Funktionelle Genomik. praktische Anwendungen

Save this PDF as:
 WORD  PNG  TXT  JPG

Größe: px
Ab Seite anzeigen:

Download "Funktionelle Genomik. praktische Anwendungen"

Transkript

1 Funktionelle Genomik praktische Anwendungen

2 Schmelzpunkt der DNA Einzelsträngige DNA absorbiert UV-Licht effektiver SYBR Green fluoresziert nur wenn es an doppelsträngiger DNA bindet Fluoreszenz erhöht sich bis auf Schmelzpunkt, T M Nimmt nach dem T M ab Kehrt zur Nullwert nach dem vollkommenen Schmelzen der DNA zurück Programmiertes Aufheizen der PCR-Produkte ermöglicht Analyse

3 Real time PCR Gerät

4 Real-Time PCR Anwendungen im Laborpraxis VNTR/Satelliten-Analyse von 5 Personen (unterschiedliche Farben). Welche Schmelzkurve an welchem Gelfoto gehört? Die Fluoreszenz nimmt proportional mit der Menge der PCR-Produkte zu. Diese Fluoreszenzfarbstoffe lagern sich in die DNA ein (interkalieren) bzw. binden an die doppelsträngige DNA, wodurch die Fluoreszenz dieser Farbstoffe ansteigt. Die Zunahme der Target-DNA korreliert daher mit der Zunahme der Fluoreszenz von Zyklus zu Zyklus

5 Real-Time PCR Anwendungen im Laborpraxis

6 Real-Time PCR Anwendungen im Laborpraxis Was der Genotyp der Patienten ist?

7 Real-Time PCR Anwendungen im Laborpraxis Die 5 Patienten weisen 2 morphologische Varianten auf #2 und # 6: Homozygot, mehrere Wiederholungen #3, #4: Heterozygot #5: Homozygot, weniger Wiederholungen der Satelliten-Einheiten

8 Real-Time PCR Demonstrierung von Punktmutation 3 Patienten, Amplifizierung des Mutanten Exons G-C->A-T Austausch verniedrigt TM 3 Genotypen

9 Real-Time PCR Demonstrierung von Punktmutation 3 Patienten, Amplifizierung des Mutanten Exons G-C->A-T Austausch verniedrigt T M Homozygot, Wildtyp

10 Real-Time PCR Demonstrierung von Punktmutation Homozygot, Wildtyp Heterozygot

11 Real-Time PCR Demonstrierung von Punktmutation Homozygot, Wildtyp Homozygot, Mutant Heterozygot

12 Real-Time PCR, Genexpressionsanalyse A: Gesund, Kontrolle B: Patient Überexprimierung in Patient kann diagnostischen Wert vertreten

13 DNA-Chip Kinetik der Genexpression Pharmakogenomik: Test eines Wirkstoffes auf Genexpression; A, B, C, D: Unterschiedliche Geweben A B C D v 0h 2h 4h 6h 8h 10h

14 Analyse von Expressionsmuster Gen 0h 2h 4h 6h 8h 12h Q S T V Die Gene Q und T weisen identische Expression auf Ob die Gene S und V mit Q und T zusammenhängend sind rechnet man mithilfe Pearson-Korrelation aus 1: Beide Genexpression ändern sich in der selben Richtung -1: Ändern sich gegenseitig 0.5: Deutlich positiver Zusammenhang -0.5: Deutlich negativer Zusammenhang ρ(q,s)=0,897, deutlich positiver Zusammenhang

15 Korrelation zwischen X und Y

16 Strukturelle Genomik Praktikum

17 Was ist ein SNP? Untersuchung von SNP

18 Was ist ein SNP? Einzelnukleotid Polymorhpismus Untersuchung von SNP

19 Was ist ein SNP? Einzelnukleotid Polymorhpismus Wie oft ist ein SNP? Untersuchung von SNP

20 Was ist ein SNP? Wie oft ist ein SNP? Einzelnukleotid Polymorhpismus >1% Untersuchung von SNP

21 Was ist ein SNP? Einzelnukleotid Polymorhpismus Wie oft ist ein SNP? >1% Wie können wir es bestimmen? Untersuchung von SNP

22 Was ist ein SNP? Einzelnukleotid Polymorhpismus Wie oft ist ein SNP? Hogyan lehet azonosítani? >1% ASA (AS-PCR) Untersuchung von SNP

23 Was ist ein SNP? Einzelnukleotid Polymorhpismus Wie oft ist ein SNP? Hogyan lehet azonosítani? >1% ASA (AS-PCR) DNA Sequenzierung Untersuchung von SNP Allelspezifische Analyse (ASA)

24 (wt) 5 CGT AGT CCT TGA AGC TAT TAT GTA CGT AGC TGA (m) 5 CGT AGT CCT TGA AGC TAC TAT GTA CGT AGC TGA Allelspezyfische Amplifikation - ASA

25 (wt) (m) 5 CGT AGT CCT TGA AGC TAT TAT GTA CGT AGC TGA 5 CGT AGT CCT TGA AGC TAC TAT GTA CGT AGC TGA Allelspezyfische Amplifikation - ASA

26 (wt) (m) 5 CGT AGT CCT TGA AGC TAT TAT GTA CGT AGC TGA 5 CGT AGT CCT TGA AGC TAC TAT GTA CGT AGC TGA Konstruieren Sie ein Primerpaar! Allelspezyfische Amplifikation - ASA

27 (wt) (m) 5 CGT AGT CCT TGA AGC TAT TAT GTA CGT AGC TGA3 3 GCA TCA GGA ACT TCG ATA... ATA CAT GCA TCG ACT5 5 CGT AGT CCT TGA AGC TAC TAT GTA CGT AGC TGA3 3 GCA TCA GGA ACT TCG ATG... ATA CAT GCA TCG ACT5 Wie viele Primers brauchen wir? Allelspezyfische Amplifikation - ASA

28 (wt) (m) 5 CGT AGT CCT TGA AGC TAT TAT GTA CGT AGC TGA3 3 GCA TCA GGA ACT TCG ATA... ATA CAT GCA TCG ACT5 5 CGT AGT CCT TGA AGC TAC TAT GTA CGT AGC TGA3 3 GCA TCA GGA ACT TCG ATG... ATA CAT GCA TCG ACT5 Wie viele Primers brauchen wir? 3 Allelspezyfische Amplifikation - ASA

29 (wt) 5 CGT AGT CCT TGA AGC TAT TAT GTA CGT AGC TGA3 3 GCA TCA GGA ACT TCG ATA... ATA CAT GCA TCG ACT5 (m) 5 CGT AGT CCT TGA AGC TAC TAT GTA CGT AGC TGA3 3 GCA TCA GGA ACT TCG ATG. ATA CAT GCA TCG ACT5 Allelspezyfische Amplifikation - ASA

30 (wt) 5 CGT AGT CCT TGA AGC TAT TAT GTA CGT AGC TGA3 3 GCA TCA GGA ACT TCG ATA... ATA CAT GCA TCG ACT5 (m) 5 CGT AGT CCT TGA AGC TAC TAT GTA CGT AGC TGA3 3 GCA TCA GGA ACT TCG ATA. ATA CAT GCA TCG ACT5 Allelspezyfische Amplifikation - ASA

31 FAST PCR in silico PCR Kontrollierung: mir dem Program: MultAlin Reverse Primerkontrollierung: Primerplanung mit Internetprogrammen

32 (wt) CGT AAT GAA TTC AGT TGC EcoRI- Erkennungsstelle Verdauung mit RE

33 (m) CGT AAT GAA CTC AGT TGC EcoRI-Erkennungsstelle Ein SNP steht im Erkennungssequenz eines Restriktionsenzyms

34 (m) CGT AAT GAA CTC AGT TGC EcoRI akcióban Keine Verdauung

35 Gelelektroforese

36 m wt Gelelektroforese

37 Was ist die Reihefolge der Nukleotiden in 5 ->3 Richtung aufgrund des Gelphotos? GGCCA GGCCATCGTTGA GGC GGCC GGCCATC GGCCATCG GGCCATCGTTG GGCCAT GGCCATCGT GGCCATCGTT n A C G T Sanger-sequenzierung

38 Was ist die Reihefolge der Nukleotiden aufgrund des Gelphotos? Welche kurze Sequenz gehört zu den Bänden? GGCCA GGCCATCGTTGA n A C G T GGC GGCC GGCCATC GGCCATCG GGCCATCGTTG A3 G T T G C T A C C5 Sanger-sequenzierung GGCCAT GGCCATCGT GGCCATCGTT

39 DNA-Sequenzierung nach Sanger Templat: 3 Primer : 5 CCGGTAGCAACT 5 GG 3 datp + ddatp dctp dgtp dttp datp dctp + ddctp dgtp dttp datp dctp dgtp + ddgtp dttp datp dctp dgtp dttp + ddttp GGCCA GGCCATCGTTGA GGC GGCC GGCCATC GGCCATCG GGCCATCGTTG GGCCAT GGCCATCGT GGCCATCGTT n A C G T A3 G T T G C T A C C5 Mit dem Templat komplementere Sequenz Dideoxy- Kettenterminierung

40 Was ist die Sequenz des Templatstranges? N A C G T A3 G T T G C T A C C5 GGTAGCAA5 Sanger-sequenzierung

41 Was ist die Sequenz des Templatstranges? n A C G T A3 G T T G C T A C C5 GGTAGCAACT5 Sanger-sequenzierung

42 Pyrosequenzierung (DNA) n + dntp DNA-Polymerase (DNA) n+1 + PP i Sulfurylase Luziferase APS + PP i ATP Licht dntp ATP Apyrase T/G polimorfizmus pirogramja dndp + dnmp + P i ADP + AMP + P i Pyrogram der DNA Sequenzen

43 Aufgrund des Pyrograms bestimmen Sie die Sequenz! Pirosequenzierung

44 Aufgrund des Pyrograms bestimmen Sie die Sequenz! G C A G G C C T Pirosequenzierung

45 Aufgrund Pyrogrammes in welcher Reihenfolge wurden dntps zugegeben? G C T A Wie die Sequenz lautet? GCAGGCCT Pyrosequenierung

46 Klinische Anwendung von Pyrosequenzierung Kann eine Chemotherapie unnötig sein? K-RAS ist ein Onkogen 12p12 RAS Molekülfamilie, GTPase (K-, N- und H-RAS) Das Gen kodiert ein 21kD Protein (p21ras oder K-Ras) K-Ras Funktion: Umwandler in Signaltransduktion zb in EGFR/RTK Signalweg, Schaltprotein Mutation tritt sehr häufig in Tumoren auf

47 K-RAS Gen ist ein BIOMARKER Das Genprodukt reguliert die Zellüberlebensprozesse, wie die Proliferation oder Angiogenese der Zellen Der mutante Genprodukt verursacht unkontrollierte Vermehrung der Krebszellen Genanalyse von K-RAS kann den Erfolg der Chemotherapie voraussagen

48 Untersuchung von Tumorresistenz in Anti- EGFR Therapie normal Normal Mit anti-egfr Mutant mit anti-egfr

49 KRAS Genanalyse mit Pyrosequenzierung

50 Wenn eine Mutation im K-RAS-Gen auftritt -> wird das Protein immer aktiv (betrifft GTP-Bindungsstelle)-> Krebs Die häufigste Mutationen sind in 12., 13., 61. Kodon KRAS

51 K-RAS Genanalyse mit Pyrosequenzierung

52 K-RAS Genanalyse mit Pyrosequenzierung

53 K-RAS Genanalyse mit Pyrosequenzierung

54 SMRT: single molecule real time (sequencing)

55 Video -Ergänzungsmaterial Real time PCR: (englisch) (englisch) SNP: 2E6BBB7D49579&index=57 (deutsch) Sequenzierung: (deutsch) (englisch) (verschiedene Techniken: (deutsch)

56 ENDE

I. Strukturelle Genomik II. Funktionelle Genomik III. Integrative Genomik

I. Strukturelle Genomik II. Funktionelle Genomik III. Integrative Genomik I. Strukturelle Genomik II. Funktionelle Genomik III. Integrative Genomik Themen 1.Begriffe 2.Genomstruktur 3.Funktion des Genoms 4.Verfahren von Genomik Begriffe- 1 Genom: Definition 1. Gesamte Vererbungsinformation

Mehr

I. Strukturelle Genomik II. Funktionelle Genomik III. Integrative Genomik

I. Strukturelle Genomik II. Funktionelle Genomik III. Integrative Genomik I. Strukturelle Genomik II. Funktionelle Genomik III. Integrative Genomik Themen 1.Begriffe 2.Genomstruktur 3.Funktion des Genoms 4.Verfahren von Genomik Begriffe- 1 Genom: Definition 1. Gesamte Vererbungsinformation

Mehr

A- Zugabe von 180µl Pufferlösung und Proteinase K, Inkubation bei 56 C. B- Zugabe von 200µl einer zweiten Pufferlösung, Inkubation bei 70 C

A- Zugabe von 180µl Pufferlösung und Proteinase K, Inkubation bei 56 C. B- Zugabe von 200µl einer zweiten Pufferlösung, Inkubation bei 70 C 3 Methoden 3.1 Extraktion der DNA aus den Paraffinschnitten 3.1.1 Extraktions-Kit Das QIAamp DNA Mini Kit- System beruht auf dem Prinzip der Auflösung der Eiweiße mit Proteinase K, DNA Bindung an eine

Mehr

Praktikum Molekularbiologie, 5. Semester, BT 12 Martin Sievers, Gottfried Dasen und Tobias Wermelinger RT 418

Praktikum Molekularbiologie, 5. Semester, BT 12 Martin Sievers, Gottfried Dasen und Tobias Wermelinger RT 418 Praktikum Molekularbiologie, 5. Semester, BT 12 Martin Sievers, Gottfried Dasen und Tobias Wermelinger RT 418 Datum Gruppe Thema 18.09.14 I Forensik: PCR und Restriktionsanalyse am Beispiel der ITS-Region

Mehr

Rekombinante Wirkstoffe

Rekombinante Wirkstoffe Gentechnik/Biotechnik Rekombinante Wirkstoffe Vorlesung im WS 2010/2011 Prof. Theo Dingermann Institut für Pharmazeutische Biologie Goethe-Universität Frankfurt/Main Dingermann@em.uni-frankfurt.de Die

Mehr

7. Anhang. 7. Anhang. Abbildung 7.1: Aminosäuresequenz AtMYC2 im Wildtyp und in jin1. Unterschiede zwischen den Sequenzen sind rot unterlegt.

7. Anhang. 7. Anhang. Abbildung 7.1: Aminosäuresequenz AtMYC2 im Wildtyp und in jin1. Unterschiede zwischen den Sequenzen sind rot unterlegt. 7. Anhang 10 20 30 40 50 60 70 80 90 100 jin1 MTDYRLQPTMNLWTTDDNASMMEAFMSSSDISTLWPPASTTTTTATTETTPTPAMEIPAQAGFNQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASV AtMYC2 MTDYRLQPTMNLWTTDDNASMMEAFMSSSDISTLWPPASTTTTTATTETTPTPAMEIPAQAGFNQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASV

Mehr

Das Prinzip der DNA-Sequenzierung Best.- Nr. 201.3055

Das Prinzip der DNA-Sequenzierung Best.- Nr. 201.3055 Das Prinzip der DNA-Sequenzierung Best.- Nr. 201.3055 Allgemeine Informationen Prinzip der DNA-Sequenzierung Ziel dieses Versuchs ist einen genauen Überblick über die Verfahrensweise der DNA- Sequenzierung

Mehr

II. GENOMIK: GLEICHZEITIGE UNTERSUCHUNG VON MEHREREN MAKROMOLEKÜLEN

II. GENOMIK: GLEICHZEITIGE UNTERSUCHUNG VON MEHREREN MAKROMOLEKÜLEN II. GENOMIK: GLEICHZEITIGE UNTERSUCHUNG VON MEHREREN MAKROMOLEKÜLEN Strukturelle Genomik Genomische Bibliothek, EST Datenbank DNA-Sequenzierung Genomprogramme Polymorphismen RFLP Herstellung einer DNA-Bibliothek

Mehr

Der neue cobas T EGFR Mutation Test (CE-IVD) Weil jeder Tag zählt das richtige Ergebnis früher

Der neue cobas T EGFR Mutation Test (CE-IVD) Weil jeder Tag zählt das richtige Ergebnis früher Der neue cobas T EGFR Mutation Test (CE-IVD) Weil jeder Tag zählt das richtige Ergebnis früher cobas T EGFR Mutation Test Diagnostik für die personalisierte Therapie beim NSCLC Unkontrollierte Zellproliferation

Mehr

Material MATERIAL 3.1 Oligonukleotide

Material MATERIAL 3.1 Oligonukleotide Material 13 3 MATERIAL 3.1 Oligonukleotide AGK34 LINE1 Ale1 Ale3 LIS1 LIS2 UR UL RA2 LS2 pbst7 sp6 DOP (6-MW) pcypac2-01 pcypac2-02 SD2 SA2 SA4 SD6 D11S2164 (CP5) forward D11S2164 (CP5) revers M16 forward

Mehr

G e n o m i k. Genomik?! Tobias Schäfer Institut für f. r Biochemische Verfahren und Analysen (IBVA) 24.02.2010

G e n o m i k. Genomik?! Tobias Schäfer Institut für f. r Biochemische Verfahren und Analysen (IBVA) 24.02.2010 Institut für f r Biochemische Verfahren und Analysen (IBVA) Genomik?! Tobias Schäfer Institut für f r Biochemische Verfahren und Analysen (IBVA) 24.02.2010 Inhalt Methoden der Gensequenzierung Nutzen genetischer

Mehr

Der neue cobas T KRAS Mutation Test (CE-IVD) Hinter jedem Ergebnis steht ein Patient, der darauf vertraut

Der neue cobas T KRAS Mutation Test (CE-IVD) Hinter jedem Ergebnis steht ein Patient, der darauf vertraut Der neue cobas T KRAS Mutation Test (CE-IVD) Hinter jedem Ergebnis steht ein Patient, der darauf vertraut cobas T KRAS Mutation Test (CE-IVD) Diagnostik für die personalisierte Darmkrebstherapie Unkontrollierte

Mehr

2. MATERIAL UND METHODEN

2. MATERIAL UND METHODEN 2. MATERIAL UND METHODEN 2.1 Material 2.1.1 Proben zur DNA-Analytik Blutproben zur Gewinnung von DNA aus Leukozyten wurden uns freundlicherweise von Dr. Ramaekers, Universität Aachen, überlassen. Ein positives

Mehr

1. Erklären Sie das Prinzip der Sanger Sequenzierung. Klären Sie dabei folgende Punkte: a) Welche besondere Art von Nukleotiden wird verwendet und

1. Erklären Sie das Prinzip der Sanger Sequenzierung. Klären Sie dabei folgende Punkte: a) Welche besondere Art von Nukleotiden wird verwendet und 10. Methoden 1. Erklären Sie das Prinzip der Sanger Sequenzierung. Klären Sie dabei folgende Punkte: a) Welche besondere Art von Nukleotiden wird verwendet und welche Funktion haben diese bei der Sequenzierungsreaktion?

Mehr

Molekulare Diagnostik Hans Nitschko

Molekulare Diagnostik Hans Nitschko Molekulare Diagnostik Hans Nitschko Nachweis viraler Erreger durch molekularbiologische Methoden Antikörpernachweise Nachweis antigenspezifischer T-Zellen Neutralisationsteste Nachweis Therapie-resistenter

Mehr

DNA Sequenzierung. Transkriptionsstart bestimmen PCR

DNA Sequenzierung. Transkriptionsstart bestimmen PCR 10. Methoden DNA Sequenzierung Transkriptionsstart bestimmen PCR 1. Erklären Sie das Prinzip der Sanger Sequenzierung. Klären Sie dabei folgende Punkte: a) Welche besondere Art von Nukleotiden wird verwendet

Mehr

PCR (polymerase chain reaction)

PCR (polymerase chain reaction) PCR (polymerase chain reaction) Ist ein in vitro Verfahren zur selektiven Anreicherung von Nukleinsäure-Bereichen definierter Länge und definierter Sequenz aus einem Gemisch von Nukleinsäure-Molekülen

Mehr

Produktkatalog 2010. Molekularbiologische Reagenzien

Produktkatalog 2010. Molekularbiologische Reagenzien Produktion, Vertrieb und Serviceleistung im Bereich der Molekularbiologie und Medizin Produktkatalog 2010 Molekularbiologische Reagenzien Molegene GmbH Bienenweg 28 35764 Sinn Tel. 02772-570952 Fax 02772-570945

Mehr

Methodensammlung der Bund/Länder-Arbeitsgemeinschaft Gentechnik. PCR- Nachweis von E. coli B- und BL21- Stämmen

Methodensammlung der Bund/Länder-Arbeitsgemeinschaft Gentechnik. PCR- Nachweis von E. coli B- und BL21- Stämmen Methodensammlung der Bund/Länder-Arbeitsgemeinschaft Gentechnik PCR- Nachweis von E. coli B- und BL21- Stämmen Erstellt vom Unterausschuss Methodenentwicklung der LAG, März 2005 1. Zweck und Anwendungsbereich

Mehr

Vorwärts /Rückwärts Mutationen. Somatische Zellen oder Keimzellen. Loss of function/gain of function. Mutagenese

Vorwärts /Rückwärts Mutationen. Somatische Zellen oder Keimzellen. Loss of function/gain of function. Mutagenese 9. Mutationen Konzepte: Vorwärts /Rückwärts Mutationen Somatische Zellen oder Keimzellen Loss of function/gain of function Mutagenese 1. Loss of function Mutationen treten häufiger auf als gain of function

Mehr

7 Anhang. Tabelle I: Zusammensetzung der Restriktionsansätze.

7 Anhang. Tabelle I: Zusammensetzung der Restriktionsansätze. 7 Anhang Tabelle I: Zusammensetzung der Restriktionsansätze. Reagenz Konzentration Volumen je Endkonzentration der Stammlösung Reaktionansatz Reaktionspuffer 10x NEB-Puffer 2 1.50 µl 1x MseI 4 U/µl 0.30

Mehr

Biologie I/B: Klassische und molekulare Genetik, molekulare Grundlagen der Entwicklung Theoretische Übungen SS 2016

Biologie I/B: Klassische und molekulare Genetik, molekulare Grundlagen der Entwicklung Theoretische Übungen SS 2016 Biologie I/B: Klassische und molekulare Genetik, molekulare Grundlagen der Entwicklung Theoretische Übungen SS 2016 Fragen für die Übungsstunde 7 (11.07-15.07.) Methoden und Techniken II 1. Sie bekommen

Mehr

Basierend auf Publikation: Ahmadian A, Ehn M, Hober S. (2006): Pyrosequencing: history, biochemistry and future; Clin Chim Acta. 363(1-2):83-94.

Basierend auf Publikation: Ahmadian A, Ehn M, Hober S. (2006): Pyrosequencing: history, biochemistry and future; Clin Chim Acta. 363(1-2):83-94. In diesem Skript wird der Versuch unternommen, der Prozess Pyrosequencing so zu erklären, dass Schüler die Chance haben Pyrosequencing zu verstehen. Es basiert auf einem Vortrag im Rahmen des Science Bridge

Mehr

1. Nachschreibeklausur zur Vorlesung "Genetik" im WS 09/10 A. Matrikel-Nr.: Versuch: 1 2 3

1. Nachschreibeklausur zur Vorlesung Genetik im WS 09/10 A. Matrikel-Nr.: Versuch: 1 2 3 1. Nachschreibeklausur zur Vorlesung "Genetik" im WS 09/10 A Modul: Studiengang: Matrikel-Nr.: Versuch: 1 2 3 Vollständiger Name in Druckbuchstaben (Vorname Nachname): Jena, 01.04.2010, 10 12 Uhr; Unterschrift:

Mehr

Grundlagen der Zellulären Biochemie

Grundlagen der Zellulären Biochemie Grundlagen der Zellulären Biochemie Replikation, Sequenzierung und PCR Vorlesung zum Modul BCB P07 im Bachelor-Studiengang Biochemie Hannover Prof. J. Alves, Institut für Biophysikalische Chemie, MHH http://www.mh-hannover.de/bpc_grundzellbc.html

Mehr

Während der Synthese synthetisiert die Polymerase den neuen Strang in 5 3 Richtung und bewegt sich in 3 5 -Richtung am Matrizenstrang entlang:

Während der Synthese synthetisiert die Polymerase den neuen Strang in 5 3 Richtung und bewegt sich in 3 5 -Richtung am Matrizenstrang entlang: 4.4 Replikation und PCR Ablauf der Replikation in vivo: Die Replikation wird von einer DNA-abhängigen DNA- Polymerase katalysiert. Jede DNA-Polymerase synthetisiert den neuen Strang in 5 3 Richtung, hierzu

Mehr

Praktikum Biochemie Biotechnologie (Molekularbiologie & Biochemie) Bettina Siebers

Praktikum Biochemie Biotechnologie (Molekularbiologie & Biochemie) Bettina Siebers Praktikum Biochemie Biotechnologie (Molekularbiologie & Biochemie) Bettina Siebers FIGURE 20.1 Biology 6/e Biotechnologie Protein Expression Genomische DNA PCR Vektormolekül (Plasmid) Escherichia coli

Mehr

Personalisierte Medizin: Genetische Analyse zirkulierender Tumorzellen mittels eines mikrofluidischen Chipsystems

Personalisierte Medizin: Genetische Analyse zirkulierender Tumorzellen mittels eines mikrofluidischen Chipsystems 16. Heiligenstädter Kolloquium, IBA Heilbad Heiligenstadt, 2012-09-25 Personalisierte Medizin: Genetische Analyse zirkulierender Tumorzellen mittels eines mikrofluidischen Chipsystems Christine Steinbach

Mehr

Genannotation bei Prokaryoten

Genannotation bei Prokaryoten Genannotation bei Prokaryoten Maike Tech Abt. Bioinformatik Institut für Mikrobiologie und Genetik (IMG) Universität Göttingen 28. November 2005 Genetik von Pro- und Eukaryoten Eukaryoten Prokaryoten Zellkern

Mehr

Primer zum Nachweis eukaryoter DNA (Kontroll-PCR) Primer Sequenz Ziel-Gen Produktgröße T a

Primer zum Nachweis eukaryoter DNA (Kontroll-PCR) Primer Sequenz Ziel-Gen Produktgröße T a 7 Anhang 7.1 Primersequenzen Alle Oligonukleotide sind in 5-3 -Orientierung aufgelistet. 7.1.1.1.1 Primer zum Nachweis eukaryoter DNA (Kontroll-PCR) 258 s CCA TCC AAC ATC TCA GCA TGA TGA AA GCC CCT CAG

Mehr

Etablierung einer. Homemade - PCR

Etablierung einer. Homemade - PCR Etablierung einer Homemade - PCR Anja Schöpflin Institut für Pathologie Universitätsklinikum Freiburg Überblick: Anwendungsgebiete der PCR Anforderungen an Primer Auswahl geeigneter Primer / Primerdesign

Mehr

Inhalt. 3 Das Werkzeug... 47 3.1 Restriktionsenzyme... 47 3.2 Gele... 58 3.2.1 Agarosegele... 58

Inhalt. 3 Das Werkzeug... 47 3.1 Restriktionsenzyme... 47 3.2 Gele... 58 3.2.1 Agarosegele... 58 Inhalt 1 Was ist denn Molekularbiologie, bitteschön?...................... 1 1.1 Das Substrat der Molekularbiologie, oder: Molli-World für Anfänger.... 2 1.2 Was brauche ich zum Arbeiten?..................................

Mehr

Cornel Mülhardt. Genomics. 6. Auflaqe. Spektrum k - / l AKADEMISCHER VERLAG

Cornel Mülhardt. Genomics. 6. Auflaqe. Spektrum k - / l AKADEMISCHER VERLAG I Cornel Mülhardt Genomics 6. Auflaqe Spektrum k - / l AKADEMISCHER VERLAG Inhalt 1 Was ist denn "Molekularbiologie", bitteschön? 1 1.1 Das Substrat der Molekularbiologie, oder: Molli-World für Anfänger...

Mehr

Sequenzierung. Sequenzierung. DNA in den letzten 50 Jahren. Warum Sequenzierung

Sequenzierung. Sequenzierung. DNA in den letzten 50 Jahren. Warum Sequenzierung Sequenzierung von Thomas Grunwald Abteilung für Med. und Mol. Virologie Sequenzierung Hintergrund Allgemeiner Überblick Funktionsweise der Sequenzierung Sequenzierungsprotokoll Auswertung der Daten Probleme

Mehr

Molekularbiologie/ Genomics

Molekularbiologie/ Genomics Cornel Mülhardt Molekularbiologie/ Genomics 5. Auflage ELSEVIER SPEKTRUM AKADEMISCHER VERLAG Spektrum k-zlakademischer VERLAG Inhalt 1 Was ist denn "Molekularbiologie", bitteschön? 1 1.1 Das Substrat der

Mehr

Genetik Praktikumsklausur SS2005

Genetik Praktikumsklausur SS2005 Genetik Praktikumsklausur SS2005 1. Aufgabe: Der Genotyp AbaB wird geselbstet, dabei werden 256 Nachkommen gebildet. Davon erhalten 16 Pflanzen den Genotyp ABAB a) gekoppelt b) nicht gekoppelt c) teilweise

Mehr

Praktikum Biologen Gruppe B5

Praktikum Biologen Gruppe B5 Praktikum Biologen Gruppe B5 Versuch Betreuer Experiment Raum Tag Zeit BR1 & Langhammer Escherichia coli: 106 17.3. 13-17 BR2 Komplementationsanalyse von Lac-Mutanten Escherichia coli: Hfr-Kreuzung (P2)

Mehr

Gentechnik/Gentechnologie

Gentechnik/Gentechnologie Gentechnik/Gentechnologie Bei zelltechnischen Verfahren werden Gene wenn überhaupt, dann nur im Gesamtverband, also als ganzes Genom verschoben oder kombiniert. Bei Gentechnologischen Verfahren wird in

Mehr

Molekularbiologische Laboruntersuchungen. Labormedizinvorlesung Krisztina Káldi

Molekularbiologische Laboruntersuchungen. Labormedizinvorlesung Krisztina Káldi Molekularbiologische Laboruntersuchungen Labormedizinvorlesung 03.04.2017 Krisztina Káldi Ziel der molekularbiologischen Laboruntersuchungen Untersuchungen der DNA-Struktur und der Expression von RNA 3,2

Mehr

Zentronukleäre Myopathien von der Diagnose zur Therapie

Zentronukleäre Myopathien von der Diagnose zur Therapie MTM Familientreffen Göttingen, 5./6. Juni 2014 Zentronukleäre Myopathien von der Diagnose zur Therapie Dr. Johann Böhm IGBMC, Strasbourg Ein paar Worte über Strasbourg.and über das IGBMC Ein paar Worte

Mehr

2.) Wie lautet in der Genomforschung das Fachwort für Vielgestaltigkeit? a) Polytheismus b) Polymerisation c) Polymorphismus d) Polygamismus

2.) Wie lautet in der Genomforschung das Fachwort für Vielgestaltigkeit? a) Polytheismus b) Polymerisation c) Polymorphismus d) Polygamismus Lernkontrolle M o d u l 2 A w i e... A n k r e u z e n! 1.) Welche gentechnischen Verfahren bildeten die Grundlage für das Humangenomprojekt (Mehrfachnennungen möglich)? a) Polymerase-Kettenreaktion b)

Mehr

Luke Alphey. DNA-Sequenzierung. Aus dem Englischen übersetzt von Kurt Beginnen. Spektrum Akademischer Verlag

Luke Alphey. DNA-Sequenzierung. Aus dem Englischen übersetzt von Kurt Beginnen. Spektrum Akademischer Verlag Luke Alphey DNA-Sequenzierung Aus dem Englischen übersetzt von Kurt Beginnen Spektrum Akademischer Verlag Inhalt Abkürzungen 11 Vorwort 15 Danksagung 16 Teil 1: Grundprinzipien und Methoden 1. 1.1 1.2

Mehr

Material. 3 Material. 3.1 Reagenzien

Material. 3 Material. 3.1 Reagenzien 3 Material 3.1 Reagenzien Tabelle 1: verwendete Reagenzien Substrat Hersteller Firmensitz Agarose (NEEO, Ultra-Qualität) Carl Roth Karlsruhe BPB (Bromphenolblau) Merck Darmstadt DEPC (Diethylpyrocarbonat)

Mehr

Genisolierung in 2 Stunden : Die Polymerase-Ketten-Reaktion (PCR)

Genisolierung in 2 Stunden : Die Polymerase-Ketten-Reaktion (PCR) PCR Genisolierung in 2 Stunden : Die Polymerase-Ketten-Reaktion (PCR) von Kary B. Mullis entwickelt (1985) eigentlich im Mai 1983 bei einer nächtlichen Autofahrt erstes erfolgreiches Experiment am 16.12.1983

Mehr

Der neue cobas T BRAF V600 Mutation Test (CE-IVD) Was wäre, wenn Sie ihr die richtige Antwort früher geben könnten?

Der neue cobas T BRAF V600 Mutation Test (CE-IVD) Was wäre, wenn Sie ihr die richtige Antwort früher geben könnten? Der neue cobas T BRAF V600 Mutation Test (CE-IVD) Was wäre, wenn Sie ihr die richtige Antwort früher geben könnten? cobas T BRAF V600 Mutation Test Diagnostik für die personalisierte Hautkrebstherapie

Mehr

Tierartbestimmung mittels spezifischer Polymerasekettenreaktion

Tierartbestimmung mittels spezifischer Polymerasekettenreaktion Einleitung Der Tierart-Kit SK1-12 enthält die notwendigen Materialien, um verarbeitete Tierarten in gängigen Fleisch- und Milchprodukten, z.b. Wurst oder Käse zu bestimmen. Ein Lehrerheft und fünf Schülerhefte,

Mehr

PCR basierte- Detektionstechniken

PCR basierte- Detektionstechniken PCR basierte- Detektionstechniken Warum überhaupt? Forensische Analysen: Vaterschaftstests, Kriminalistik Mikrobielle Gemeinschaften: Biofilme, medizinische Mikrobiologie 2 Warum überhaupt? minimale Mengen

Mehr

Sigma-Aldrich Chemie GmbH, München Merck Biosciences, Darmstadt. Thermo Hybaid GmbH, Ulm Roche Diagnostics GmbH, Mannheim

Sigma-Aldrich Chemie GmbH, München Merck Biosciences, Darmstadt. Thermo Hybaid GmbH, Ulm Roche Diagnostics GmbH, Mannheim 3 Materialien 28 3 Materialien 3.1 Chemikalien Acrylamid Agar Agarose Ammoniumsulfat Ampicillin, Natriumsalz L-Arabinose Bradford-Reagenz Bromphenolblau Caseinhydrolysat Chloramphenicol Chloroform Coomassie-Brillant-Blau

Mehr

Anlage zur Akkreditierungsurkunde D-PL-13372-01-00 nach DIN EN ISO/IEC 17025:2005

Anlage zur Akkreditierungsurkunde D-PL-13372-01-00 nach DIN EN ISO/IEC 17025:2005 Deutsche Akkreditierungsstelle GmbH Anlage zur Akkreditierungsurkunde D-PL-13372-01-00 nach DIN EN ISO/IEC 17025:2005 Gültigkeitsdauer: 26.06.2015 bis 25.03.2017 Ausstellungsdatum: 26.06.2015 Urkundeninhaber:

Mehr

4. Diskussion. 4.1. Polymerase-Kettenreaktion

4. Diskussion. 4.1. Polymerase-Kettenreaktion 59 4. Diskussion Bei der Therapie maligner Tumoren stellt die Entwicklung von Kreuzresistenz gegen Zytostatika ein ernstzunehmendes Hindernis dar. Im wesentlich verantwortlich für die so genannte Multidrug

Mehr

Klausur zur Vorlesung Biochemie III im WS 2000/01

Klausur zur Vorlesung Biochemie III im WS 2000/01 Klausur zur Vorlesung Biochemie III im WS 2000/01 am 15.02.2001 von 15.30 17.00 Uhr (insgesamt 100 Punkte, mindestens 40 erforderlich) Bitte Name, Matrikelnummer und Studienfach unbedingt angeben (3 1.

Mehr

Neue diagnostische Verfahren in der Pathologie

Neue diagnostische Verfahren in der Pathologie athologie Bochum Neue diagnostische Verfahren in der athologie Andrea Tannapfel Institut für athologie Ruhr Universität Bochum www.pathologie-bochum.de 32.000 Genes Alternative Splicing mrna Instability

Mehr

DNA Replikation ist semikonservativ. Abb. aus Stryer (5th Ed.)

DNA Replikation ist semikonservativ. Abb. aus Stryer (5th Ed.) DNA Replikation ist semikonservativ Entwindung der DNA-Doppelhelix durch eine Helikase Replikationsgabel Eltern-DNA Beide DNA-Stränge werden in 5 3 Richtung synthetisiert DNA-Polymerasen katalysieren die

Mehr

Zielgerichtete Therapie mit Olaparib bei BRCA1/2- Mutationsträgerinnen

Zielgerichtete Therapie mit Olaparib bei BRCA1/2- Mutationsträgerinnen Zielgerichtete Therapie mit Olaparib bei BRCA1/2- Mutationsträgerinnen Prof. Dr. med. Brigitte Schlegelberger 670513011/15 Olaparib Zulassung in Europa: Rezidiv eines Platin-sensitiven Ovarialkarzinoms

Mehr

Testmethoden der Molekularpathologie. im Vergleich

Testmethoden der Molekularpathologie. im Vergleich Testmethoden der Molekularpathologie im Vergleich Andreas Bösl (Feldkirch) Gerlinde Winter (Graz) Testmethoden der Molekularpathologie PCR Fragmentanalyse Gelelektrophorese, Kapillarelektrophorese Sequenzierung

Mehr

Ergebnisse. 3 Ergebnisse. 3.1 Etablierung des Mutationsscreenings im Melusingen PCR

Ergebnisse. 3 Ergebnisse. 3.1 Etablierung des Mutationsscreenings im Melusingen PCR 3 Ergebnisse 3.1 Etablierung des Mutationsscreenings im Melusingen 3.1.1 PCR Die verwendeten Primer zur Amplifikation der einzelnen Exons wurden aus der Sequenz des Melusins bestimmt. Die genaue Lage der

Mehr

Labortechniken (2) Amplifikationskurve (linear linear) Realtime-PCR

Labortechniken (2) Amplifikationskurve (linear linear) Realtime-PCR Realtime PCR Quantitative PCR Prinzip: Nachweis der PCR-Produkte in Echtzeit und Quantifizierung anhand eines fluoreszenten Reporters R Q Taq-Polymerase Synthese- und Nuklease-Einheit R=Reporter, Q=Quencher

Mehr

3. Ergebnisse 3.1. Reaktion von Endothelzellkulturen auf Wandschubspannung

3. Ergebnisse 3.1. Reaktion von Endothelzellkulturen auf Wandschubspannung 60 3. Ergebnisse 3.1. Reaktion von Endothelzellkulturen auf Wandschubspannung Nach Stimulierung durch Wandschubspannung liessen die HUVECs aus venösen Nabelschnurendothelien bei lichtmikroskopischer Untersuchung

Mehr

Molekulares Profiling/Individualisierung - Konsequenzen für Standards, Studien und Therapien der Zukunft -

Molekulares Profiling/Individualisierung - Konsequenzen für Standards, Studien und Therapien der Zukunft - PATHOLOGIE LEIPZIG Pathologie Bochum Molekulares Profiling/Individualisierung - Konsequenzen für Standards, Studien und Therapien der Zukunft - Andrea Tannapfel Institut für Pathologie Ruhr-Universität

Mehr

Sequenzanalysen in der Molekularpathologie: Grundlagen des Sequenzierens

Sequenzanalysen in der Molekularpathologie: Grundlagen des Sequenzierens Sequenzanalysen in der Molekularpathologie: Grundlagen des Sequenzierens Wolfgang Hulla KFJ-Sital / SMZ-Süd, Wien Grundlagen Historischer Ausgangspunkt Anwendungen und klinische Relevanz Methodik Auswertung

Mehr

Sequenziertechnologien

Sequenziertechnologien Sequenziertechnologien Folien teilweise von G. Thallinger übernommen 11 Entwicklung der Sequenziertechnologie First Generation 1977 Sanger Sequenzierung (GOLD Standard) Second Generation 2005 454 Sequencing

Mehr

Anhang. Bedeutung Bezeichnung Rs + Nukleotidsequenz (5-3 ) Mutationsprimer Asp 29 Glu

Anhang. Bedeutung Bezeichnung Rs + Nukleotidsequenz (5-3 ) Mutationsprimer Asp 29 Glu AHAG 115 Anhang Tab. 13: Konstruktion der Primer zur Generierung der EcIPDC-Mutanten. Ausgetauschte ukleotide sind unterstrichen. Das ukleotidtriplett, welches für die mutierte Aminosäure codiert, ist

Mehr

MOL.504 Analyse von DNA- und Proteinsequenzen

MOL.504 Analyse von DNA- und Proteinsequenzen MOL.504 Analyse von DNA- und Proteinsequenzen Vorbereitung: Start des Serial Cloners ( unter Laufwerk K: im Ordner Win_SerialCloner2-5 Programm direkt im Ordner starten) K:\Win_SerialCloner2-5 (oder 2-6

Mehr

Pathologie und Prädiktion - neue Aspekte. Prof. Dr. med. C. Wickenhauser Institut für Pathologie

Pathologie und Prädiktion - neue Aspekte. Prof. Dr. med. C. Wickenhauser Institut für Pathologie Pathologie und Prädiktion - neue Aspekte Paradigmenwechsel in der Pathologie -Pathologe zentraler Lotse bei der individuellen Therapieentscheidung -Gewebeuntersuchung nicht nur aus diagnostischen sondern

Mehr

Disclosure. Helmut H. Popper acts as a consultant at the advisary boards of. Helmut H. Popper has got unrestricted research grants from

Disclosure. Helmut H. Popper acts as a consultant at the advisary boards of. Helmut H. Popper has got unrestricted research grants from Disclosure Helmut H. Popper acts as a consultant at the advisary boards of Astra Zeneca Eli Lilly Hofmann La Roche Boehringer Ingelheim Helmut H. Popper has got unrestricted research grants from Eli Lilly

Mehr

Übung 11 Genregulation bei Prokaryoten

Übung 11 Genregulation bei Prokaryoten Übung 11 Genregulation bei Prokaryoten Konzepte: Differentielle Genexpression Positive Genregulation Negative Genregulation cis-/trans-regulation 1. Auf welchen Ebenen kann Genregulation stattfinden? Definition

Mehr

Molekulare Diagnostik Hans Nitschko

Molekulare Diagnostik Hans Nitschko Molekulare Diagnostik Hans Nitschko Nachweis viraler Erreger durch molekularbiologische Methoden Antikörpernachweise Nachweis antigenspezifischer T-Zellen Neutralisationsteste Nachweis Therapie-resistenter

Mehr

Platzhalter für Bild

Platzhalter für Bild Instrumentelle Bioanalytik in der Molekularbiologie Anke Neumann Platzhalter für Bild KIT die Kooperation von Forschungszentrum Karlsruhe GmbH und Universität Karlsruhe (TH) www.kit.edu Motivation und

Mehr

'Agaroselels große DNA-Fragmente im Ethidiumbromid-gefärbten Agarosegel normalenrueise

'Agaroselels große DNA-Fragmente im Ethidiumbromid-gefärbten Agarosegel normalenrueise 4. (Kap2-Enzyme) a) KleinJDNA-Fragmente haben weniger negative Ladungen als große, aber das Masse/Ladungs-Verhältnis ist gleich. Warum wandern sie trotzdem schneller in der Agarose- Gelelektrophorese?

Mehr

Untersuchungen zur Wechselbeziehung von Struktur und Funktion von Transkriptionsaktivatoren am PHO5-Promotor in Saccharomyces cerevisiae

Untersuchungen zur Wechselbeziehung von Struktur und Funktion von Transkriptionsaktivatoren am PHO5-Promotor in Saccharomyces cerevisiae Aus dem Adolf-Butenandt-Institut der Ludwig-Maximilians-Universität München Lehrstuhl: Molekularbiologie Vorstand: Prof. Dr. P. B. Becker Thema: Untersuchungen zur Wechselbeziehung von Struktur und Funktion

Mehr

2.1.2 Anamnese und Untersuchung der Patienten

2.1.2 Anamnese und Untersuchung der Patienten 2. Materialien und Methoden 2.1 Klinische Methoden 2.1.1 Patientengut Für diese Studie wurden insgesamt 108 Patienten ausgewählt, die wegen einer hypertrophen Kardiomyopathie im Deutschen Herzzentrum Berlin

Mehr

Grundprinzip-Sanger. Verfahren - Sanger. Vorlesung 12: Neandertal Genome. Sanger (dideoxy) sequencing. Sequencing ladder 6/28/11

Grundprinzip-Sanger. Verfahren - Sanger. Vorlesung 12: Neandertal Genome. Sanger (dideoxy) sequencing. Sequencing ladder 6/28/11 Vorlesung 12: eandertal Genome Dideoxy (Sanger) Sequenzierung Pyrosequenzierung Sequenz des eandertalers: erste Schritte Sequenz des eandertalers: aktuelle Situation FOXP2 Gen und die Sprache des eandertalers

Mehr

DNA mrna Protein. Initiation Elongation Termination. RNA Prozessierung. Unterschiede Pro /Eukaryoten

DNA mrna Protein. Initiation Elongation Termination. RNA Prozessierung. Unterschiede Pro /Eukaryoten 7. Transkription Konzepte: DNA mrna Protein Initiation Elongation Termination RNA Prozessierung Unterschiede Pro /Eukaryoten 1. Aus welchen vier Nukleotiden ist RNA aufgebaut? 2. RNA unterscheidet sich

Mehr

Klausur zum Modul Molekularbiologie ILS, SS 2010 Freitag 6. August 10:00 Uhr

Klausur zum Modul Molekularbiologie ILS, SS 2010 Freitag 6. August 10:00 Uhr Klausur zum Modul Molekularbiologie ILS, SS 2010 Freitag 6. August 10:00 Uhr Name: Matrikel-Nr.: Code Nummer: Bitte geben Sie Ihre Matrikel-Nr. und Ihren Namen an. Die Code-Nummer erhalten Sie zu Beginn

Mehr

Patente in der Biotechnologie. VPP-Düsseldorf. 2002-März-20

Patente in der Biotechnologie. VPP-Düsseldorf. 2002-März-20 Patente in der Biotechnologie VPP-Düsseldorf 2002-März-20 25 März, 2002 KB-RP / PL / PL4 / Biotechnology 1 Patente in der Biotechnologie Große Tiere, kleine Tiere, Gene, Proteine und Patente 25 März, 2002

Mehr

9. Mutationen. Konzepte: Vorwärts-/Rückwärts-Mutationen. Somatische Zellen oder Keimzellen. Loss-of-function/gain-of-function.

9. Mutationen. Konzepte: Vorwärts-/Rückwärts-Mutationen. Somatische Zellen oder Keimzellen. Loss-of-function/gain-of-function. 9. Mutationen Konzepte: Vorwärts-/Rückwärts-Mutationen Somatische Zellen oder Keimzellen Loss-of-function/gain-of-function Mutagenese 1. Loss-of-function -Mutationen treten häufiger auf als gain-of-function

Mehr

Polymerase-Kettenreaktion

Polymerase-Kettenreaktion Polymerase-Kettenreaktion Universität für Bodenkultur Wien Interuniversitäres Department für Agrarbiotechnologie Tulln Ein Einblick über eine der wohl bekanntesten Analysemethoden der Neuzeit Martin Kellner

Mehr

Anlage zur Akkreditierungsurkunde D PL 13372 01 00

Anlage zur Akkreditierungsurkunde D PL 13372 01 00 Deutsche Akkreditierungsstelle GmbH Anlage zur Akkreditierungsurkunde D PL 13372 01 00 nach DIN EN ISO/IEC 17025:2005 Gültigkeitsdauer: 22.05.2014 bis 25.03.2017 Ausstellungsdatum: 22.05.2014 Urkundeninhaber:

Mehr

Tier-Biotechnologie. Teil II: Genomanalyse sowie gendiagnostische Verfahren. 61

Tier-Biotechnologie. Teil II: Genomanalyse sowie gendiagnostische Verfahren. 61 Tier-Biotechnologie Inhaltsverzeichnis Vorwort. 9 Mitarbeiter. 10 Einführung in die Tier-Biotechnologie. 11 Teil I: Zellkultur- und Bioverfahrenstechniken. 23 1 Kultivierung tierischer Zellen. 25 1.1 Voraussetzungen

Mehr

Molekularbiologische / gentechnische Methoden

Molekularbiologische / gentechnische Methoden Molekularbiologische / gentechnische Methoden MPM 1 Wie lässt sich ein spezifisches Gen/Genprodukt molekular analysieren? Fundamentales Problem: Komplexität biologischer Systeme MPM 2 Ein Ausschnitt aus

Mehr

Klinische Bedeutung von KRAS und BRAF Mutationen in der Therapie des kolorektalen Karzinoms

Klinische Bedeutung von KRAS und BRAF Mutationen in der Therapie des kolorektalen Karzinoms Klinische Bedeutung von KRAS und BRAF Mutationen in der Therapie des kolorektalen Karzinoms S. Stintzing 26.06.09 EGF-Rezeptor - Auf 60-80% der kolorektalen Karzinome exprimiert (IHC) - Intrazelluläre

Mehr

4.1 Erstellung einer Mammakarzinom-spezifischen cdna- Expressionsbank in λ-phagen

4.1 Erstellung einer Mammakarzinom-spezifischen cdna- Expressionsbank in λ-phagen 4 Ergebnisse 4.1 Erstellung einer Mammakarzinom-spezifischen cdna- Expressionsbank in λ-phagen 4.1.1 RNA-Isolierung aus den Mammakarzinom-Zellinien BT-474 und 8701-BC Von jeder Zellinie wurden 4 x 10 7

Mehr

Chromosomendarstellung und -identifizierung

Chromosomendarstellung und -identifizierung Chromosomendarstellung und -identifizierung Bei den 46 Chromosomen des Menschen unterscheidet man 22 homologe Autosomenpaare und 2 Geschlechtschromosomen, das homologe XX-Paar im weiblichen und das nicht-homologe

Mehr

Molekulare Diagnostik in der Dermato-Onkologie: Wie? Wann? Warum? Was? Und was kostet es?

Molekulare Diagnostik in der Dermato-Onkologie: Wie? Wann? Warum? Was? Und was kostet es? Molekulare Diagnostik in der Dermato-Onkologie: Wie? Wann? Warum? Was? Und was kostet es? Ralf Gutzmer Klinik für Dermatologie, Allergologie und Venerologie Haut- Tumor- Zentrum Hannover Wann+Warum? Wenn

Mehr

2. Konstruktion und Charakterisierung einer stx 2 -Mutante im E. coli-stamm O157:H7 86-24

2. Konstruktion und Charakterisierung einer stx 2 -Mutante im E. coli-stamm O157:H7 86-24 IV. Ergebnisse 90 2. Konstruktion und Charakterisierung einer stx 2 -Mutante im E. coli-stamm O157:H7 86-24 Die Konstruktion einer isogenen Toxinmutante des Stx2-produzierenden EHEC- Stamm O157:H7 86-24

Mehr

3 Ergebnisse. 3.1 Mutationen im MYBPC3-Gen. 28 Ergebnisse

3 Ergebnisse. 3.1 Mutationen im MYBPC3-Gen. 28 Ergebnisse 28 Ergebnisse 3 Ergebnisse 3.1 Mutationen im MYBPC3-Gen Bei einem Patientenkollektiv von insgesamt 46 unverwandten Patienten mit dilatativer Kardiomyopathie (DCM) wurde eine systematische Mutationssuche

Mehr

Europäisches Patentamt European Patent Office Dffice europeen des brevets 3> J ) 2) Veröffentlichungsnummer: 0 409 078 AZ

Europäisches Patentamt European Patent Office Dffice europeen des brevets 3> J ) 2) Veröffentlichungsnummer: 0 409 078 AZ 3> J ) Europäisches Patentamt European Patent Office Dffice europeen des brevets 2) Veröffentlichungsnummer: 0 409 078 AZ 3> EUROPAISCHE PATENTANMELDUNG Anmeldenummer: 90113328.0 ) Int. CIA C1 20. 1/68

Mehr

Rekombinante DNA. Werkzeuge der Gentechnik

Rekombinante DNA. Werkzeuge der Gentechnik Rekombinante DNA = im Labor neu zusammengesetzte DNA. Ein definiertes DNA Fragment (meistens ein Gen) wird aus seiner ursprünglichen Lage entnommen und in einen Vektor integriert, der gezielt in andere

Mehr

Versuch 2: Polymerasekettenreaktion. Betreuer: Knut Jahreis. Versuchsinhalt. Polymerasekettenreaktion, Gelelektrophorese auf Agarosegelen

Versuch 2: Polymerasekettenreaktion. Betreuer: Knut Jahreis. Versuchsinhalt. Polymerasekettenreaktion, Gelelektrophorese auf Agarosegelen Versuch 2: Polymerasekettenreaktion Betreuer: Knut Jahreis Versuchsinhalt Polymerasekettenreaktion, Gelelektrophorese auf Agarosegelen Zwei verschiedene Plasmide werden als Matrizen für eine Polymerasekettenreaktion

Mehr

Begleittext zum Foliensatz Erbgänge beim Menschen

Begleittext zum Foliensatz Erbgänge beim Menschen Für ein besseres Verständnis der Folien werden vorab einige Begriffe definiert: Gen Genom Allel Ein Gen ist die physikalische und funktionelle Einheit der Vererbung. Biochemisch ist es eine geordnete Abfolge

Mehr

Vom Gen zum Naturstoff!

Vom Gen zum Naturstoff! Pierre Stallforth // HKI Jena Vom Gen zum Naturstoff Sequenzierung: Wie erhalte ich genomische Informationen eines Organismus Genetische Knockouts, (CRISPR-Cas9) Veränderung: Bioinformatik: Datenbanken,

Mehr

3. Methoden. 3.1 Chemikalien und Geräte

3. Methoden. 3.1 Chemikalien und Geräte 3. Methoden Aufgabenstellung: Ziel der Arbeit war es eine eigene Multiplexreaktion zu erstellen, die im Rechtsmedizinischen Institut der Martin-Luther-Universität Halle-Wittenberg zur Durchführung von

Mehr

Universitätsklinikum Essen Medizinische Fakultät der Universität-Gesamthochschule Duisburg-Essen. Aus dem Institut für Humangenetik

Universitätsklinikum Essen Medizinische Fakultät der Universität-Gesamthochschule Duisburg-Essen. Aus dem Institut für Humangenetik Universitätsklinikum Essen Medizinische Fakultät der Universität-Gesamthochschule Duisburg-Essen Aus dem Institut für Humangenetik Deletionen und Insertionen des RB1-Gens bei Patienten mit Retinoblastom:

Mehr

Evidence of strobilurine resistant isolates of A. solani and A. alternata in Germany

Evidence of strobilurine resistant isolates of A. solani and A. alternata in Germany Technische Universität München Evidence of strobilurine resistant isolates of A. solani and A. alternata in Germany H. Hausladen, B. Adolf and J. Leiminger outline introduction material and methods results

Mehr

Bioinformatik. Zeichenketten und Stringalgorithmen. Ulf Leser Wissensmanagement in der. Bioinformatik

Bioinformatik. Zeichenketten und Stringalgorithmen. Ulf Leser Wissensmanagement in der. Bioinformatik Bioinformatik Zeichenketten und Stringalgorithmen Ulf Leser Wissensmanagement in der Bioinformatik Inhalt dieser Vorlesung Warum Stringmatching? Strings und Matching Naiver Algorithmus Ulf Leser: Bioinformatik

Mehr

Polizei sucht Täter FALL: MISSION:

Polizei sucht Täter FALL: MISSION: Polizei sucht Täter FALL: Polizei hat ein Photo des Täters veröffentlicht Polizei sucht einen Mann der Dienstag früh in einer Maske ein Laboratorium ausgeraubt hat. Er hat einen Medizinstudenten getötet,

Mehr

Kapillarelektrophorese DNA-Sequenzierung

Kapillarelektrophorese DNA-Sequenzierung Kapillarelektrophorese DNA-Sequenzierung DNA Kettenanalyse oder DNA-Sequenzierung wird bei der Anordnung der Primärstruktur und Bestimmung der Nukleotid-Basensequenz verwendet. Die Analyse basiert auf

Mehr

Informationsveranstaltung Heimtierfuttermittel. PCR-Analytik zur Bestimmung von GVOs in Heimtierfuttermitteln. C. Haldemann, ALP

Informationsveranstaltung Heimtierfuttermittel. PCR-Analytik zur Bestimmung von GVOs in Heimtierfuttermitteln. C. Haldemann, ALP Informationsveranstaltung Heimtierfuttermittel PCR-Analytik zur Bestimmung von GVOs in Heimtierfuttermitteln C. Haldemann, ALP Grundidee des Nachweises von GVOs mittels PCR Die Bestimmung genveränderter

Mehr

DNA-Analytik. Beispiel: Nachweis von gentechnisch veränderten Lebensmitteln

DNA-Analytik. Beispiel: Nachweis von gentechnisch veränderten Lebensmitteln DNA-Analytik Beispiel: Nachweis von gentechnisch veränderten Lebensmitteln rdna PCR mrna RT-PCR Protein (Enzym) Immunochemie Produkt Stoffanalytik 1. Extraktion der DNA aus den Lebensmitteln 2. DNA liegt

Mehr