Die Suche nach Genen in Bakteriengenomen. BWInf-Workshop März Prof. Dr. Sven Rahmann AG Bioinformatik Informatik XI, TU Dortmund

Save this PDF as:
 WORD  PNG  TXT  JPG

Größe: px
Ab Seite anzeigen:

Download "Die Suche nach Genen in Bakteriengenomen. BWInf-Workshop 22.-23. März 2011. Prof. Dr. Sven Rahmann AG Bioinformatik Informatik XI, TU Dortmund"

Transkript

1 Die Suche nach Genen in Bakteriengenomen BWInf-Workshop März 2011 Prof. Dr. Sven Rahmann AG Bioinformatik Informatik XI, TU Dortmund 1

2 Bioinformatik was ist das? Aufgabe: Analyse (molekular)biologischer Daten mit Methoden der Informatik Teilgebiet: Sequenzanalyse Analyse von DNA-, RNA-, Proteinsequenzen Speziell an der Universität: Erforschung und Entwicklung neuer solcher Methoden 2

3 Das zentrale Dogma der Molekularbiologie: Informationsverarbeitung in der Zelle DNA enthält Erbinformation (bei Viren oft RNA) Diese wird abgelesen (Transkription) in mrna Anhand der mrna-sequenz wird ein Proteinmolekül erstellt (Translation) Proteine führen Funktionen in der Zelle aus. Der Informationsfluss ist also DNA -> RNA -> Protein. (Diese Sichtweise ist nicht immer korrekt.) 3

4 DNA-Struktur: Biopolymer aus 4 Basen 4

5 DNA-Struktur: Biopolymer aus 4 Basen Darstellung von DNA-Sequenzen als Zeichenketten (Strings) Alphabet: 4 Buchstaben {A,C,G,T} Länge: Millionen bis Milliarden Zeichen (Einheit: nt, bp) Algorithmen auf Zeichenketten erlauben Analyse von Genomen. 5

6 Transkription von DNA in messenger RNA (mrna) 6

7 Proteine sind Ketten von Aminosäuren 7

8 21 Aminosäuren Illustration: Dan Cojocari, Toronto 8

9 Translation von mrna in Protein am Ribosom 9

10 Genetischer Code: 3 nt => 1 aa Formaler Übersetzungsprozess Lies jeweils 3 nt Suche dazu die passende Aminosäure Hänge diese aneinander, bis die DNA-Sequenz erschöpft ist. Beachte auch: Start, Stopp Base1 Base2 Base3 AA = = = = TTTTTTTTTTTTTTTT TTTTCCCCAAAAGGGG TCAGTCAGTCAGTCAG FFLLSSSSYY**CC*W CCCCCCCCCCCCCCCC TTTTCCCCAAAAGGGG TCAGTCAGTCAGTCAG LLLLPPPPHHQQRRRR AAAAAAAAAAAAAAAA TTTTCCCCAAAAGGGG TCAGTCAGTCAGTCAG IIIMTTTTNNKKSSRR GGGGGGGGGGGGGGGG TTTTCCCCAAAAGGGG TCAGTCAGTCAGTCAG 10 VVVVAAAADDEEGGGG

11 Offene Leserahmen (open reading frames, ORFs) Eine DNA-Sequenz kann auf 6 Arten interpretiert werden (Leseraster). 3 Startpositionen 2 Richtungen Protein-kodierende Bereiche (inkorrekterweise "Gene" genannt) beginnen mit Startcodon enthalten darauf folgend viele "normale" Codons enden mit Stopp-Codon Name für eine solche Struktur: ORF Jedes Gen ist ein ORF, aber nicht umgekehrt ORFs finden ist leicht, Gene finden schwierig. Aufgabe: Finde alle ORFs in allen Leserastern in einem Bakteriengenom. 11

12 Beispiel: Übersetzung DNA -> Protein (Nichtstrukturprotein NS1 des H1N1-Grippevirus, Patient aus Puerto Rico im Jahr 1934) ATGGATCCAAACACTGTGTCAAGCTTTCAGGTAGATTGCTTTCTTTGGCATGTCCGCAAACGAGTTGCAG ACCAAGAACTAGGTGATGCCCCATTCCTTGATCGGCTTCGCCGAGATCAGAAATCCCTAAGAGGAAGGGG CAGCACTCTTGGTCTGGACATCGAGACAGCCACACGTGCTGGAAAGCAGATAGTGGAGCGGATTCTGAAA GAAGAATCCGATGAGGCACTTAAAATGACCATGGCCTCTGTACCTGCGTCGCGTTACCTAACCGACATGA CTCTTGAGGAAATGTCAAGGGAATGGTCCATGCTCATACCCAAGCAGAAAGTGGCAGGCCCTCTTTGTAT CAGAATGGACCAGGCGATCATGGATAAAAACATCATACTGAAAGCGAACTTCAGTGTGATTTTTGACCGG CTGGAGACTCTAATATTGCTAAGGGCTTTCACCGAAGAGGGAGCAATTGTTGGCGAAATTTCACCATTGC CTTCTCTTCCAGGACATACTGCTGAGGATGTCAAAAATGCAGTTGGAGTCCTCATCGGAGGACTTGAATG GAATGATAACACAGTTCGAGTCTCTGAAACTCTACAGAGATTCGCTTGGAGAAGCAGTAATGAGAATGGG AGACCTCCACTCACTCCAAAACAGAAACGAGAAATGGCGGGAACAATTAGGTCAGAAGTTTGA MDPNTVSSFQVDCFLWHVRKRVADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILKE ESDEALKMTMASVPASRYLTDMTLEEMSREWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLE TLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEWNDNTVRVSETLQRFAWRSSNENGRPP LTPKQKREMAGTIRSEV. 12

13 Aufgabe Gegeben: Bakteriengenom (mehrere Millionen bp) Dateiformat wird noch erläutert Gesucht: Liste aller ORFs (Start- und Endposition, Strang), evtl. deren Eigenschaften (Länge, Bewertung) Vorgehen: Diskussion verschiedener algorithmischer Strategien Bewertung der Effizienz Aufteilung in Unterprobleme Implementierung in Python Test, Anwendung auf Genome Projektpräsentation 13

14 Übungen Wie lautet die Aminosäuresequenz zu ATGCTTGGG? GAGATTAC? Wie lauten die Aminosäuresequenzen in allen 6 Leserastern? Wie viele Möglichkeiten gibt es, diese Aminosäuresequenz zu erzeugen? ILSW Base1 Base2 Base3 AA = = = = TTTTTTTTTTTTTTTT TTTTCCCCAAAAGGGG TCAGTCAGTCAGTCAG FFLLSSSSYY**CC*W CCCCCCCCCCCCCCCC TTTTCCCCAAAAGGGG TCAGTCAGTCAGTCAG LLLLPPPPHHQQRRRR AAAAAAAAAAAAAAAA TTTTCCCCAAAAGGGG TCAGTCAGTCAGTCAG IIIMTTTTNNKKSSRR GGGGGGGGGGGGGGGG TTTTCCCCAAAAGGGG TCAGTCAGTCAGTCAG 14 VVVVAAAADDEEGGGG

15 Wie bringe ich den genetischen Code dem Computer bei? Hängt von der Programmiersprache ab. Hier am Beispiel von Python (www.python.org): Erstelle ein "Wörterbuch" (engl. dictionary), in Python: dict. Dessen Name sei 'aa' (für amino acids). Mit aa["atg"] erhält man die Aminosäure zum Codon ATG. Das ist langweilige Tipparbeit... aa = dict( ATA="I", ATC="I", ATT="I", ATG="M",...) 15

16 Wie bringe ich den genetischen Code dem Computer bei? Jetzt benötigen wir: Funktion, die eine Sequenz in Tripel zerlegt. Funktion, die zu einer DNA-Sequenz eine Folge von Aminosäuren erstellt Funktion, die die Folge von Aminosäuren zu einem Protein verbindet Erzeugung aller Tripel einer Sequenz: def triples(seq): """gibt zu einer Sequenz 'seq' alle Tripel zurueck.""" it = iter(seq) # Iterator der Sequenz while it: yield (next(it),next(it),next(it)) 16

17 Erklärungen zu triples() def definiert eine neue Funktion. Ihr Name ist triples Sie hat ein Argument; das heißt seq. Die Zeile mit den """... """ ist ein Kommentar (Hilfe) zur Funktion. iter() liefert einen Iterator. Ein Iterator ist ein Objekt, das über ein anderes Objekt iteriert, d.h. alle Elemente dieses Objektes nacheinander besucht. Dies geschieht solange wie der Iterator noch nicht erschöpft ist (while it) Auf das jeweils nächste Element wird mit next() zugegriffen. Dies geschieht immer 3x, so dass ein Tripel erzeugt wird Die yield-anweisung unterbricht die Funktion und liefert ein Tripel zurück. def triples(seq): """gibt zu einer Sequenz 'seq' alle Tripel zurueck.""" it = iter(seq) # Iterator der Sequenz while it: 17 yield (next(it),next(it),next(it))

18 Übung Was passiert (irgendwann), wenn die Länge der Sequenz seq kein Vielfaches von 3 ist? def triples(seq): """gibt zu einer Sequenz 'seq' alle Tripel zurueck.""" it = iter(seq) # Iterator der Sequenz while it: yield (next(it),next(it),next(it)) 18

19 Wie bringe ich den genetischen Code dem Computer bei? Wir benötigen: Funktion, die eine Sequenz in Tripel zerlegt. Funktion, die zu einer DNA-Sequenz eine Folge von Aminosäuren erstellt Funktion, die die Folge von Aminosäuren zu einem Protein verbindet Erzeugung der Folge der Aminosäuren: def aminoacids(dna): """gibt Aminosaeuren zur DNA-Sequenz 'dna' zurueck.""" for t in triples(dna): codon = "".join(t) yield aa[codon] 19

20 Erklärungen zu aminoacids() Die Funktion aminoacids() bekommt eine DNA-Sequenz übergeben. Wir iterieren über alle Tripel mit Hilfe der definierten Funktion triples(). Da triples() eine yield-anweisung enthält, ist sie eine Generator-Funktion. Deswegen kann man sie als "Container" in einer for-schleife verwenden. Wann immer triples() ein neues Tripel erzeugt hat, wird der Rumpf der forschleife ausgeführt; das Tripel heißt hier t. Um im genetischen Code die zugehörige Aminosäure zu finden, muss aus dem Tripel (z.b. ("A","G","T")) erst das Codon (z.b. "AGT") erstellt werden. Dies geschieht mit Hilfe der join-methode. Die Aminosäure wird im genetischen Code (aa) nachgeschlagen. Auch aminoacids() ist eine Generator-Funktion. Sie liefert nacheinander die Aminosäuren an die aufrufende Routine. def aminoacids(dna): """gibt Aminosaeuren zur DNA-Sequenz 'dna' zurueck.""" for t in triples(dna): codon = "".join(t) 20 yield aa[codon]

21 Wie bringe ich den genetischen Code dem Computer bei? Wir benötigen: Funktion, die eine Sequenz in Tripel zerlegt. Funktion, die zu einer DNA-Sequenz eine Folge von Aminosäuren erstellt Funktion, die die Folge von Aminosäuren zu einem Protein verbindet def protein(dna): return "".join(aminoacids(dna)) Wir müssen die Folge der Aminosäuren zu einer Zeichenkette verbinden. Dies geschieht wieder mit der join-methode und dem leeren String als Verbinder. Die return-anweisung liefert den Ausdruck dahinter zurück und beendet die Funktion. 21

Rekonstruktion biologischer Netzwerke (mit probabilistischen Methoden) Einführung 11.10.2010

Rekonstruktion biologischer Netzwerke (mit probabilistischen Methoden) Einführung 11.10.2010 Rekonstruktion biologischer Netzwerke (mit probabilistischen Methoden) Einführung 11.10.2010 Prof. Dr. Sven Rahmann 1 Team Prof. Dr. Sven Rahmann Zeit Mo 10-12; Do 8:30-10 Ort OH14, R104 Alle Informationen

Mehr

Algorithmen auf Sequenzen 12.04.2010

Algorithmen auf Sequenzen 12.04.2010 Algorithmen auf Sequenzen 12.04.2010 Prof. Dr. Sven Rahmann 1 Team Prof. Dr. Sven Rahmann Dipl.-Inform Tobias Marschall (Skript) Zeit Mo 8:30-10; Übungen Mi 8:30-10 ca. alle 2 Wochen (Plan!) Ort OH14,

Mehr

DATENQUALITÄT IN GENOMDATENBANKEN

DATENQUALITÄT IN GENOMDATENBANKEN DATENQUALITÄT IN GENOMDATENBANKEN Alexander Fehr 28. Januar 2004 Gliederung Motivation Biologische Grundkonzepte Genomdaten Datenproduktion und Fehler Data Cleansing 2 Motivation (1) Genomdatenbanken enthalten

Mehr

Biologie I/B: Klassische und molekulare Genetik, molekulare Grundlagen der Entwicklung Theoretische Übungen SS 2014

Biologie I/B: Klassische und molekulare Genetik, molekulare Grundlagen der Entwicklung Theoretische Übungen SS 2014 Biologie I/B: Klassische und molekulare Genetik, molekulare Grundlagen der Entwicklung Theoretische Übungen SS 2014 Fragen für die Übungsstunde 8 (14.07-18.07.) 1) Von der DNA-Sequenz zum Protein Sie können

Mehr

Beispiel 19. December 4, 2009

Beispiel 19. December 4, 2009 Beispiel 9 December 4, 2009 Computermathematik (für Informatik) 4. Übungsblatt (Musterlösung) 2. 2. 2009 Die heutigen Übungen sollen mit dem Computeralgebrasystem Sage gelöst werden. Die Lösung der Beispiele

Mehr

Bioinformatik für Biochemiker

Bioinformatik für Biochemiker Bioinformatik für Biochemiker Oliver Kohlbacher, Steffen Schmidt SS 2010 3. Strings, Sequenzen und Python Abt. Simulation biologischer Systeme WSI/ZBIT, Eberhard Karls Universität Tübingen Übersicht Strings

Mehr

Evolution & Genetik (Beispiel Hämoglobin) Prof. Dr. Antje Krause FH Bingen 06721 / 409 253 akrause@fh-bingen.de

Evolution & Genetik (Beispiel Hämoglobin) Prof. Dr. Antje Krause FH Bingen 06721 / 409 253 akrause@fh-bingen.de Evolution & Genetik (Beispiel Hämoglobin) Prof. Dr. Antje Krause FH Bingen 06721 / 409 253 akrause@fh-bingen.de DNA (Desoxyribonukleinsäure) 5 3 CGATGTACATCG GCTACATGTAGC 3 5 Doppelhelix Basen: Adenin,

Mehr

Informatik I. Informatik I Iteratoren Generatoren Das Modul itertools. Iterierbare Objekte Iteratoren. Python-Interpreter

Informatik I. Informatik I Iteratoren Generatoren Das Modul itertools. Iterierbare Objekte Iteratoren. Python-Interpreter Informatik I 28.01.2014 25. und Informatik I 25. und Bernhard Nebel Albert-Ludwigs-Universität Freiburg 25.1 25.2 25.3 Das Modul itertools 28.01.2014 Bernhard Nebel (Universität Freiburg) Informatik I

Mehr

Gen Protein Aufgaben: Edel LK-Bio BI-3

Gen Protein Aufgaben: Edel LK-Bio BI-3 Proteinbiosynthese Von der DNA zum Protein Dieses Lernprogramm zeigt Ihnen in einem vereinfachten Modell den im Zellinneren ablaufenden Prozess vom Gen auf der DNA zum Protein. Aufgaben: 1 Betrachten Sie

Mehr

Dr. Jens Kurreck. Otto-Hahn-Bau, Thielallee 63, Raum 029 Tel.: 83 85 69 69 Email: jkurreck@chemie.fu-berlin.de

Dr. Jens Kurreck. Otto-Hahn-Bau, Thielallee 63, Raum 029 Tel.: 83 85 69 69 Email: jkurreck@chemie.fu-berlin.de Dr. Jens Kurreck Otto-Hahn-Bau, Thielallee 63, Raum 029 Tel.: 83 85 69 69 Email: jkurreck@chemie.fu-berlin.de Prinzipien genetischer Informationsübertragung Berg, Tymoczko, Stryer: Biochemie 5. Auflage,

Mehr

Bioinformatik: Hype oder Hoffnung?

Bioinformatik: Hype oder Hoffnung? Bioinformatik: Hype oder Hoffnung? Florian Markowetz Max-Planck-Institut für Molekulare Genetik Computational Molecular Biology Berlin Career Nights AKG Bensheim, 28. Januar 2005 1 Florian Markowetz, Bioinformatik:

Mehr

368 4 Algorithmen und Datenstrukturen

368 4 Algorithmen und Datenstrukturen Kap04.fm Seite 368 Dienstag, 7. September 2010 1:51 13 368 4 Algorithmen und Datenstrukturen Java-Klassen Die ist die Klasse Object, ein Pfeil von Klasse A nach Klasse B bedeutet Bextends A, d.h. B ist

Mehr

Grundlagen der Theoretischen Informatik, SoSe 2008

Grundlagen der Theoretischen Informatik, SoSe 2008 1. Aufgabenblatt zur Vorlesung Grundlagen der Theoretischen Informatik, SoSe 2008 (Dr. Frank Hoffmann) Lösung von Manuel Jain und Benjamin Bortfeldt Aufgabe 2 Zustandsdiagramme (6 Punkte, wird korrigiert)

Mehr

Formale Sprachen und Grammatiken

Formale Sprachen und Grammatiken Formale Sprachen und Grammatiken Jede Sprache besitzt die Aspekte Semantik (Bedeutung) und Syntax (formaler Aufbau). Die zulässige und korrekte Form der Wörter und Sätze einer Sprache wird durch die Syntax

Mehr

Modul 8: Bioinformatik A. Von der DNA zum Protein Proteinsynthese in silicio

Modul 8: Bioinformatik A. Von der DNA zum Protein Proteinsynthese in silicio Modul 8: Bioinformatik A. Von der DNA zum Protein Proteinsynthese in silicio Ein Wissenschaftler erhält nach einer Sequenzierung folgenden Ausschnitt aus einer DNA-Sequenz: 5 ctaccatcaa tccggtaggt tttccggctg

Mehr

Inhalt Genexpression Microarrays E-Northern

Inhalt Genexpression Microarrays E-Northern Inhalt Genexpression Microarrays E-Northern Genexpression Übersicht Definition Proteinbiosynthese Ablauf Transkription Translation Transport Expressionskontrolle Genexpression: Definition Realisierung

Mehr

Molekularbiologie 6c Proteinbiosynthese. Bei der Proteinbiosynthese geht es darum, wie die Information der DNA konkret in ein Protein umgesetzt wird

Molekularbiologie 6c Proteinbiosynthese. Bei der Proteinbiosynthese geht es darum, wie die Information der DNA konkret in ein Protein umgesetzt wird Molekularbiologie 6c Proteinbiosynthese Bei der Proteinbiosynthese geht es darum, wie die Information der DNA konkret in ein Protein umgesetzt wird 1 Übersicht: Vom Gen zum Protein 1. 2. 3. 2 Das Dogma

Mehr

Molekulargenetik Biologie am Inhaltsverzeichnis Die Begriffe DNA, Nukleotid, Gen, Chromosom und Epigenom definieren...

Molekulargenetik Biologie am Inhaltsverzeichnis Die Begriffe DNA, Nukleotid, Gen, Chromosom und Epigenom definieren... Molekulargenetik Inhaltsverzeichnis Die Begriffe DNA, Nukleotid, Gen, Chromosom und Epigenom definieren... 2 Beschreiben, wie die DNA aufgebaut ist... 3 Den Ablauf der Replikation erklären und dabei die

Mehr

Grafische Interaktionssysteme/ dynamische Visualisierung des endlichen Automaten

Grafische Interaktionssysteme/ dynamische Visualisierung des endlichen Automaten Sprachliche Informationsverarbeitung 29.01.2007 HS Intelligente Systeme Prof. Dr. J. Rolshoven (WS 06/07) Grafische Interaktionssysteme/ dynamische Visualisierung des endlichen Automaten Referentin: Melinda

Mehr

In den Proteinen der Lebewesen treten in der Regel 20 verschiedene Aminosäuren auf. Deren Reihenfolge muss in der Nucleotidsequenz der mrna und damit

In den Proteinen der Lebewesen treten in der Regel 20 verschiedene Aminosäuren auf. Deren Reihenfolge muss in der Nucleotidsequenz der mrna und damit In den Proteinen der Lebewesen treten in der Regel 20 verschiedene Aminosäuren auf. Deren Reihenfolge muss in der Nucleotidsequenz der mrna und damit in der Nucleotidsequenz der DNA verschlüsselt (codiert)

Mehr

Seminar Biomedical Informatics

Seminar Biomedical Informatics Martin Dugas und Xiaoyi Jiang Institut für Informatik Sommersemester 2017 Organisation Vorlage: Englischsprachige Publikation Vortrag: ca. 30min + 15min Diskussion, Hand-out, Blockseminar Anfang Juni Seminararbeit:

Mehr

Python im Bioinformatiker-Alltag

Python im Bioinformatiker-Alltag Python im Bioinformatiker-Alltag Marcel Martin Bioinformatik für Hochdurchsatztechnologien, TU Dortmund 6. Oktober 2011 1 von 27 Worum gehts? Bioinformatik Löst Probleme in Biologie oder Medizin Teilbereich

Mehr

VBA-Programmierung: Zusammenfassung

VBA-Programmierung: Zusammenfassung VBA-Programmierung: Zusammenfassung Programmiersprachen (Definition, Einordnung VBA) Softwareentwicklung-Phasen: 1. Spezifikation 2. Entwurf 3. Implementierung Datentypen (einfach, zusammengesetzt) Programmablaufsteuerung

Mehr

Die DNA Replikation. Exakte Verdopplung des genetischen Materials. Musterstrang. Neuer Strang. Neuer Strang. Eltern-DNA-Doppelstrang.

Die DNA Replikation. Exakte Verdopplung des genetischen Materials. Musterstrang. Neuer Strang. Neuer Strang. Eltern-DNA-Doppelstrang. Die DNA Replikation Musterstrang Neuer Strang Eltern-DNA-Doppelstrang Neuer Strang Musterstrang Exakte Verdopplung des genetischen Materials Die Reaktion der DNA Polymerase 5`-Triphosphat Nächstes Desoxyribonucleosidtriphosphat

Mehr

Lehrstuhl Informatik VI Grundzüge der Informatik * WS 2008/2009 Prof. Dr. Joachim Biskup

Lehrstuhl Informatik VI Grundzüge der Informatik * WS 2008/2009 Prof. Dr. Joachim Biskup Universität Dortmund Lehrstuhl Informatik VI Grundzüge der Informatik * WS 28/29 Prof. Dr. Joachim Biskup Leitung der Übungen: Arno Pasternak Lösungs-Ideen Übungsblatt 6 A: Grammatiken, Syntaxdiagramme

Mehr

Folge 19 - Bäume. 19.1 Binärbäume - Allgemeines. Grundlagen: Ulrich Helmich: Informatik 2 mit BlueJ - Ein Kurs für die Stufe 12

Folge 19 - Bäume. 19.1 Binärbäume - Allgemeines. Grundlagen: Ulrich Helmich: Informatik 2 mit BlueJ - Ein Kurs für die Stufe 12 Grundlagen: Folge 19 - Bäume 19.1 Binärbäume - Allgemeines Unter Bäumen versteht man in der Informatik Datenstrukturen, bei denen jedes Element mindestens zwei Nachfolger hat. Bereits in der Folge 17 haben

Mehr

mrna S/D UTR: untranslated region orf: open reading frame S/D: Shine-Dalgarno Sequenz

mrna S/D UTR: untranslated region orf: open reading frame S/D: Shine-Dalgarno Sequenz 1. Nennen Sie die verschiedenen RNA-Typen, die bei der Translation wichtig sind. Erklären Sie die Funktion der verschiedenen RNA-Typen. Skizzieren Sie die Struktur der verschiedenen RNA-Typen und bezeichnen

Mehr

Genetik - The Human Genome Project. Überblick über die Genetik. Die gesamte Erbinformation eines Menschen befindet sich in jedem Zellkern

Genetik - The Human Genome Project. Überblick über die Genetik. Die gesamte Erbinformation eines Menschen befindet sich in jedem Zellkern Genetik - The Human Genome Project Überblick über die Genetik Die gesamte Erbinformation eines Menschen befindet sich in jedem Zellkern seines Körpers. 1 2 Im Organismus müsssen nun ständig Enzyme u. a.

Mehr

Musterlösung - Übung 5 Vorlesung Bio-Engineering Sommersemester 2008

Musterlösung - Übung 5 Vorlesung Bio-Engineering Sommersemester 2008 Aufgabe 1: Prinzipieller Ablauf der Proteinbiosynthese a) Erklären Sie folgende Begriffe möglichst in Ihren eigenen Worten (1 kurzer Satz): Gen Nukleotid RNA-Polymerase Promotor Codon Anti-Codon Stop-Codon

Mehr

PIWIN 1 Übung Blatt 5

PIWIN 1 Übung Blatt 5 Fakultät für Informatik Wintersemester 2008 André Gronemeier, LS 2, OH 14 Raum 307, andre.gronemeier@cs.uni-dortmund.de PIWIN 1 Übung Blatt 5 Ausgabedatum: 19.12.2008 Übungen: 12.1.2009-22.1.2009 Abgabe:

Mehr

Alignment-Verfahren zum Vergleich biologischer Sequenzen

Alignment-Verfahren zum Vergleich biologischer Sequenzen zum Vergleich biologischer Sequenzen Hans-Joachim Böckenhauer Dennis Komm Volkshochschule Zürich. April Ein biologisches Problem Fragestellung Finde eine Methode zum Vergleich von DNA-Molekülen oder Proteinen

Mehr

Grundideen der Gentechnik

Grundideen der Gentechnik Grundideen der Gentechnik Die Gentechnik kombiniert Biotechnik und Züchtung. Wie in der Züchtung wird die Erbinformation eines Lebewesen verändert. Dabei nutzte man in den Anfängen der Gentechnik vor allem

Mehr

M. Graefenhan 2000-12-07. Übungen zu C. Blatt 3. Musterlösung

M. Graefenhan 2000-12-07. Übungen zu C. Blatt 3. Musterlösung M. Graefenhan 2000-12-07 Aufgabe Lösungsweg Übungen zu C Blatt 3 Musterlösung Schreiben Sie ein Programm, das die Häufigkeit von Zeichen in einem eingelesenen String feststellt. Benutzen Sie dazu ein zweidimensionales

Mehr

Programmiersprachen Einführung in C. Unser erstes C-Programm. Unser erstes C-Programm. Unser erstes C-Programm. Unser erstes C-Programm

Programmiersprachen Einführung in C. Unser erstes C-Programm. Unser erstes C-Programm. Unser erstes C-Programm. Unser erstes C-Programm Programmiersprachen Einführung in C Teil 2: Prof. Dr. int main (int argc, char *argv[]) int sum = 0; for (i = 0; i

Mehr

Informatik für Schüler, Foliensatz 21 Objektorientierte Programmierung

Informatik für Schüler, Foliensatz 21 Objektorientierte Programmierung rof. G. Kemnitz Institut für Informatik, Technische Universität Clausthal 23. April 2009 1/14 Informatik für Schüler, Foliensatz 21 Objektorientierte Programmierung Prof. G. Kemnitz Institut für Informatik,

Mehr

Verbesserte Basenpaarung bei DNA-Analysen

Verbesserte Basenpaarung bei DNA-Analysen Powered by Seiten-Adresse: https://www.gesundheitsindustriebw.de/de/fachbeitrag/aktuell/verbesserte-basenpaarungbei-dna-analysen/ Verbesserte Basenpaarung bei DNA-Analysen Ein Team aus der Organischen

Mehr

Homologie und Sequenzähnlichkeit. Prof. Dr. Antje Krause FH Bingen 06721 / 409 253 akrause@fh-bingen.de

Homologie und Sequenzähnlichkeit. Prof. Dr. Antje Krause FH Bingen 06721 / 409 253 akrause@fh-bingen.de Homologie und Sequenzähnlichkeit Prof. Dr. Antje Krause FH Bingen 06721 / 409 253 akrause@fh-bingen.de Homologie Verwandtschaft aufgrund gleicher Abstammung basiert auf Speziation (Artbildung): aus einer

Mehr

22. Algorithmus der Woche Partnerschaftsvermittlung Drum prüfe, wer sich ewig bindet

22. Algorithmus der Woche Partnerschaftsvermittlung Drum prüfe, wer sich ewig bindet 22. Algorithmus der Woche Partnerschaftsvermittlung Drum prüfe, wer sich ewig bindet Autor Volker Claus, Universität Stuttgart Volker Diekert, Universität Stuttgart Holger Petersen, Universität Stuttgart

Mehr

Kapitel 3 Das Projekt Bankkonto Seite 1

Kapitel 3 Das Projekt Bankkonto Seite 1 Kapitel 3 Das Projekt Bankkonto Seite 1 3 Das Projekt Bankkonto Nun wirst du dich etwas gründlicher mit dem Quelltext einer Klasse beschäftigen. Du lernst, wie zwei Objekte eine gemeinsame Aufgabe erledigen.

Mehr

Kontrollstrukturen, Pseudocode und Modulo-Rechnung

Kontrollstrukturen, Pseudocode und Modulo-Rechnung Kontrollstrukturen, Pseudocode und Modulo-Rechnung CoMa-Übung III TU Berlin 29.10.2012 CoMa-Übung III (TU Berlin) Kontrollstrukturen, Pseudocode und Modulo-Rechnung 29.10.2012 1 / 1 Themen der Übung 1

Mehr

Wir übertragen Daten mit Licht

Wir übertragen Daten mit Licht Wir übertragen Daten mit Licht Durch das Internet werden täglich Unmengen von Daten von einem Ort an den anderen transportiert. Häufig geschieht dies über Glasfasern (Abb. 1). An dem einen Ende werden

Mehr

Drei-Schichten-Architektur. Informatik B - Objektorientierte Programmierung in Java. Vorlesung 16: 3-Schichten-Architektur 1 Fachkonzept - GUI

Drei-Schichten-Architektur. Informatik B - Objektorientierte Programmierung in Java. Vorlesung 16: 3-Schichten-Architektur 1 Fachkonzept - GUI Universität Osnabrück Drei-Schichten-Architektur 3 - Objektorientierte Programmierung in Java Vorlesung 6: 3-Schichten-Architektur Fachkonzept - GUI SS 2005 Prof. Dr. F.M. Thiesing, FH Dortmund Ein großer

Mehr

Sortieralgorithmen. Inhalt: InsertionSort BubbleSort QuickSort. Marco Block

Sortieralgorithmen. Inhalt: InsertionSort BubbleSort QuickSort. Marco Block Inhalt: InsertionSort BubbleSort QuickSort Block M.: "Java-Intensivkurs - In 14 Tagen lernen Projekte erfolgreich zu realisieren", Springer-Verlag 2007 InsertionSort I Das Problem unsortierte Daten in

Mehr

Objektorientierte Programmierung

Objektorientierte Programmierung Objektorientierte Programmierung Ein Computerprogramm besteht aus Funktionen (Programmabschnitten, die etwas tun) und Variablen (Speicherplätzen für Informationen). Werden Funktionen aktiviert, verändern

Mehr

Kompilieren und Linken

Kompilieren und Linken Kapitel 2 Kompilieren und Linken Bevor wir uns auf C++ selbst stürzen, brauchen wir einiges Vorgeplänkel, wie man komfortabel ein größeres C++- kompilieren kann. Mit Java stellt sich der Kompiliervorgang

Mehr

Klausur zum Modul Molekularbiologie ILS, SS 2010 Freitag 6. August 10:00 Uhr

Klausur zum Modul Molekularbiologie ILS, SS 2010 Freitag 6. August 10:00 Uhr Klausur zum Modul Molekularbiologie ILS, SS 2010 Freitag 6. August 10:00 Uhr Name: Matrikel-Nr.: Code Nummer: Bitte geben Sie Ihre Matrikel-Nr. und Ihren Namen an. Die Code-Nummer erhalten Sie zu Beginn

Mehr

Übungen für Woche 10

Übungen für Woche 10 Übungen für Woche 10 Martin Rubey 12. Januar 2011 Die folgenden Übungen sollen den Umgang mit Backtracking und kombinatorischen Spezies näherbringen. Genaue Hinweise gibt es erst auf Seite 5. Zur Erinnerung:

Mehr

syntax.tex Eine Übersicht

syntax.tex Eine Übersicht syntax.tex Eine Übersicht Bernd Worsch 7. Juli 1997 Inhaltsverzeichnis 1 Einleitung 1 2 Bevor es funktioniert... 1 3 Grundelemente von syntax.tex 1 4 Strukturelemente von syntax.tex 3 5 Setzen von Syntaxdiagrammen

Mehr

Kap. 4.2: Binäre Suchbäume

Kap. 4.2: Binäre Suchbäume Kap. 4.2: Binäre Suchbäume Professor Dr. Lehrstuhl für Algorithm Engineering, LS11 Fakultät für Informatik, TU Dortmund 11. VO DAP2 SS 2009 26. Mai 2009 1 Zusätzliche Lernraumbetreuung Morteza Monemizadeh:

Mehr

Programmieren in Python

Programmieren in Python Iteratoren und Generatoren Programmieren in Python 10. Iteratoren und Generatoren Malte Helmert Albert-Ludwigs-Universität Freiburg Überblick über diese Lektion: Iteratoren Generatoren Generator Comprehensions

Mehr

Objektorientierte Programmierung mit C++ Vector und List

Objektorientierte Programmierung mit C++ Vector und List Vector und List Ziel, Inhalt Wir lernen die Klassen vector und list aus der Standard-C++ Library kennen und anwenden. In einer Übung wenden wir diese Klassen an um einen Medienshop (CD s und Bücher) zu

Mehr

Schreibe ein Programm, das den AT Gehalt diese DNA Sequenz berechnet. Hinweis: A-Gehalt plus T-Gehalt bezogen auf die gesamte Sequenz.

Schreibe ein Programm, das den AT Gehalt diese DNA Sequenz berechnet. Hinweis: A-Gehalt plus T-Gehalt bezogen auf die gesamte Sequenz. 1 Einführung Keine Übungen 2 Python - Zeichenketten - "Strings" (1. Tag) 2.1 AT Gehalt berechnen Berechne aus der folgenden DNA Sequenz den AT-Gehalt. GAGATTTCTTTATTACAATCACTGTGTTTGTTAAAATACCTGCNTCACTTGGTTGTTCTTCAATAACACCAACTTA

Mehr

Erstellen einer GoTalk-Auflage

Erstellen einer GoTalk-Auflage Erstellen einer GoTalk-Auflage 1. Bei dem Startbild Vorlage öffnen wählen 2. In dem folgenden Fenster Geräte Schablonen doppelt anklicken. - und schon öffnet sich der gesamte Katalog der verfügbaren Talker-Auflagen...eigentlich

Mehr

Übersicht. Datenstrukturen und Algorithmen. Übersicht. Divide-and-Conquer. Vorlesung 9: Quicksort (K7)

Übersicht. Datenstrukturen und Algorithmen. Übersicht. Divide-and-Conquer. Vorlesung 9: Quicksort (K7) Datenstrukturen und Algorithmen Vorlesung 9: (K7) Joost-Pieter Katoen Lehrstuhl für Informatik 2 Software Modeling and Verification Group http://www-i2.rwth-aachen.de/i2/dsal0/ Algorithmus 8. Mai 200 Joost-Pieter

Mehr

Was ist der Promotor? Antwort: Eine spezielle Nucleotidsequenz auf der DNA, an der die RNA-Polymerase bindet um die Transkription zu starten.

Was ist der Promotor? Antwort: Eine spezielle Nucleotidsequenz auf der DNA, an der die RNA-Polymerase bindet um die Transkription zu starten. Was ist der Promotor? Antwort: Eine spezielle Nucleotidsequenz auf der DNA, an der die RNA-Polymerase bindet um die Transkription zu starten. Wie bezeichnet man den Strang der DNA- Doppelhelix, der die

Mehr

Bearbeitungszeit: 120 Minuten. Kommentare kosten Zeit; kommentieren Sie ihr Programm nur da, wo der Code alleine nicht verständlich wäre.

Bearbeitungszeit: 120 Minuten. Kommentare kosten Zeit; kommentieren Sie ihr Programm nur da, wo der Code alleine nicht verständlich wäre. Fakultät IV Elektrotechnik/Informatik Klausur Einführung in die Informatik I für Elektrotechniker Name:... Matr.-Nr.... Bearbeitungszeit: 120 Minuten Bewertung (bitte offenlassen : ) Aufgabe Punkte Erreichte

Mehr

Q1 B1 KW 49. Genregulation

Q1 B1 KW 49. Genregulation Q1 B1 KW 49 Genregulation Transkription Posttranskription elle Modifikation Genregulation bei Eukaryoten Transkriptionsfaktoren (an TATA- Box) oder Silencer (verringert Transkription) und Enhancer (erhöht

Mehr

Modellierung biologischer. Christian Maidorfer Thomas Zwifl (Seminar aus Informatik)

Modellierung biologischer. Christian Maidorfer Thomas Zwifl (Seminar aus Informatik) Modellierung biologischer Prozesse Christian Maidorfer Thomas Zwifl (Seminar aus Informatik) Überblick Einführung Arten von Modellen Die stochastische Pi-Maschine Warum Modelle Die Biologie konzentriert

Mehr

Animationen erstellen

Animationen erstellen Animationen erstellen Unter Animation wird hier das Erscheinen oder Bewegen von Objekten Texten und Bildern verstanden Dazu wird zunächst eine neue Folie erstellt : Einfügen/ Neue Folie... Das Layout Aufzählung

Mehr

Übungen zu Einführung in die Informatik: Programmierung und Software-Entwicklung: Lösungsvorschlag

Übungen zu Einführung in die Informatik: Programmierung und Software-Entwicklung: Lösungsvorschlag Ludwig-Maximilians-Universität München WS 2015/16 Institut für Informatik Übungsblatt 9 Prof. Dr. R. Hennicker, A. Klarl Übungen zu Einführung in die Informatik: Programmierung und Software-Entwicklung:

Mehr

4 Codierung nach Viginere (Lösung)

4 Codierung nach Viginere (Lösung) Kapitel 4 Codierung nach Viginere (Lösung) Seite 1/14 4 Codierung nach Viginere (Lösung) 4.1 Einführung Blaise de Vigenère lebte von 1523 bis 1596 in Frankreich und war nach dem Studium bei verschiedenen

Mehr

EJB Beispiel. JEE Vorlesung 10. Ralf Gitzel ralf_gitzel@hotmail.de

EJB Beispiel. JEE Vorlesung 10. Ralf Gitzel ralf_gitzel@hotmail.de EJB Beispiel JEE Vorlesung 10 Ralf Gitzel ralf_gitzel@hotmail.de 1 Stundenkonzept Gemeinsame Übung Stoff der letzten Stunde wird gemeinsam in einem Beispiel umgesetzt Details werden nochmals erklärt bzw.

Mehr

Übersicht Shell-Scripten

Übersicht Shell-Scripten !!!! Wichtig: Bei Shell-Scripten enden die Zeilen nicht mit einem Strichpunkt!!!! Erste Zeile eines Shell-Scripts: #! /bin/bash Variablen in Shell-Scripts: Variablennamen müssen mit einem Buchstaben beginnen,

Mehr

5.2 Neue Projekte erstellen

5.2 Neue Projekte erstellen 5.2 Neue Projekte erstellen Das Bearbeiten von bestehenden Projekten und Objekten ist ja nicht schlecht wie aber können Sie neue Objekte hinzufügen oder gar völlig neue Projekte erstellen? Die Antwort

Mehr

Einführung in die C-Programmierung

Einführung in die C-Programmierung Einführung in die C-Programmierung Warum C? Sehr stark verbreitet (Praxisnähe) Höhere Programmiersprache Objektorientierte Erweiterung: C++ Aber auch hardwarenahe Programmierung möglich (z.b. Mikrokontroller).

Mehr

Grundlagen der Informatik II. Teil I: Formale Modelle der Informatik

Grundlagen der Informatik II. Teil I: Formale Modelle der Informatik Grundlagen der Informatik II Teil I: Formale Modelle der Informatik 1 Einführung GdInfoII 1-2 Ziele/Fragestellungen der Theoretischen Informatik 1. Einführung abstrakter Modelle für informationsverarbeitende

Mehr

Objektorientierte Programmierung

Objektorientierte Programmierung Universität der Bundeswehr Fakultät für Informatik Institut 2 Priv.-Doz. Dr. Lothar Schmitz FT 2006 Übungsblatt 5 Lösungsvorschlag Objektorientierte Programmierung 22. 05. 2006 Lösung 9 (SMS-Eingabe am

Mehr

Wintersemester 2010/2011 Rüdiger Westermann Institut für Informatik Technische Universität München

Wintersemester 2010/2011 Rüdiger Westermann Institut für Informatik Technische Universität München Informatik 1 Wintersemester 2010/2011 Rüdiger Westermann Institut für Informatik Technische Universität München 1 0 Allgemeines Zielgruppen Siehe Modulbeschreibung Studierende anderer (nicht Informatik)

Mehr

Wiederholunng. Klassische Genetik

Wiederholunng. Klassische Genetik Wiederholunng Klassische Genetik Mendelsche Regeln Uniformitätsregel Spaltungsregel Freie Kombinierbarkeit Koppelung von Genen Polygene: mehre Gene für ein Merkmal Pleiotropie: 1 Gen steuert mehrere Merkmale

Mehr

Aufbau und Funktion des Genoms: Von der Genstruktur zur Funktion

Aufbau und Funktion des Genoms: Von der Genstruktur zur Funktion Assoc. Prof. PD Mag. Dr. Aufbau und Funktion des Genoms: Von der Genstruktur zur Funktion Wien, 2013 Währinger Straße 10, A-1090 Wien helmut.dolznig@meduniwien.ac.at www.meduniwien.ac.at/medizinische-genetik

Mehr

Translation benötigt trnas und Ribosomen. Genetischer Code. Initiation Elongation Termination

Translation benötigt trnas und Ribosomen. Genetischer Code. Initiation Elongation Termination 8. Translation Konzepte: Translation benötigt trnas und Ribosomen Genetischer Code Initiation Elongation Termination 1. Welche Typen von RNAs gibt es und welches sind ihre Funktionen? mouse huma n bacter

Mehr

Bioinformatik für Biochemiker

Bioinformatik für Biochemiker Bioinformatik für Biochemiker Oliver Kohlbacher WS 2009/2010 3. Strings und Sequenzen Abt. Simulation biologischer Systeme WSI/ZBIT, Eberhard Karls Universität Tübingen Übersicht Strings und Sequenzen

Mehr

Überblick von DNA zu Protein. Biochemie-Seminar WS 04/05

Überblick von DNA zu Protein. Biochemie-Seminar WS 04/05 Überblick von DNA zu Protein Biochemie-Seminar WS 04/05 Replikationsapparat der Zelle Der gesamte Replikationsapparat umfasst über 20 Proteine z.b. DNA Polymerase: katalysiert Zusammenfügen einzelner Bausteine

Mehr

8. Translation. Konzepte: Translation benötigt trnas und Ribosomen. Genetischer Code. Initiation - Elongation - Termination

8. Translation. Konzepte: Translation benötigt trnas und Ribosomen. Genetischer Code. Initiation - Elongation - Termination 8. Translation Konzepte: Translation benötigt trnas und Ribosomen Genetischer Code Initiation - Elongation - Termination 1. Welche Typen von RNAs gibt es und welches sind ihre Funktionen? mouse human bacteria

Mehr

Fachgebiet Informationssysteme Prof. Dr.-Ing. N. Fuhr. Programmierung Prof. Dr.-Ing. Nobert Fuhr. Übungsblatt Nr. 6

Fachgebiet Informationssysteme Prof. Dr.-Ing. N. Fuhr. Programmierung Prof. Dr.-Ing. Nobert Fuhr. Übungsblatt Nr. 6 Gudrun Fischer Sascha Kriewel programmierung@is.informatik.uni-duisburg.de Anmeldung zur Klausur! Übungsblatt Nr. 6 Um an der Klausur teilzunehmen, müssen sich Studierende der angewandten Informatik in

Mehr

Das zentrale Dogma der Molekularbiologie:

Das zentrale Dogma der Molekularbiologie: Das zentrale Dogma der Molekularbiologie: DNA Transkription RNA Translation Protein 1 Begriffserklärungen GENOM: Ist die allgemeine Bezeichnung für die Gesamtheit aller Gene eines Organismus GEN: Ist ein

Mehr

Steuern des GSR-Interface mit QBasic

Steuern des GSR-Interface mit QBasic Steuern des GSR-Interface mit QBasic Erstellt von Jochen Sendler, Geschwister-Scholl-Realschule Mannheim Inhaltsverzeichnis 1. Die Programmiersprache QBasic 3 2. Starten von QBasic 3 3. Ansteuern einzelner

Mehr

Funktionale Programmierung Übung 01. Dozent: mein Dozent Tutor: mein Tutor Studenten: person1 und person2 tt. mm. jjjj

Funktionale Programmierung Übung 01. Dozent: mein Dozent Tutor: mein Tutor Studenten: person1 und person2 tt. mm. jjjj Funktionale Programmierung Übung 01 Dozent: mein Dozent Tutor: mein Tutor Studenten: person1 und person tt. mm. jjjj 1 Inhaltsverzeichnis 1 Text schreiben 3 Tabulatoren 3.1 Tabulatoren zur Textstrukturierung....................

Mehr

Grundbegriffe der Informatik

Grundbegriffe der Informatik Grundbegriffe der Informatik Einheit 15: Reguläre Ausdrücke und rechtslineare Grammatiken Thomas Worsch Universität Karlsruhe, Fakultät für Informatik Wintersemester 2008/2009 1/25 Was kann man mit endlichen

Mehr

Assertions (Zusicherungen)

Assertions (Zusicherungen) April 10, 2005 Oberseminar Software-Entwicklung Inhalt 1. Einführung (Motivation, Tony Hoare, Programmverifikation) 2. Design by Contract (Idee, Eiffel) 3. Praxis: Programming by Contract for Python 4.

Mehr

Einführung in Python Übung 1

Einführung in Python Übung 1 Einführung in Python Übung 1 Rebecca Breu, Bastian Tweddell Oktober 2007 Login: XXXloginXXX Passwort: XXXpasswortXXX Bitte das Passwort ändern (passwd)! Datentypen I Aufgabe 1 (Erste Schritte, Zahlen)

Mehr

Bioinformatik I (Einführung)

Bioinformatik I (Einführung) Kay Diederichs, Sommersemester 2015 Bioinformatik I (Einführung) Algorithmen Sequenzen Strukturen PDFs unter http://strucbio.biologie.unikonstanz.de/~dikay/bioinformatik/ Klausur: Fr 17.7. 10:00-11:00

Mehr

Autor: Michael Spahn Version: 1.0 1/10 Vertraulichkeit: öffentlich Status: Final Metaways Infosystems GmbH

Autor: Michael Spahn Version: 1.0 1/10 Vertraulichkeit: öffentlich Status: Final Metaways Infosystems GmbH Java Einleitung - Handout Kurzbeschreibung: Eine kleine Einführung in die Programmierung mit Java. Dokument: Autor: Michael Spahn Version 1.0 Status: Final Datum: 23.10.2012 Vertraulichkeit: öffentlich

Mehr

Informatik Grundlagen, WS04, Seminar 13

Informatik Grundlagen, WS04, Seminar 13 Informatik Grundlagen, WS04, Seminar 13 Informatik Informatik Grundlagen, Seminar 13 WS04 1 Was wir heute besprechen Nachbesprechen von Übungsblatt 11 Rekursion Grundprinzipien Übung Besprechung Übungsblatt

Mehr

Vorlesung Molekulare Humangenetik

Vorlesung Molekulare Humangenetik Vorlesung Molekulare Humangenetik WS 2013/2014 Dr. Shamsadin DNA-RNA-Protein Allgemeines Prüfungen o. Klausuren als indiv. Ergänzung 3LP benotet o. unbenotet Seminar Block 2LP Vorlesung Donnerstags 14-16

Mehr

10 Block 10: Verwendung von Modulen in Perl

10 Block 10: Verwendung von Modulen in Perl 10 Block 10: Verwendung von Modulen in Perl 10.1 Lernziele... 2 10.2 Theorie... 3 10.2.1 Warum Module?... 3 10.3 Praxis... 5 10.3.1 Module erstellen... 5 10.3.2 Module aufrufen... 6 10.3.3 Aufgabe... 8

Mehr

II. Grundlagen der Programmierung. 9. Datenstrukturen. Daten zusammenfassen. In Java (Forts.): In Java:

II. Grundlagen der Programmierung. 9. Datenstrukturen. Daten zusammenfassen. In Java (Forts.): In Java: Technische Informatik für Ingenieure (TIfI) WS 2005/2006, Vorlesung 9 II. Grundlagen der Programmierung Ekkart Kindler Funktionen und Prozeduren Datenstrukturen 9. Datenstrukturen Daten zusammenfassen

Mehr

5 DATEN. 5.1. Variablen. Variablen können beliebige Werte zugewiesen und im Gegensatz zu

5 DATEN. 5.1. Variablen. Variablen können beliebige Werte zugewiesen und im Gegensatz zu Daten Makro + VBA effektiv 5 DATEN 5.1. Variablen Variablen können beliebige Werte zugewiesen und im Gegensatz zu Konstanten jederzeit im Programm verändert werden. Als Variablen können beliebige Zeichenketten

Mehr

Einleitung. Replikation

Einleitung. Replikation (C) 2014 - SchulLV 1 von 9 Einleitung Der Action-Film von gestern Abend war wieder ziemlich spannend. Mal wieder hat es der Superheld geschafft, alle Zeichen richtig zu deuten, diverse Geheimcodes zu knacken

Mehr

Translation benötigt trnas und Ribosomen. Genetischer Code. Initiation Elongation Termination

Translation benötigt trnas und Ribosomen. Genetischer Code. Initiation Elongation Termination 8. Translation Konzepte: Translation benötigt trnas und Ribosomen Genetischer Code Initiation Elongation Termination 1. Welche Typen von RNAs gibt es und welches sind ihre Funktionen? mouse huma n bacter

Mehr

1 topologisches Sortieren

1 topologisches Sortieren Wolfgang Hönig / Andreas Ecke WS 09/0 topologisches Sortieren. Überblick. Solange noch Knoten vorhanden: a) Suche Knoten v, zu dem keine Kante führt (Falls nicht vorhanden keine topologische Sortierung

Mehr

Wir arbeiten mit Zufallszahlen

Wir arbeiten mit Zufallszahlen Abb. 1: Bei Kartenspielen müssen zu Beginn die Karten zufällig ausgeteilt werden. Wir arbeiten mit Zufallszahlen Jedesmal wenn ein neues Patience-Spiel gestartet wird, muss das Computerprogramm die Karten

Mehr

Von der DNA zum Eiweißmolekül Die Proteinbiosynthese. Ribosom

Von der DNA zum Eiweißmolekül Die Proteinbiosynthese. Ribosom Von der DNA zum Eiweißmolekül Die Proteinbiosynthese Ribosom Wiederholung: DNA-Replikation und Chromosomenkondensation / Mitose Jede Zelle macht von Teilung zu Teilung einen Zellzyklus durch, der aus einer

Mehr

Text-Zahlen-Formatieren

Text-Zahlen-Formatieren Text-Zahlen-Formatieren Beobachtung: Bei der Formatierung einer Zahl in eine Textzahl und umgekehrt zeigt Excel ein merkwürdiges Verhalten, welches nachfolgend skizziert werden soll: Wir öffnen eine neue

Mehr

Kapitel 12 Dokumentation und Zugriffsrechte

Kapitel 12 Dokumentation und Zugriffsrechte Kapitel 12 Dokumentation und Zugriffsrechte Seite 1 / 6 Kapitel 12 Dokumentation und Zugriffsrechte Lernziele: Dokumentation mit Hilfe von Javadoc Datenkapselung über Zugriffsrechte 12.1 Dokumentation

Mehr

Kapitel 1: Informationsverarbeitung durch Programme

Kapitel 1: Informationsverarbeitung durch Programme LUDWIG- MAXIMILIANS- UNIVERSITY MUNICH DEPARTMENT INSTITUTE FOR INFORMATICS Skript zur Vorlesung: Einführung in die Informatik: Systeme und Anwendungen Sommersemester 2009 Kapitel 1: Informationsverarbeitung

Mehr

SAGE-Crashkurs SoSe 2009

SAGE-Crashkurs SoSe 2009 SAGE-Crashkurs SoSe 2009 Lars Fischer (lars. fischer (an der) uni - siegen. de) Diese Zusammenstellung erläutert die wichtigsten Dinge, um SAGE in der Zahlentheorie- Vorlesung zum Lösen der ersten Übungsblätter

Mehr

Ideen der Informatik Suchen und Sortieren [Ordnung muss sein ] Kurt Mehlhorn Adrian Neumann viele Folien von Kostas Panagiotou

Ideen der Informatik Suchen und Sortieren [Ordnung muss sein ] Kurt Mehlhorn Adrian Neumann viele Folien von Kostas Panagiotou Ideen der Informatik Suchen und Sortieren [Ordnung muss sein ] Kurt Mehlhorn Adrian Neumann viele Folien von Kostas Panagiotou Suchen Welche Telefonnummer hat Kurt Mehlhorn? Wie schreibt man das Wort Equivalenz?

Mehr

Evolution und Entwicklung

Evolution und Entwicklung Evolution und Entwicklung Wie aus einzelnen Zellen die Menschen wurden: Phylogenese Klassische Genetik: Mendel Moderne Genetik: Watson & Crick Wie aus einer einzigen Zelle ein Mensch wird: Ontogenese Vererbung

Mehr