. Praktische Informatik für Wirtschaftsmathematiker, Ingenieure und Naturwissenschaftler I. Vorlesung 3 SWS WS 2007/2008

PIWIN I. Praktische Informatik für Wirtschaftsmathematiker, Ingenieure und Naturwissenschaftler I. Vorlesung 3 SWS WS 2007/2008 PIWIN I Kap. 7 Objektorientierte Programmierung - Einführung 1 PIWIN I Praktische Informatik für Wirtschaftsmathematiker, Ingenieure und Naturwissenschaftler I Vorlesung 3 SWS WS 2007/2008 FB Informatik

Mehr

1. PCR Polymerase-Kettenreaktion

1. PCR Polymerase-Kettenreaktion entechnische Verfahren 1. PCR Polymerase-Kettenreaktion Die PCR (engl. Polymerase Chain Reaction) ist eine Methode, um die DNA zu vervielfältigen, ohne einen lebenden Organismus, wie z.b. Escherichia coli

Mehr

Linux Prinzipien und Programmierung

Linux Prinzipien und Programmierung Linux Prinzipien und Programmierung Dr. Klaus Höppner Hochschule Darmstadt Sommersemester 2014 1 / 25 2 / 25 Pipes Die Bash kennt drei Standard-Dateideskriptoren: Standard In (stdin) Standard-Eingabe,

Mehr

1. Nachschreibeklausur zur Vorlesung "Genetik" im WS 09/10 A. Matrikel-Nr.: Versuch: 1 2 3

1. Nachschreibeklausur zur Vorlesung Genetik im WS 09/10 A. Matrikel-Nr.: Versuch: 1 2 3 1. Nachschreibeklausur zur Vorlesung "Genetik" im WS 09/10 A Modul: Studiengang: Matrikel-Nr.: Versuch: 1 2 3 Vollständiger Name in Druckbuchstaben (Vorname Nachname): Jena, 01.04.2010, 10 12 Uhr; Unterschrift:

Mehr

Homologie und Sequenzähnlichkeit. Prof. Dr. Antje Krause FH Bingen 06721 / 409 253 akrause@fh-bingen.de

Homologie und Sequenzähnlichkeit. Prof. Dr. Antje Krause FH Bingen 06721 / 409 253 akrause@fh-bingen.de Homologie und Sequenzähnlichkeit Prof. Dr. Antje Krause FH Bingen 06721 / 409 253 akrause@fh-bingen.de Homologie Verwandtschaft aufgrund gleicher Abstammung basiert auf Speziation (Artbildung): aus einer

Mehr

Statistische Methoden in der Bioinformatik

Statistische Methoden in der Bioinformatik Statistische Methoden in der Bioinformatik Prof. Dr. Jörg Rahnenführer Raum 720 Email: rahnenfuehrer@statistik. tu-.de Voraussetzungen: Vordiplom in Statistik, Mathematik, Datenanalyse, Informatik Zeiten

Mehr

Schritt 1. Schritt 1. Schritt 3. - Analysieren des Problems und Spezifizierung einer Lösung.

Schritt 1. Schritt 1. Schritt 3. - Analysieren des Problems und Spezifizierung einer Lösung. I. Programmierung ================================================================== Programmierung ist die Planung einer Abfolge von Schritten (Instruktionen), nach denen ein Computer handeln soll. Schritt

Mehr

IV. Übungsaufgaben für die Jahrgangstufe 9 & 10

IV. Übungsaufgaben für die Jahrgangstufe 9 & 10 IV. Übungsaufgaben für die Jahrgangstufe 9 & 10 Von der Erbanlage zum Erbmerkmal: 34) Welche Aufgaben haben Chromosomen? 35) Zeichne und benenne die Teile eines Chromosoms, wie sie im Lichtmikroskop während

Mehr