Biogasregister Deutschland Kriterienkatalog.

Größe: px
Ab Seite anzeigen:

Download "Biogasregister Deutschland Kriterienkatalog."

Transkript

1 . Nr. Bezeichnung Nr. Bezeichnung 1 (b) Biomasse i.s.d. BiomasseV 2 (b) Ausschließlichkeit 3 (b) sonstige Biomasse (StromStG) 4 (b) Mengengerüst plausibel 5 (b) Einsatzstofftagebuch 6 (b) Einspeisemenge in Erdgasnetz 7 (b) Erdgasqualität für gesamte Menge 8 1 (b) max. Methanemission (EEG 2009) 9 (b) max. Stromverbrauch (EEG 2009/2012 und EEWärmeG 2009/2011) 10 (b) regenerative Prozesswärme (EEG 2009/2012) 11 (a) Kapazität bis 350 Nm³/h 12 (a) Kapazität Nm³/h 13 (a) Verklammerung von Gasaufbereitungs- Anlagen lag nicht vor 14 (b) Nawaro/Gülle 15 (b, U) ggf. Nebenprodukte 16 1 (a) eine Anlage/ Betriebsgelände 17 (b) 17a (b) Gärrestabdeckung/Gasfackel Gasfackel 18 (b, U) Landschaftspflege 19 (b) Deponiegas ausschließlich 20 (b) Klärgas ausschließlich 21 (b) Methanemission (EEWärmeG 2009) 22 (b) Prozesswärme/Abwärme (EEWärmeG 2009) 23 (b) DIN (c) Massebilanzsystem (BLE) 25 3 (a) Nachhaltigkeitsnachweis der Schnittstelle 26 1 (b) Nachhaltigkeitsnachweis (Übergangslösung) 27 (b) Massenbilanzierung bis zur Einspeisung in das Erdgasnetz 28 (b,u 2 ) Einsatzstoffvergütungsklasse 0 29 (b, U 2 ) Einsatzstoffvergütungsklasse 1 30 (b, U 2 ) Einsatzstoffvergütungsklasse 2a 31 (b, U 2 ) Einsatzstoffvergütungsklasse 2b (Gülle) 32 (a) Nennleistung Nm³/h 33 (a) Nennleistung Nm³/h 34 (a) Nennleistung Nm³/h 35 (b) Gärrestlager, Verweildauer, Gasverbrauchseinrichtung 36 (b) Gärrückstand-Nachrotte 37 (b) Maisdeckel (max. 60 %) 38 (b) max. Methanemission (EEG 2012 und EE- WärmeG 2011) 39 (b) Bioabfälle (mind. 90 %) 40 (b) Stoffliche Verwertung Gärrückstände 41 (b) Biomasse i. S. d. EEWärmeG 42 (b) Biomasse i.s.d. 7 der 36. BImschV 43 (b) Biomasse i. S. d. MVO 44 (b) Gas ausschließlich aus EE-Strom 45 (a) Zwischenspeicherung vor dem Stromnetz 46 (b) Keine gezielte Erzeugung von CO/CO 2 47 (b) H 2 /CH 4 weit überwiegend aus EE nach RL 2009/28/EG 48 (b) Ausschließlichkeit Elektrolyseur 49 (a) GAA mit Einspeisung vor dem (a) GAA mit Genehmigung vor dem und Einspeisung vor dem Seite 1 von 12

2 Hinweise. Typ der Nachweisführung a: anlagenbezogenes Kriterium, Teil des Anlagenaudits (wird ex ante dokumentiert) b: betriebsbezogenes Kriterium, Voraussetzung für Betriebsaudit (wird ex post dokumentiert) c: chargenbezogenes Kriterium, muss bei jeder Teilung/Besitzerwechsel vom Nutzer neu belegt werden, lückenlose Nachweiskette nötig. U: Diese Prüfung muss durch einen Umweltgutachter vorgenommen werden Fußnoten 1: Kriterien 8, 16 und 26 sind nicht mehr in Anwendung bzw. ihre Anwendbarkeit wird absehbar auslaufen. Näheres dazu erfahren Sie in den Erläuterungen zu den einzelnen Kriterien. 2: Die Dokumentation von gemischten Einsatzstoffvergütungsklassen kann nur durch Umweltgutachter durchgeführt werden. 3: Massenbilanzierung gemäß den gesetzlichen Vorgaben über die Webanwendung nabisy der Bundesanstalt für Landwirtschaft und Ernährung (BLE). Rechtshinweis: Die nachfolgenden Erläuterungen zum Kriterienkatalog des Biogasregisters sind nach bestem Wissen des Registerführers erstellt worden. Der Registerführer übernimmt jedoch keine Gewähr für die Vollständigkeit, Richtigkeit oder Aktualität. Der Registerführer hat die Absicht, mit dieser Erläuterung eine hilfreiche Übersicht über die wesentlichen Kriterien zu geben. Bitte beachten Sie, dass der Registerführer keine rechtlich verbindlichen oder rechtsberatenden Aussagen trifft bzw. treffen darf. Seite 2 von 12

3 Erläuterungen der Kriterien Nr. 1 (b) Biomasse i.s.d. BiomasseV 2012/2014 Bei der Herstellung des Biogases wurde nur Biomasse im Sinne der BiomasseV 2012/2014 eingesetzt (Beispiel: Pflanzen und Pflanzenbestandteile, 2 Abs. 2 Nr. 1 BiomasseV 2012/2014). Ggf. ist hier auch zu prüfen, ob anteilig Biomasse außerhalb der Definition der BiomasseV eingesetzt wurde. Zulässig wäre beispielsweise der Einsatz von bestimmten tierischen Nebenprodukten, weil zwar Biomasse, aber außerhalb der BiomasseV, wie 3 Nr. 9 BiomasseV zeigt. Der Auditor prüft dann, ob die eingesetzte sonstige Biomasse tatsächlich ausschließlich sonstige Biomasse war (und nicht etwa eine sonstige vergärbare Substanz wie Papier, Pappe, ). Zudem wird überprüft, dass der angegebene Anteil der sonstigen Biomasse eingehalten wurde (Einsatzstofftagebuch). vgl. 44 EEG 2014; 27 Abs. 1 EEG 2009/2012; 8 Abs. 1 EEG 2004; 3 Nr. 1 EEWärmeG BW; 2 Abs.1 Biokraft-NachV ggf. 27 Abs. 3 Nr.2 EEG 2009, Art. 2 lit. e EE-RL 2 (b) Ausschließlichkeit Nachweis, dass für den förderfähigen Anteil (für Vergütung nach 8 Abs. 1 EEG 2004: für die gesamte Stromerzeugung) keine anderen Substanzen als Biomasse im Sinn der BiomasseV 2012/2014 eingesetzt wurden (Beispiel: Nachweis, dass z.b. kein Torf eingesetzt wurde, 3 Nr. 2 BiomasseV 2012/2014). 19 Abs. 1 EEG 2014; 16 Abs. 1 EEG 2009, 44 EEG 2014, 45 EEG 2014; 27 Abs. 1 und 27a EEG 2009/2012; 8 Abs. 1 EEG 2004; Sonstige Biomasse: 3 (b) sonstige Biomasse (StromStG) Einsatz von Biomasse im Sinne von 2 Nr. 7 StromStG. vgl. 27 Abs. 3 Nr.2 EEG 2009, 2 Nr. 7 StromStG vgl. 2 Nr. 7 StromStG Seite 3 von 12

4 4 (b) Mengengerüst plausibel Nachweis, dass die zur Erzeugung eingesetzte Biomassemenge für die produzierte Biogasmenge ausreichend war. Bei Speichergas Nachweis, dass der zur Erzeugung des Speichergases eingesetzte Strom aus ausschließlich erneuerbaren Energien ausreichend für die produzierte Menge Speichergas war. Prüfung durch Sachverständigen 5 (b) Einsatzstofftagebuch Die zur Biogasproduktion genutzten Rohstoffe wurden lückenlos und vollständig in einem Einsatzstofftagebuch dokumentiert. vgl. 47 Abs. 2 Nr. 1 EEG 2014; 27 Abs. 3 Nr. 2 und Ziff. I Nr. 1.b Anlage 2 EEG 2009; 27 Abs. 5 (b)und Abs. 6 Nr. 4 EEG 2012; 8 Abs. 2 Nr. 2 EEG (b) Einspeisemenge in Erdgasnetge/Speichergasmenge Nachweis, dass die Biogasmen- vgl. 47 Abs. 6 EEG 2014, 27 tatsächlich in das Abs. 2 EEG 2009, Erdgasnetz eingespeist wurde (per Zählerstandprüfung). 25 Abs. 2, 24 Abs. 2 EEG 2009/2012, 27c Abs. 1 EEG 2012; 8 Abs. 1 S. 3 EEG 2004; Ziff. II.1.b) EEWärmeG 2009; Ziff. II.1.c)aa) EEWärmeG 2011; 3 Nr. 2 EEWärmeG BW; 50 Abs. 1 Nr. 4 EnergieStG; 37a Abs. 4 BImSchG 16 Abs. 2 Satz 1 EEG 7 (b) Erdgasqualität für gesamte Menge Das gesamte eingespeiste Biogas wurde auf Erdgasqualität aufbereitet, das Kriterium Erdgasqualität ist deshalb für die gesamte Einspeisemenge gegeben. 27c Abs. 2 EEG 2012; Anlage 1 Ziff. I Nr. 1 EEG 2009/2012; 8 Abs. 4 EEG 2004; Ziff. II.1.b) EEWärmeG 2009; Ziff. II.1.c) EEWärmeG 2011; 50 Abs. 1 Nr. 4 EnergieStG; 37a Abs. 4 BImSchG Seite 4 von 12

5 8 1 (b) max. Methanemission (EEG 2009) 9 (b) max. Stromverbrauch (EEG 2009/2012 und EE- WärmeG 2009/2011) 10 (b) regenerative Prozesswärme (EEG 2009/2012) Die bei der Aufbereitung maximal erlaubte Methanemission in die Atmosphäre von 0,5 % wurde nicht überschritten. Kriterium 8 ist zum ausgelaufen, vgl. 66 Abs. 1 Nr. 7 EEG Seit dem beträgt der sog. Methanschlupf auch für Bestandsanlagen 0,2 % (statt 0,5%), siehe Kriterium 38. Bei der Aufbereitung wurde ein Stromverbrauch von max. 0,5 kwh pro Nm³ Rohgas nicht überschritten. Die für die Erzeugung und Aufbereitung benötigte Prozesswärme wurde vollständig aus erneuerbaren Energien, Grubengas oder aus der Abwärme der Gasaufbereitungs- oder Einspeiseanlage ohne Einsatz zusätzlicher fossiler Energie bereitgestellt. Anlage 1 Ziff. I Nr. 1.a EEG 2009 Anlage 1 Ziff. I Nr. 1.b EEG 2009/2012; Anlage Ziff. II.1.b)bb) EE- WärmeG 2009; Anlage Ziff. II Nr. 1.c) aa) EEWärmeG 2011 Anlage 1 Ziff. I Nr. 1.c EEG 2009/ (a) Kapazität bis 350 Nm³/ h Die Produktionskapazität der Anlage ist kleiner 350 Nm³/h (Outputmenge aus Gasaufbereitungsprozess). 12 (a) Kapazität Nm³/h Die Produktionskapazität der Anlage liegt zwischen 350 Nm³/h und 700 Nm³/h (Outputmenge aus Gasaufbereitungsprozess). 350 Nm³: vgl. Anlage 1 Ziff. I Nr. 2.a EEG Nm³: vgl. Anlage 1 Ziff. I Nr. 2.b EEG (a) Verklammerung von Anlagen lag nicht vor Keine Verklammerung von mehreren Aufbereitungsanlagen durch Lage auf einem Grundstück oder sonst in unmittelbarer räumlicher Nähe. Anlage 1 Ziff. I. 2. i. V. m. 19 Abs. 1 EEG 2009/2012 Seite 5 von 12

6 14 (b) Nawaro/Gülle Alle Rohstoffe für die Biogasproduktion erfüllen tatsächlich die Anforderungen an nachwachsende Rohstoffe oder Gülle, es sei denn, es werden zulässige pflanzliche Nebenprodukte eingesetzt. In diesem Fall fällt die aus den pflanzlichen Nebenprodukten erzeugte Gasmenge unter Kriterium (b,u) ggf. Nebenprodukte Prüfung, dass neben Nawaro und Gülle nur zulässige pflanzliche Nebenprodukte wie zum Beispiel Gemüseabputz eingesetzt wurden. Anlage 2 Ziff. I Nr. 1a), Ziff. II.-IV. EEG 2009 Anlage 2 Ziff. I Nr. 3, Ziff V EEG (a) eine Anlage/ Betriebsgelände 17 (b) Gärrestabdeckung/Gasfackel Dies Kriterium dient der Abgrenzung der Teilgasmengen aus Nawaro, Gülle und pflanzlichen Nebenprodukten. Nur eine Anlage auf dem Betriebsgelände. Kriterium 16 ist seit dem auch für die Stromerzeugung in Bestandsanlagen nicht mehr anzuwenden. Bestätigung, dass das Gärrestlager gasdicht abgedeckt war und eine zusätzliche Gasverbrauchseinrichtung für einen Störfall oder für eine Überproduktion verwendet wurde, gilt nur für nach BImSchG genehmigungspflichtige Anlagen. Anlage 2 Ziff. I Nr. 1.c EEG 2009 Anlage 2 Ziff. I Nr. 4 EEG a (b) Gasfackel Anlagen, die die Grundvergütung nach EEG 2009, nicht aber den Nawaro-Bonus beanspruchen, müssen nachweisen, dass bei der Erzeugung zusätzliche Gasverbrauchseinrichtungen installiert waren. 66 Abs. 1 Nr. 3, 6 Abs. 4 Nr. 2EEG 2012 Wurde Kriterium 17 positiv geprüft, ist damit Kriterium 17a ebenfalls als erfüllt anzusehen und braucht nicht ausgewählt zu werden. Seite 6 von 12

7 18 (b,u) Landschaftspflege Es wurden überwiegend Rohstoffe aus Resten aus der Landschaftspflege eingesetzt (inkl. Mengennachweis). Anlage 2 Ziff. VI Nr. 2.c EEG 2009 i.v.m. 101 Abs. 2 Nr. 1 EEG 2014 und Anlage 3 Nr. 5 zur BiomasseV (b) Deponiegas ausschließlich Es handelt sich ausschließlich um Deponiegas. 24 Abs. 1 EEG 2009/2012; 2 Nr. 4.c) EEWärmeG, 2 Nr. 7 StromStG 20 (b) Klärgas ausschließlich Es handelt sich ausschließlich um Klärgas. 25 Abs. 1 EEG 2009/2012; 2 Abs. 1 Nr. 4.d) EEWärmeG; 2 Nr. 7 StromStG 21 (b) Methanemission (EE- Methanemissionen und Stromverbrauch Anlage Ziff. II Nr. 1.c) aa) WärmeG 2009) wurden nach jeweils bester verfügbarer EEWärmeG 2009 Technik gesenkt (Anforderungen des EE- WärmeG 2009). 22 (b) regenerative Prozesswärme/Abwärme (EE- WärmeG 2009) Prozesswärmebedarf wurde aus erneuerbaren Energien oder aus Abwärme gedeckt. Anlage Ziff. II Nr. 1.b) bb) EEWärmeG (b) DIN Das Biogas entspricht den Anforderungen der DIN (c) Massebilanzsystem (BLE) Lückenloser Nachweis der Herkunft der nachhaltigen Biomasse über ein Massebilanzsystem nach BioKraftNachV, z.b. nabisy von der BLE. 25 (a) Nachhaltigkeitsnachweis Die Biogasaufbereitungsanlage darf Nachhaltigkeitsnachweise ausstellen, weil für sie ein gültiges Schnittstellenzertifikat vorliegt. Damit wurde im Voraus (ex ante) der Nachweis erbracht, dass nachhaltige Biomasse eingesetzt wird. vgl. 6 der 10. BImSchV ivm 50 Abs. 1 Nr. 4 EnergieStG bzw. i.v.m. 37a Abs. 4 BIm- SchG 16 Abs. 2, 17 Abs. 2 Biokraft-NachV 11, 20 Abs. 1 Nr. 3 BioKraftNachV Seite 7 von 12

8 26 1 (b, U) Nachhaltigkeitsnachweis (Übergangslösung) Wenn der Biokraftstoff bis zum in den Verkehr gebracht wurde, kann alternativ zu Kriterium 25 auch durch die Bescheinigung eines Umweltgutachters im Nach- 58 BioKraftNachV, 37c Abs. 1 S. 1 BImSchG 50 EnergieStG, 94 Abs. 1 EnergieStV hinein nachgewiesen werden, dass die Menge zum Zeitpunkt der Einspeisung ins Erdgasnetz die Anforderungen der BioKraft- NachV erfüllt hat. 27 (b) Massenbilanzierung bis zur Einspeisung in das Erdgasnetz Die Übergangslösung für den Nachweis über die Menge des in Verkehr gebrachten Biokraftstoffs läuft rückwirkend für das Jahr 2011 mit dem aus. Die Übergangslösung für die Energiesteuerentlastung von Biokraftstoffen läuft rückwirkend für das Jahr 2011 mit dem aus. Von der Herstellung des Biomethans/Speichergases (bzw. bei der Aufbereitung von Rohbiogas aus mehreren Fermentern in derselben Aufbereitungsanlage: empfohlen ab der Herstellung des Rohbiogases) bis zur Einspeisung in das Erdgasnetz wurde die vorgeschriebene Massenbilanzierung durch den Auditor durchgeführt. Die an den Erdgasnetzbetreiber übergebene Menge wurde an das Biogasregister Deutschland übergeben.. 47 Abs. 6 EEG 2014; 27c Abs. 1 Nr. 2 EEG 2012 i.v.m. 100 Abs. 1 Nr. 4 EEG Abs. 2 EEWärmeG; Ziff II. Nr 1. c) bb) Anlage EEWärmeG 2011, Auslegungshilfe zur Massenbilanzierung nach 27c Absatz 1 Nummer 2 EEG 2012 des BMU vom (b 2 ) Einsatzstoffvergütungsklasse 0 29 Einsatzstoff- (b,u 2 ) Vergütungsklasse 1 Als Substrat wurde Biomasse im Sinne der BiomasseV eingesetzt, die keinen Anspruch auf eine einsatzstoffbezogene Vergütung begründen Als Substrat wurden Stoffe der Einsatzstoffklasse 1 gemäß Anlage 2 der BiomasseV eingesetzt. 27 Abs. 1 EEG 2012; Anlage 1 BiomasseV Abs 2 Nr. 1 EEG 2012; Anlage 2 BiomasseV 2014 Seite 8 von 12

9 30 (b,u 2 ) Einsatzstoff- Vergütungsklasse 2a 31 (b,u 2 ) Einsatzstoff- Vergütungsklasse 2b (Gülle) Als Substrat wurden Stoffe der Einsatzstoffklasse 2 gemäß Anlage 3 der BiomasseV eingesetzt, jedoch keine Gülle. Als Substrat wurde Gülle eingesetzt, die als Stoff der Einsatzstoffklasse 2 gemäß Anlage 3 der BiomasseV gilt 27 Abs 2 a) EEG 2012; Anlage 3 BiomasseV Abs 2 Nr. 2 b) EEG 2012; Anlage 3 BiomasseV (a) Nennleistung Nm³/h 33 (a) Nennleistung Nm³/h 34 (a) Nennleistung Nm³/h 35 (b) Gärrestlager, Verweildauer, Gasverbrauchseinrichtung Die Nennleistung der Anlage ist kleiner 700 Nm³/h (Outputmenge aus Gasaufbereitungsprozess). Die Nennleistung der Anlage liegt zwischen 700 und Nm³/h (Outputmenge aus Gasaufbereitungsprozess). Die Nennleistung der Anlage liegt zwischen und Nm³/h (Outputmenge aus Gasaufbereitungsprozess). Ein am Standort der Biogaserzeugung nach dem neu errichtetes Gärrestlager ist technisch gasdicht abgedeckt. Die hydraulische Verweilzeit in diesem System beträgt mindestens 150 Tage. Es wurde an eine Gasverwertung angeschlossen. Es werden zusätzliche Gasverbrauchseinrichtungen zur Vermeidung einer Freisetzung von Biogas verwendet. Anlage 1 Nr. 2 EEG 2012 Anlage 1 Nr. 2 EEG 2012 Anlage 1 Nr. 2 EEG Abs. 5 EEG (b) Gärrückstand-Nachrotte Der Fermenter ist unmittelbar mit der Gärrückstand-Nachrotte 27a Abs. 3 EEG 2012 verbunden. Betrifft nur die Vergärung von Bioabfällen. Seite 9 von 12

10 37 (b) Maisdeckel (max. 60 %) Der Anteil von Mais (Ganzpflanze) und Getreidekorn einschließlich Corn-Cob-Mix und Körnermais sowie Lieschkolbenschrot am eingesetzten Substrat betrug im Kalenderjahr maximal 60 Masseprozent ( Maisdeckel ). 27 Abs. 5 Satz 1 EEG 2012 Für Anlagen, die Biogas aus Biogaserzeugungsanlagen einsetzen, die bereits vor dem Biogas erzeugt haben, gilt diese Regelung nicht ( 66 Abs. 4 EEG 2012). 38 (b) max. Methanemission (EEG 2012 und EEWärmeG 2011) Die Methanemission bei der Aufbereitung ist kleiner 0,2 %. 39 (b) Bioabfälle (mind. 90 %) Als Substrat wurde Biomasse im Sinne der BiomasseV 2012/2014 mit einem Anteil von getrennt erfassten Bioabfälle (biologisch abbaubare Abfälle, gemischte Siedlungsabfälle, Marktabfälle) von durchschnittlich mindestens 90 Masseprozent eingesetzt. 27c Abs. 1 (ggf. i.v.m. 66 Abs. 1 Nr. 7) EEG 2012; Anlage 1 Nr. 1 EEG 2012; 5 Abs. 2 EEWärmeG 2011; Anlage Ziff. II. Nr. 1. c) aa) EEWärmeG EEG 2014; 27a Abs. 1 ( i.v.m. 100 Abs. 1 Nr. 4 EEG 2014 und ggf. 66 Abs. 1 Nr. 13) EEG 2012; Anhang 1 Nr. 1 Spalte 2 BioabfallV 40 (b) stoffliche Verwertung Gärrückstände 41 (b) Biomasse i. S. d. EEWärmeG 2009/2011 Die nachgerotteten Gärrückstände wurden stofflich verwertet. Betrifft nur die Vergärung von Bioabfällen. Für die Herstellung des Biogases wurden Substrate eingesetzt, die den Anforderungen aus dem EEWärmeG entsprechen (biologisch abbaubare Anteile von Abfällen aus privaten Haushalten und Industrie, Deponiegas, Klärgas, Klärschlamm i.s.d. KlärschlammV, Pflanzenmethylester). Dieses Kriterium beschreibt einen weiteren Biomassebegriff als in Kriterium Abs. 2 EEG 2014, 27a Abs 3 EEG Abs. 1 Nr. 4 EEWärmeG (2009/2011) Seite 10 von 12

11 42 (b) Biomasse i.s.d. 7 der 36. BImSchV 43 (b) Biogas im Sinne der MVO (min. 97 %) 44 (b) Gas ausschließlich aus EE- Strom 45 (a) Zwischenspeicherung vor dem Stromnetz 46 (b) Keine gezielte Erzeugung von CO/CO 2 Das Biogas wurde (anteilig) physisch aus Substraten erzeugt, die den Anforderungen nach 7 der 36. BImSchV entsprechen Das Biogas wurde aus Biomasse im Sinne der MVO hergestellt. Das Gas entspricht den Anforderungen an Speichergas. Es ist zum Zweck der Zwischenspeicherung von Strom aus erneuerbaren Energien ausschließlich unter Einsatz von Strom aus erneuerbaren Energien erzeugt worden. Erneuerbare Energien sind Wasserkraft einschließlich der Wellen-, Gezeiten, Salzgradienten- und Strömungsenergie, Windenergie, solare Strahlungsenergie, Geothermie, Energie aus Biomasse einschließlich Biogas, Biomethan, Deponiegas und Klärgas sowie aus dem biologisch abbaubaren Anteil von Abfällen aus Haushalten und Industrie. 14 Nr. 14 EEG Der Strom aus erneuerbaren Energien wurde vor der Einspeisung in das Stromnetz für die allgemeine Versorgung ( 3 Nr. 7 EEG) zwischengespeichert (durch die Erzeugung von Speichergas). Die Einrichtung zur Speicherung des Stroms im Fall der Gewinnung von Speichergas regelmäßig der Elektrolyseur darf also nicht über das Netz für die allgemeine Versorgung von den EEG- Stromerzeugungsanlagen beliefert werden, aus denen der Strom zwischengespeichert werden soll. Das eingesetzte Kohlendioxid oder Kohlenmonoxid wurde nicht ausschließlich zum Zweck der Methanisierung von Wasserstoff erzeugt. 7 der 36. BImSchV 7 der 36. BImSchV 5 Nr. 29 EEG Abs. 4 Satz 1 EEG Nr. 29 EEG 2014Bundestags- Drucksache 17/6071 S. 62 Seite 11 von 12

12 47 (b) H 2 /CH 4 weit überwiegend aus EE nach RL 2009/28/EG 48 (b) Ausschließlichkeit Elektrolyseur 49 (a) GAA mit erstmaliger Einspeisung vor dem (a) GAA mit Genehmigung vor dem und erstmaliger Einspeisung vor dem Es handelt sich um Wasserstoff aus der Wasserelektrolyse oder um synthetisch erzeugtes Methan, bei denen der zur Elektrolyse eingesetzte Strom und das zur Methanisierung eingesetzte Kohlendioxid oder Kohlenmonoxid jeweils nachweislich weit überwiegend aus erneuerbaren Energiequellen im Sinne der Richtlinie 2009/28/EG stammen, 3 Nr. 10c EnWG. Als weit überwiegend soll nach der Gesetzesbegründung ein Anteil von mindestens 80 Prozent ausreichen (Bundestagsdrucksache 17/6072, S. 50). Mit der Einhaltung dieses Kriteriums können Wasserstoff/Methan als Biogas im Sinne des EnWG betrachtet werden, woraus sich gerade bei der Einspeisung in das Erdgasnetz Vorteile ergeben können. Jedoch ergibt sich allein aus der Einhaltung dieser Anforderungen noch kein Anspruch auf eine Vergütung nach dem EEG damit es sich um Speichergas nach 3 Nr. 9a EEG handelt, muss das Gas vielmehr ausschließlich unter Einsatz von Strom aus erneuerbaren Energien im Sinne des EEG erzeugt werden. Die Einrichtung zur Erzeugung des Speichergases wird durchgehend ausschließlich mit erneuerbaren Energien betrieben. Die GAA speiste erstmals vor dem Biomethan in das Erdgasnetz ein. Die GAA ist nach dem BImSchG genehmigungsbedürftig, wurde vor dem genehmigt und speiste erstmals vor dem Biomethan in das Erdgasnetz ein. 3 Nr. 10c EnWG Bundestagsdrucksache 17/6072, S.50 5 Nr. 1, 2. Hs. EEG 2014;, 19 Abs. 1 EEG Abs. 2 S. 2 und 3 EEG Abs. 2 S. 4 EEG 2014 Seite 12 von 12

Biogasregister Deutschland Biogasregister-Auszug über eine Biogas-Lieferung

Biogasregister Deutschland Biogasregister-Auszug über eine Biogas-Lieferung 1 Produktion und Einspeisung Nach Angaben des Biogasproduzenten und bestätigt durch ein (oder mehrere) Sachverständigen- Gutachten (Auditberichte) wurde in der Anlage Riedlingen Wolfsgruben 1 88499 Riedlingen

Mehr

Regelungen und Anforderungen an die Biomethanerzeugung im EEG 2012. biogaspartner die konferenz

Regelungen und Anforderungen an die Biomethanerzeugung im EEG 2012. biogaspartner die konferenz Regelungen und Anforderungen an die Biomethanerzeugung im EEG 2012 biogaspartner die konferenz am 1. Dezember 2011 in Berlin Rechtsanwalt Dr. Florian Valentin Schnutenhaus & Kollegen Reinhardtstraße 29

Mehr

VorgangsID: Betreiber der Stromerzeugungsanlage. Tel.: Fax: Inbetriebnahme: Installierte Leistung:

VorgangsID: Betreiber der Stromerzeugungsanlage. Tel.: Fax: Inbetriebnahme: Installierte Leistung: VERBINDLICHE ERKLÄRUNG ZUR ERMITTLUNG DER FÖRDERFÄHIGKEIT UND DER MAßGEBLICHEN VERGÜTUNGSHÖHE FÜR STROM AUS BIOMASSE-ANLAGEN NACH DEM GESETZ FÜR DEN VORRANG ERNEUERBARER ENERGIEN (ERNEUERBARE- ENERGIEN-GESETZ-EEG)

Mehr

Zertifizierung der Einspeisung von Biomethan in das Erdgasnetz (kurz: Erzeugung GM)

Zertifizierung der Einspeisung von Biomethan in das Erdgasnetz (kurz: Erzeugung GM) TÜV SÜD Standard Zertifizierung der Einspeisung von Biomethan in das Erdgasnetz (kurz: Erzeugung GM) Version 12/2012 TÜV SÜD Industrie Service GmbH Carbon Management Service Westendstraße 199 80686 München

Mehr

Einspeisevergütung nach EEG (ct/kwh) Photovoltaik

Einspeisevergütung nach EEG (ct/kwh) Photovoltaik Photovoltaik Photovoltaik ( 32 und 33 EEG) Inbetriebnahme ab 01.04.2011 01.05.2012 01.06.2012 01.07.2012 01.08.2012 01.09.2012 Anlagengröße bis 10 kw 19,5 19,31 19,11 18,92 18,73 18,54 ab 10 kw 16,5 16,34

Mehr

Ergänzende Systemgrundlagen für die Zertifizierung von gasförmigen Biokraftstoffen aus Biogasanlagen

Ergänzende Systemgrundlagen für die Zertifizierung von gasförmigen Biokraftstoffen aus Biogasanlagen ISCC 201 / Biogasanlage Ergänzende Systemgrundlagen für die Zertifizierung von gasförmigen Biokraftstoffen aus Biogasanlagen ISCC 28-06-13 V 1.02 28-06-13 Copyright-Vermerk ISCC 2013 Dieses Dokument von

Mehr

Biomassenutzung und Naturschutzrecht

Biomassenutzung und Naturschutzrecht Bundesfachtagung Naturschutzrecht Landnutzung in der offenen Kulturlandschaft Biomassenutzung und Naturschutzrecht Dr. Frank Fellenberg, LL.M. (Cambr.) Rechtsanwalt und Fachanwalt für Verwaltungsrecht,

Mehr

ANFORDERUNGEN AN BESTANDSANLAGEN NACH DEM EEG 2014

ANFORDERUNGEN AN BESTANDSANLAGEN NACH DEM EEG 2014 ANFORDERUNGEN AN BESTANDSANLAGEN NACH DEM EEG 2014 30.09.2014 Energie Regulierung & Governmental Affairs Gleichzeitig mit dem Inkrafttreten des EEG 2014 am 01.08.2014 ist das bislang geltende EEG 2012

Mehr

Biomethaneinspeisung in Ungarn

Biomethaneinspeisung in Ungarn Biomethaneinspeisung in Ungarn Dipl.-Ing. Zoltan Elek, Landwärme GmbH Bioenergy Decentral DLG Tagung Biogasmärkte: Internationale Biogasmärkte 17. November 2010 Biogasanlage Kaposvár Standort Kaposvár,

Mehr

EEG Novelle 2014. Harald Wedemeyer. Rechtsanwalt

EEG Novelle 2014. Harald Wedemeyer. Rechtsanwalt Harald Wedemeyer Rechtsanwalt Harald Wedemeyer Folie 1 Einführung des NawaRo - Bonus: Begründung zum EEG 2004 4. Bessere Bedingungen für die energetische Nutzung von Biomasse und ( ) Für die Erzeugung

Mehr

Das EEG 2012 - wesentliche Änderungen für den Bereich Biomasse

Das EEG 2012 - wesentliche Änderungen für den Bereich Biomasse 18. Thüringer Bioenergietag Jena, 28.02.2012 Das EEG 2012 - wesentliche Änderungen für den Bereich Biomasse Dr. Bernhard Dreher Bundesministerium für Umwelt, Naturschutz und Reaktorsicherheit Ziele für

Mehr

Merkblatt Nachhaltige Biomasseherstellung. Anlagenbetreiber und Netzbetreiber 3/7

Merkblatt Nachhaltige Biomasseherstellung. Anlagenbetreiber und Netzbetreiber 3/7 Merkblatt Nachhaltige Biomasseherstellung Anlagenbetreiber und Netzbetreiber 3/7 2 Merkblatt - Anlagen- und Netzbetreiber Mit dem Inkrafttreten der Biomassestrom-Nachhaltigkeitsverordnung (BioSt-NachV)

Mehr

Biomethan als Kraftstoff: Nachweisführung gemäß der Biokraft-NachV. Berlin, 02.12.2010

Biomethan als Kraftstoff: Nachweisführung gemäß der Biokraft-NachV. Berlin, 02.12.2010 Biomethan als Kraftstoff: Nachweisführung gemäß der Biokraft-NachV Berlin, 02.12.2010 Rechtsanwalt Dr. Martin Altrock, Mag.rer.publ. w w w. b b h o n l i n e. d e Gegründet 1970 Über uns Büros in Berlin,

Mehr

Hinweise zur Registrierungspflicht gemäß 6 Anlagenregisterverordnung (AnlRegV) Im März 2015. Guten Tag,

Hinweise zur Registrierungspflicht gemäß 6 Anlagenregisterverordnung (AnlRegV) Im März 2015. Guten Tag, EWE NETZ GmbH Postfach 25 01 26015 Oldenburg Sie erreichen uns: * EWE NETZ GmbH Cloppenburger Straße 302 26133 Oldenburg ' Tel. 0800-393 6389 Fax 0441-4808 1195 @ info@ewe-netz.de www.ewe-netz.de Kundennummer:

Mehr

Gesetz zur Neuregelung des Rechtsrahmens für die Förderung der Stromerzeugung aus erneuerbaren Energien

Gesetz zur Neuregelung des Rechtsrahmens für die Förderung der Stromerzeugung aus erneuerbaren Energien 1634 Bundesgesetzblatt Jahrgang 2011 Teil I Nr. 42, ausgegeben zu Bonn am 4. August 2011 Gesetz zur Neuregelung des Rechtsrahmens für die Förderung der Stromerzeugung aus erneuerbaren Energien Vom 28.

Mehr

Rechtlicher Rahmen der Biogaseinspeisung und -nutzung

Rechtlicher Rahmen der Biogaseinspeisung und -nutzung Rechtlicher Rahmen der Biogaseinspeisung und -nutzung Biomethan Perspektiven nach der EEG-Novelle 2014 Fachforum der Biogaspartnerschaft der dena Energy Decentral am 12. November 2014 in Hannover Rechtsanwalt

Mehr

Biogas in Deutschland und die wichtigsten Neuregelungen im EEG

Biogas in Deutschland und die wichtigsten Neuregelungen im EEG Biogas in Niedersachsen Auswirkungen des neuen EEG Hannover, 11.11.2008 Biogas in Deutschland und die wichtigsten Neuregelungen im EEG P. Weiland Johann Heinrich von Thünen-Institut (vti) Bundesforschungsinstitut

Mehr

Biogasanlagen in Rheinland-Pfalz 2007

Biogasanlagen in Rheinland-Pfalz 2007 Biogasanlagen in Rheinland-Pfalz 2007 Ergebnisse einer Umfrage Inhalt - Biogas in Deutschland - Biogaserhebung 2007 in Rheinland-Pfalz - Aussichten Stand der Biogaserzeugung in Deutschland Verteilung der

Mehr

TÜV SÜD Standard: Produkt GreenMethane GM. TÜV SÜD Industrie Service GmbH - Carbon Management Service - Westendstraße München

TÜV SÜD Standard: Produkt GreenMethane GM. TÜV SÜD Industrie Service GmbH - Carbon Management Service - Westendstraße München TÜV SÜD Standard: Produkt GreenMethane GM TÜV SÜD Industrie Service GmbH - Carbon Management Service - Westendstraße 199 80686 München Zertifizierung von GreenMethane Endkundenprodukten Inhalt Zertifizierung

Mehr

Leitfaden zum Inhalt von Gutachten für Biomasseanlagen gemäß EEG 2009 der Mitteldeutschen Netzgesellschaft Strom mbh

Leitfaden zum Inhalt von Gutachten für Biomasseanlagen gemäß EEG 2009 der Mitteldeutschen Netzgesellschaft Strom mbh Leitfaden zum Inhalt von Gutachten für Biomasseanlagen gemäß EEG 2009 der Mitteldeutschen Netzgesellschaft Strom mbh Mindestanforderungen an den Nachweis der Anspruchsvoraussetzung für den Erhalt von Biomasse-Boni

Mehr

Zwischenspeicherung von Strom aus erneuerbaren Energien: Praxisbeispiel e-gas von Audi und EWE

Zwischenspeicherung von Strom aus erneuerbaren Energien: Praxisbeispiel e-gas von Audi und EWE Zwischenspeicherung von Strom aus erneuerbaren Energien: Praxisbeispiel e-gas von Audi und EWE Das Unternehmen EWE: Ganzheitliche Lösungen in drei Schlüsselbranchen EWE bündelt mit Energie, Telekommunikation

Mehr

Merkblatt Nachhaltige Biomasse. Allgemeine Informationen

Merkblatt Nachhaltige Biomasse. Allgemeine Informationen Merkblatt Nachhaltige Biomasse Allgemeine Informationen 2 Merkblatt - Allgemeine informationen Warum wurden die Regelungen zur nachhaltigen Biomasseherstellung eingeführt? Es ist Ziel der Europäischen

Mehr

Clearingstelle EEG 18. Fachgespräch Das EEG 2014

Clearingstelle EEG 18. Fachgespräch Das EEG 2014 Das EEG 2014 Klärungsbedarf aus Sicht der Netzbetreiber Assessor jur. Christoph Weißenborn / BDEW Berlin, 23. September 2014 www.bdew.de Eintritt in die verpflichtende Direktvermarktung Verpflichtende

Mehr

Fachkonferenz: Optimierung der dezentralen Energieversorgung Märkte und Perspektiven für den Handel mit Biomethan

Fachkonferenz: Optimierung der dezentralen Energieversorgung Märkte und Perspektiven für den Handel mit Biomethan Fachkonferenz: Optimierung der dezentralen Energieversorgung Märkte und Perspektiven für den Handel mit Biomethan Berlin, 27. November 2013 Agenda 1. Vom Biogas zum Biomethan Marktvolumen und -entwicklung

Mehr

Biogasanlagen Was geht noch? Auswirkungen des Regierungsentwurfes vom 10.04.2014 zur Novellierung des EEG 2014 auf Biogasanlagen

Biogasanlagen Was geht noch? Auswirkungen des Regierungsentwurfes vom 10.04.2014 zur Novellierung des EEG 2014 auf Biogasanlagen Biogasanlagen Was geht noch? Auswirkungen des Regierungsentwurfes vom 10.04.2014 zur Novellierung des EEG 2014 auf Biogasanlagen Vortrag Haus Düsse am 10.04.2014 Rechtsanwalt Philipp Wernsmann Weberstraße

Mehr

Wettbewerb der Speichertechnologien - Rechtsvergleichung der regulatorischen Rahmenbedingungen der Flexibilitätsoptionen PSW, PtH und PtG -

Wettbewerb der Speichertechnologien - Rechtsvergleichung der regulatorischen Rahmenbedingungen der Flexibilitätsoptionen PSW, PtH und PtG - Forschungsstelle Umweltenergierecht Wettbewerb der Speichertechnologien - Rechtsvergleichung der regulatorischen Rahmenbedingungen der Flexibilitätsoptionen PSW, PtH und PtG - 3. Pumpspeicher-Tagung des

Mehr

Informationen zur Registrierungspflicht für Bestandsanlagen gemäß 16 Abs. 3 Satz 1 AnlRegV

Informationen zur Registrierungspflicht für Bestandsanlagen gemäß 16 Abs. 3 Satz 1 AnlRegV Informationen zur Registrierungspflicht für Bestandsanlagen gemäß 16 Abs. 3 Satz 1 AnlRegV Information über Registrierungspflicht für Bestandsanlagen gemäß 16 Abs. 3 Satz 1 AnlRegV - Betreiber von vor

Mehr

- vom BMU erstellte unverbindliche Textfassung -

- vom BMU erstellte unverbindliche Textfassung - Verordnung über die Erzeugung von Strom aus Biomasse (Biomasseverordnung BiomasseV) vom 21. Juni 2001 (BGBl. I Nr. 29 vom 27. Juni 2001 Seite 1234) in ihrer durch die 1. Verordnung zur Änderung der Biomasseverordnung

Mehr

Zertifizierung des Handels Erneuerbarer Energie

Zertifizierung des Handels Erneuerbarer Energie TÜV SÜD Standard Zertifizierung des Handels Erneuerbarer Energie (kurz: Handel EE) Version 08/2012 TÜV SÜD Industrie Service GmbH Carbon Management Service Westendstraße 199 80686 München Zertifizierung

Mehr

Grünes Gas Deutschland Europa

Grünes Gas Deutschland Europa Grünes Gas Deutschland Europa Harm Grobrügge European Biogas Association EBA What is EBA? Non-profit organisation founded in 2009 Sustainable biogas production and use in Europe Well-established network

Mehr

Biogasanlagen: Bonusregelungen des EEG 2009

Biogasanlagen: Bonusregelungen des EEG 2009 Biogasanlagen: Bonusregelungen des EEG 2009 Norbert Kraus Erfahrungsaustausch Biogasanlagen, Nürnberg, 02.12.2010 Bonusregelungen des EEG 2009 für Biogasanlagen / Norbert Kraus / Erfahrungsaustausch Biogasanlagen

Mehr

Biogasregister-Workshop

Biogasregister-Workshop Biogasregister-Workshop Biomethannachweise richtig nutzen EEG 2014 Stand und Ausblick 1 Kurzprofil BBH Becker Büttner Held gibt es seit 1991. Bei uns arbeiten Rechtsanwälte, Wirtschaftsprüfer und Steuerberater

Mehr

Anlage 1 zum Bericht nach 52 Abs. 1 Nr. 2 EEG

Anlage 1 zum Bericht nach 52 Abs. 1 Nr. 2 EEG Anlage 1 zum Bericht 52 Abs. 1 Nr. 2 EEG 16 EEG vergütete Vergütung Wasserkraft 0 0,00 Deponiegas 0 0,00 Klärgas 0 0,00 Grubengas 0 0,00 Biomasse 1.767.189 369.774,07 Geothermie 0 0,00 Windenergie Onshore

Mehr

Urteil des OLG Oldenburg:

Urteil des OLG Oldenburg: Urteil des OLG Oldenburg: Grundsätzliches zu den Begriffen der Anlage und Inbetriebnahme bei Biogasanlagen Paluka Sobola & Partner Neupfarrplatz 10 93047 Regensburg Tel. 0941 58 57 1-0 Fax 0941 58 57 1-14

Mehr

9. Fachgespräch der Clearingstelle EEG DAS EEG 2012

9. Fachgespräch der Clearingstelle EEG DAS EEG 2012 9. Fachgespräch der Clearingstelle EEG DAS EEG 2012 Berlin-Dahlem Änderungen bei der Biomasse Strom in Kraft-Wärme-Kopplung Einsatzstoffbezogene Vergütung Christian Leuchtweis C.A.R.M.E.N. e.v. STROM IN

Mehr

Auslegungshilfe zur Massenbilanzierung nach 27c Absatz 1 Nummer 2 EEG 2012

Auslegungshilfe zur Massenbilanzierung nach 27c Absatz 1 Nummer 2 EEG 2012 Auslegungshilfe zur Massenbilanzierung nach 27c Absatz 1 Nummer 2 EEG 2012 Zugleich: Anwendungshinweis zum Vollzug des EEWärmeG hier: Massenbilanzierung von Biomethan (Hinweis Nr. 1/2012) 1 Inhaltsübersicht

Mehr

Strom- und Gasnetze: Zwei ungleiche Partner auf gemeinsamem Weg?

Strom- und Gasnetze: Zwei ungleiche Partner auf gemeinsamem Weg? www.bundesnetzagentur.de Strom- und Gasnetze: Zwei ungleiche Partner auf gemeinsamem Weg? dena Konferenz der Strategieplattform Power to Gas Peter Franke Vizepräsident der Bundesnetzagentur Berlin, 13.06.2012

Mehr

Merkblatt Nachhaltige Biomasseherstellung. Allgemeine Informationen

Merkblatt Nachhaltige Biomasseherstellung. Allgemeine Informationen Merkblatt Nachhaltige Biomasseherstellung Allgemeine Informationen 2 Merkblatt - Allgemeine informationen Warum wurden die Regelungen zur nachhaltigen Biomasseherstellung eingeführt? Es ist Ziel der Europäischen

Mehr

Nachwachsende Rohstoffe

Nachwachsende Rohstoffe Nachwachsende Rohstoffe Megatrend oder Zeitgeist? W. Diepenbrock Martin Luther Universität Halle Wittenberg Nachwachsende Rohstoffe (NaWaRo, NawaRo, Nawaro, NR, NWR) sind organische Rohstoffe, die aus

Mehr

Taschenkarte für den Feuerwehreinsatz

Taschenkarte für den Feuerwehreinsatz Taschenkarte für den Feuerwehreinsatz Biogas-Anlagen Bei Brandereignissen oder bei sonstigen technischen Hilfeleistungen in Biogas-Anlagen sind nachfolgende Grundsätze zu beachten: Beachtung der Windrichtung

Mehr

Häufig gestellte Fragen (FAQ) zum EEG 2012

Häufig gestellte Fragen (FAQ) zum EEG 2012 Häufig gestellte Fragen (FAQ) zum EEG 2012 Nr. V 15/2012 Zusammengestellt von der Arbeitsgruppe V (Betriebs- und volkswirtschaftliche Bewertung) im Biogas Forum Bayern von: Dr. Stefan Rauh Georg Friedl

Mehr

2a. Wasserkraft bis 5 MW (Neuanlagen, 40 Abs. 1) Netto-Vergütung

2a. Wasserkraft bis 5 MW (Neuanlagen, 40 Abs. 1) Netto-Vergütung Einspeisevergütung für im Kalenderjahr 2015 neu in Betrieb genommene Eigenerzeugungsanlagen nach dem Erneuerbare-Energien-Gesetz EEG vom 21.07.2014 (EEG 2014) Grundlage: Zum 1. August 2014 ist das novellierte

Mehr

Das EEG 2012 neue Chancen und neue Verpflichtungen

Das EEG 2012 neue Chancen und neue Verpflichtungen Das EEG 2012 neue Chancen und neue Verpflichtungen Konrad Raab Ministerium für Umwelt, Klima und Energiewirtschaft Baden-Württemberg Referat Erneuerbare Energien Ziele der EEG-Novellierung Ausbau der Stromerzeugung

Mehr

- Grundvergütung Biomasse -

- Grundvergütung Biomasse - Verbindliche Erklärung zur Ermittlung der Förderfähigkeit und der maßgeblichen Vergütungshöhe für Strom aus Biomasse-Anlagen nach dem Gesetz für den Ausbau erneuerbarer Energien (Erneuerbare-Energien-Gesetz

Mehr

Kriterien der EU für die umweltorientierte öffentliche Beschaffung von Strom

Kriterien der EU für die umweltorientierte öffentliche Beschaffung von Strom Kriterien der EU für die umweltorientierte öffentliche Beschaffung von Strom Die umweltorientierte öffentliche Beschaffung (Green Public Procurement, GPP) ist ein freiwilliges Instrument. Im vorliegenden

Mehr

Die Biogasanlage. GFS von Franziska Marx

Die Biogasanlage. GFS von Franziska Marx Die Biogasanlage GFS von Franziska Marx Inhalt Geschichte Die Biomasse Das Biogas Funktion der Biogasanlage Der Gärprozess Die Aufbereitung Biogasanlagen in der Umgebung Wirtschaftlichkeit Bedeutung der

Mehr

Zusammenfassung. Machbarkeitsstudie zur Gewinnung von Methan aus erneuerbaren Energien. Kooperationspartner

Zusammenfassung. Machbarkeitsstudie zur Gewinnung von Methan aus erneuerbaren Energien. Kooperationspartner Zusammenfassung Windgas-Projekt in Nordfriesland Nord Machbarkeitsstudie zur Gewinnung von Methan aus erneuerbaren Energien Kooperationspartner Auftraggeber LAG AktivRegion Nordfriesland Nord e.v. Marktstraße

Mehr

desdeutschenbruttoendenergieverbrauchsauserneuerbarenenergienbereitgestelltwerden.zudiesemzweckverpflichtetdierichtliniedeutschlandu.a.

desdeutschenbruttoendenergieverbrauchsauserneuerbarenenergienbereitgestelltwerden.zudiesemzweckverpflichtetdierichtliniedeutschlandu.a. Deutscher Bundestag Drucksache 17/3629 17. Wahlperiode 08. 11. 2010 Gesetzentwurf der Bundesregierung Entwurf eines Gesetzes zur Umsetzung der Richtlinie 2009/28/EG zur Förderung der Nutzung von Energie

Mehr

Biogas als Kraftstoff

Biogas als Kraftstoff Biogas als Kraftstoff Substitution des Erdgaskraftstoffes durch Biogas? Christian André Paris 1 Gliederung Einführung Biogas- Nutzungspfade staatliche / unternehmerische Maßnahmen Fazit 2 1 Einführung

Mehr

Bioenergiepark Harrislee

Bioenergiepark Harrislee Bioenergiepark Harrislee Errichtung einer Biogasanlage zur Erzeugung von Biomethan in Harrislee Ein Projekt der Logo tape GmbH & Co. KG, Loick Bioenergie GmbH und LandSicht GmbH Planungsstand: April 2012

Mehr

EEG Auswirkungen für die Biogasbranche. Anke Rostankowski

EEG Auswirkungen für die Biogasbranche. Anke Rostankowski EEG 2009 - Auswirkungen für die Biogasbranche Anke Rostankowski Potsdam, 23.10.2008 Gliederung Ausgangslage Ziele Status quo Entwicklung bis 2020 Stromerzeugung aus Biomasse Neufassung des EEG Überblick

Mehr

Landwirtschaftlicher Buchführungsdienst 2011/2012. Das neue EEG - Überblick

Landwirtschaftlicher Buchführungsdienst 2011/2012. Das neue EEG - Überblick LBD Unternehmerseminar 2011/2012 Das neue EEG - Überblick Inhalt 1. Zweck und Ziel des Gesetzes 2. Allgemeine Vorschriften 3. Was sind Erneuerbare Energien gem. EEG? 4. Windkraft 5. Solare Strahlungsenergie

Mehr

Übergangsbestimmungen im EEG 2014

Übergangsbestimmungen im EEG 2014 Übergangsbestimmungen im EEG 2014 Kommentierungen und Materialien Von Dr. Martin Altrock Dr. Andrea Huber Dr. Helmut Loibl René Walter Bibliografische Information der Deutschen Nationalbibliothek Die Deutsche

Mehr

Datenerfassung zum Anschluss von Biogasaufbereitungsanlagen an das Erdgasnetz der Bayernwerk AG

Datenerfassung zum Anschluss von Biogasaufbereitungsanlagen an das Erdgasnetz der Bayernwerk AG Bayernwerk AG Lilienthalstr. 7 93049 Regensburg Datenerfassung zum Anschluss von Biogasaufbereitungsanlagen an das Erdgasnetz der Bayernwerk AG 1 Angaben zum Anschlussnehmer (Betreiber) Betreiber (Vertragspartner):

Mehr

Verbindliche Erklärung zur Ermittlung der Förderfähigkeit und Förderungshöhe von Photovoltaikanlagen nach dem EEG 2014 (Inbetriebnahme ab 01.08.

Verbindliche Erklärung zur Ermittlung der Förderfähigkeit und Förderungshöhe von Photovoltaikanlagen nach dem EEG 2014 (Inbetriebnahme ab 01.08. Registrier-/ Kundennummer: 1. Anlagenbetreiber/in Vorname, Name bzw. Firmenname Telefon Fax 2. Anlagenanschrift (falls abweichend von 1.) Gemarkung, Flurstück 3. Technische Angaben 3.1 Ausführender Elektrofachbetrieb

Mehr

EEG-Vergütung, Netzzugang und Genehmigungsfragen

EEG-Vergütung, Netzzugang und Genehmigungsfragen EEG-Vergütung, Netzzugang und Genehmigungsfragen Vortrag im Rahmen des 4. Biogas-Fachkongress am 24.11.2009 in Hitzacker Referent: Dr. Helmut Loibl, Rechtsanwalt und Fachanwalt für Verwaltungsrecht Referent:

Mehr

Bundesanstalt für Landwirtschaft und Ernährung, 53168 Bonn Deichmanns Aue 29, 53179 Bonn

Bundesanstalt für Landwirtschaft und Ernährung, 53168 Bonn Deichmanns Aue 29, 53179 Bonn Bundesanstalt für Landwirtschaft und Ernährung, 53168 Bonn HAUSANSCHRIFT Deichmanns Aue 29, 53179 Bonn UST.-ID.-NR. DE 114 110 249 BEARBEITET VON Anke Reich TEL +49 (0)2 28 99 68 45-2550 FAX +49 (0)2 28

Mehr

Biogasanlage Eggertshofen bei Pulling

Biogasanlage Eggertshofen bei Pulling Biogasanlage Eggertshofen bei Pulling Im Prinzip werden in einer Biogasanlage die Vorgänge im Kuhmagen nachgeahmt. Auch die Temperaturen sind fast gleich. Je besser die Nahrung ist, umso mehr Milch gibt

Mehr

Einspeisevergütungen nach Teil 3 EEG

Einspeisevergütungen nach Teil 3 EEG Einspeisevergütungen Teil 3 EEG Die folgende Tabelle gibt die von der Stadtwerke Homburg GmbH, 8 EEG abgenommenen und 16 EEG vergüteten n sowie die für diese n Maßgabe der 16 33 i.v.m. 66 EEG gezahlten

Mehr

Inhaltsverzeichnis. http://d-nb.info/1027695248

Inhaltsverzeichnis. http://d-nb.info/1027695248 Inhaltsverzeichnis A. Einführung 11 B. Überblick über Erneuerbare Energien in der Landwirtschaft 12 I. Bioenergie 12 1. Biogas 12 2. Kraftstoffproduktion 13 3. Thermische Nutzung von flüssiger und fester

Mehr

EEG Neue Vergütungsregelungen u. Voraussetzungen für Biomasseanlagen. GUTcert Bereich Emissionshandel und Energiedienstleistungen

EEG Neue Vergütungsregelungen u. Voraussetzungen für Biomasseanlagen. GUTcert Bereich Emissionshandel und Energiedienstleistungen EEG 2009 Neue Vergütungsregelungen u. Voraussetzungen für Biomasseanlagen GUTcert Bereich Emissionshandel und Energiedienstleistungen Das Erneuerbare-Energien-Gesetz 2009 Der Weg zum EEG 2009: Monitoringbericht

Mehr

Erfassung von Anlagendaten im Marktstammdatenregister

Erfassung von Anlagendaten im Marktstammdatenregister Erfassung von Anlagendaten im Marktstammdatenregister Das Marktstammdatenregister (MaStR) wird die Stammdaten der Energieerzeugungs- und Verbrauchsanlagen im Strom- und Gasbereich erfassen und für den

Mehr

Erzeugung von BioErdgas und ökonomische

Erzeugung von BioErdgas und ökonomische Erzeugung von BioErdgas und ökonomische Rahmenbedingungen für den Einsatz im BHKW BioErdgas in kommunalen Liegenschaften Eine Veranstaltung des Hessischen Ministeriums für Umwelt, Energie, Landwirtschaft

Mehr

Energie aus nachwachsenden Rohstoffen: Biogas und Bio-Erdgas

Energie aus nachwachsenden Rohstoffen: Biogas und Bio-Erdgas Energie aus nachwachsenden Rohstoffen: Biogas und Bio-Erdgas Zu Bio-Erdgas aufbereitetes Biogas ist ein erneuerbarer Energieträger, der in die bestehende Erdgas-Infrastruktur eingespeist, dort gespeichert

Mehr

Kundennummer: Bitte vollständig ausfüllen!

Kundennummer: Bitte vollständig ausfüllen! Erklärung zur Ermittlung der Förderfähigkeit und Vergütungseinstufung von Photovoltaikanlagen kleiner 7,69 kwp nach dem EEG 2014 (Inbetriebnahme ab 01.08.2014) Kundennummer: Bitte vollständig ausfüllen!

Mehr

BUNDESGESETZBLATT FÜR DIE REPUBLIK ÖSTERREICH. Jahrgang 2015 Ausgegeben am 23. Dezember 2015 Teil II

BUNDESGESETZBLATT FÜR DIE REPUBLIK ÖSTERREICH. Jahrgang 2015 Ausgegeben am 23. Dezember 2015 Teil II 1 von 6 BUNDESGESETZBLATT FÜR DIE REPUBLIK ÖSTERREICH Jahrgang 2015 Ausgegeben am 23. Dezember 2015 Teil II 459. Verordnung: Ökostrom-Einspeisetarifverordnung 2016 ÖSET-VO 2016 459. Verordnung des Bundesministers

Mehr

LNG-Gewinnung aus Biogas

LNG-Gewinnung aus Biogas LNG-Gewinnung aus Biogas Nutzbarmachung dezentraler Biogasquellen als Energiespeicher und als Alternative zur Verstromung vor Ort 1 Agenda Ziele der Biogasaufbereitung und umwandlung zu LNG Funktionsweise

Mehr

Hinweise zum Vollzug der Genehmigung von Biogasanlagen unter den Bedingungen des neuen Kreislaufwirtschaftsgesetzes und der novellierten 4.

Hinweise zum Vollzug der Genehmigung von Biogasanlagen unter den Bedingungen des neuen Kreislaufwirtschaftsgesetzes und der novellierten 4. Biogas Fachtagung Thüringen 2 / 2012 Hinweise zum Vollzug der Genehmigung von Biogasanlagen unter den Bedingungen des neuen Kreislaufwirtschaftsgesetzes und der novellierten 4. BImSchV Maren Kühn / Referat

Mehr

Photovoltaik in der Praxis Das neue EEG 2014. 7. Jahrestagung Kommunaler Energie-Dialog Sachsen. Anja Assion

Photovoltaik in der Praxis Das neue EEG 2014. 7. Jahrestagung Kommunaler Energie-Dialog Sachsen. Anja Assion WWW.GOETZE.NET Photovoltaik in der Praxis Das neue EEG 2014 7. Jahrestagung Kommunaler Energie-Dialog Sachsen Anja Assion Rechtsanwältin, Petersstraße 15, 04109 Leipzig AGENDA 1. Gesetzgebungsprozess 2.

Mehr

Verantwortung der gesetzlichen Vertreter

Verantwortung der gesetzlichen Vertreter Prüfungsvermerk des unabhängigen Wirtschaftsprüfers über die Prüfung nach 75 Satz 1 EEG 2014 der zusammengefassten Endabrechnung 2014 eines Netzbetreibers zur Erfüllung seiner Pflichten nach 72 Abs. 1

Mehr

Einführung. Grundsatz der EEG-Umlagepflicht. auch für Eigenversorgung. Grundsatz der EEG-Umlagepflicht. Newsletter-Abo

Einführung. Grundsatz der EEG-Umlagepflicht. auch für Eigenversorgung. Grundsatz der EEG-Umlagepflicht. Newsletter-Abo NEWSLETTER ERNEUERBARE ENERGIEN AUGUST 2014 Eigenstromnutzung aus EEG-Anlage nach 1.8.2014 Was müssen Bestandsanlagen nach dem neuen EEG 2014 beachten Einführung Seit 1. August 2014 gilt das EEG 2014 nicht

Mehr

Windenergie & Solarthermie in Ägypten. Perspektiven der Erneuerbaren Energien In Ägypten - Fact Sheet

Windenergie & Solarthermie in Ägypten. Perspektiven der Erneuerbaren Energien In Ägypten - Fact Sheet Windenergie & Solarthermie in Ägypten Perspektiven der Erneuerbaren Energien In Ägypten - Fact Sheet Perspektiven der Erneuerbaren Energien in Ägypten Fact Sheet Jahr I. Ägypten s BIP Entwicklung ( * Prognose

Mehr

Biomethan als Kraftstoff Zukunft für Biomethan?! EnergyDecentral Hannover 12. November 2014

Biomethan als Kraftstoff Zukunft für Biomethan?! EnergyDecentral Hannover 12. November 2014 Zukunft für Biomethan?! EnergyDecentral Hannover 12. November 2014 Inhalt RG Energy GmbH Biomethan im Kraftstoffmarkt Treibhausgas (THG-) bezogene Quote (ab 2015) Zukünftige Entwicklungen 3 6 11 17 RG

Mehr

Rechtliche Rahmenbedingungen für Umweltgutachter im EEG 2009

Rechtliche Rahmenbedingungen für Umweltgutachter im EEG 2009 Rechtliche Rahmenbedingungen für Umweltgutachter im EEG 2009 KWK-Bonus Güllebonus / Landschaftspflegebonus Rein pflanzliche Nebenprodukte Luftreinhaltebonus Referent: RA Micha Schulte-Middelich Definition

Mehr

3. Solarteurforum der Sparkasse Heidelberg Neuerungen / Hinweise 2013 für Einspeiseanlagen 4. Juli 2013

3. Solarteurforum der Sparkasse Heidelberg Neuerungen / Hinweise 2013 für Einspeiseanlagen 4. Juli 2013 3. Solarteurforum der Sparkasse Heidelberg Neuerungen / Hinweise 2013 für Einspeiseanlagen 4. Juli 2013 Neuerungen 2013 für Einspeiseanlagen BDEE Klaus Radßuweit Version / Übersicht Meldung an die Bundesnetzagentur

Mehr

Bericht nach 77 Abs. 1 Nr. 2 EEG des Netzbetreibers EEG-Einspeisungen im Jahr 2014

Bericht nach 77 Abs. 1 Nr. 2 EEG des Netzbetreibers EEG-Einspeisungen im Jahr 2014 Bericht nach 77 Abs. 1 Nr. 2 EEG des Netzbetreibers EEG-Einspeisungen im Jahr 2014 Netzbetreiber (VNB): Betriebsnummer bei der Bundesnetzagentur: 10001099 Vorgelagerter Übertragungsnetzbetreiber (ÜNB):

Mehr

Foto: privat. Biogasanlage

Foto: privat. Biogasanlage Foto: privat Biogasanlage Was ist eine Biogasanlage? eine umweltschonende Energiegewinnungsanlage zur Erzeugung von Biogas Funk5onsbereiche 1. Rohstoffe 2. Biogasreaktor 3. Biogasentstehung 4. Umwandlung

Mehr

Biokraftstoffe verstehen Ein Überblick über einen Begriffsdschungel

Biokraftstoffe verstehen Ein Überblick über einen Begriffsdschungel Biokraftstoffforschung Deutschland, Österreich, Schweiz Biokraftstoffe verstehen Ein Überblick über einen Begriffsdschungel Georg, ForNeBiK 6. Rostocker Bioenergieforum 14. - 15. Juni 2012 A 12 N Ko 001

Mehr

Energie Versorgung Margarethen. Biogasanlage Margarethen am Moos. Ein neuer Weg

Energie Versorgung Margarethen. Biogasanlage Margarethen am Moos. Ein neuer Weg Energie Versorgung Margarethen Biogasanlage Margarethen am Moos. Ein neuer Weg Die Biogasanlage: Die Anlage ist seit 2006 in Betrieb, erzeugt mit dem BHKW 625 kwh Strom und versorgt den Standort selbst

Mehr

Rechtliche Probleme bei der Auslegung und Umsetzung des Direktvermarktungsmodells. Dr. Steffen Herz

Rechtliche Probleme bei der Auslegung und Umsetzung des Direktvermarktungsmodells. Dr. Steffen Herz Rechtliche Probleme bei der Auslegung und Umsetzung des Direktvermarktungsmodells Workshop zum EEG 2014 Institut für Energie- und Regulierungsrecht Berlin 10. Dezember 2014 Dr. Steffen Herz Über uns Erneuerbare

Mehr

Das Verbraucherportal Verivox legt eine strengere Definition zu Grunde und rät dazu, bei der Wahl eines Ökostrom-Tarifs auf zwei Dinge zu achten:

Das Verbraucherportal Verivox legt eine strengere Definition zu Grunde und rät dazu, bei der Wahl eines Ökostrom-Tarifs auf zwei Dinge zu achten: Was ist Ökostrom? Laut dem Bundesverband Erneuerbare Energien (BEE) gibt es keine einheitliche Definition für Ökostrom. Der BEE spricht von Ökostrom, wenn mindestens 50 Prozent des erzeugten Stromaufkommens

Mehr

Zukünftige Möglichkeiten der Betriebsführung und Systemintegration für Erneuerbare Energien (EE)

Zukünftige Möglichkeiten der Betriebsführung und Systemintegration für Erneuerbare Energien (EE) Zukünftige Möglichkeiten der Betriebsführung und Systemintegration für Erneuerbare Energien (EE) Innovationstag Energie - BTU Cottbus 30./31.05.2007 Dr. Georg Gjardy 1 Inhalt - Derzeitige Situation - Ein

Mehr

Gesetz zur Förderung Erneuerbarer Energien im Wärmebereich (Erneuerbare-Energien-Wärmegesetz EEWärmeG)*)

Gesetz zur Förderung Erneuerbarer Energien im Wärmebereich (Erneuerbare-Energien-Wärmegesetz EEWärmeG)*) Gesetz zur Förderung Erneuerbarer Energien im Wärmebereich (Erneuerbare-Energien-Wärmegesetz EEWärmeG)*) Der Bundestag hat das folgende Gesetz beschlossen: Inhaltsübersicht Teil 1 Allgemeine Bestimmungen

Mehr

Wind to Gas Speicherlösung Elektrolyse, Wasserstoff, Methan

Wind to Gas Speicherlösung Elektrolyse, Wasserstoff, Methan Wind to Gas Speicherlösung Elektrolyse, Wasserstoff, Methan Birgit Scheppat H2BZ-Initiative/Hochschule RheinMain November 2012 Wind to Gas Speicherlösung Elektrolyse, Wasserstoff, Methan. Wer ist die H2BZ?

Mehr

post EEG? Zukunftschancen für Bioenergiedörfern Bio-LNG (verflüssigtes Biogas) ist eine Alternative!

post EEG? Zukunftschancen für Bioenergiedörfern Bio-LNG (verflüssigtes Biogas) ist eine Alternative! post EEG? Zukunftschancen für Bioenergiedörfern Bio-LNG (verflüssigtes Biogas) ist eine Alternative! Oliver Auras, Leiter Projektentwicklung, Erdgas Südwest GmbH Emmingen-Liptingen, 7. November 2014 Agenda

Mehr

EEG Eigenstromprivileg für die Energieerzeugung aus Abfällen. Dr. Gernot-Rüdiger Engel Kassel, 30. April 2015

EEG Eigenstromprivileg für die Energieerzeugung aus Abfällen. Dr. Gernot-Rüdiger Engel Kassel, 30. April 2015 EEG Eigenstromprivileg für die Energieerzeugung aus Abfällen Dr. Gernot-Rüdiger Engel Kassel, 30. April 2015 1 Wer Kartoffeln aus dem eigenen Garten isst, muss dafür auch keine Mehrwertsteuer zahlen. Peter

Mehr

Ausbau Erneuerbarer Energien: Aktueller Stand und Szenarien in Deutschland

Ausbau Erneuerbarer Energien: Aktueller Stand und Szenarien in Deutschland Ausbau Erneuerbarer Energien: Aktueller Stand und Szenarien in Deutschland Dialogforum: Erneuerbare Energien wohin geht die Reise? ICC Berlin, 26. Januar 211 Dr. Frank Musiol - 1 - Datengrundlagen: unabhängiges

Mehr

Perspek'ven*der*Biomethanerzeugung* und*6nutzung*nach*der*eeg6novelle*

Perspek'ven*der*Biomethanerzeugung* und*6nutzung*nach*der*eeg6novelle* Perspek'ven*der*Biomethanerzeugung* und*6nutzung*nach*der*eeg6novelle* Johan*Grope*(Ins1tut.für.Biogas,.Kreislaufwirtscha;.und.Energie,.Weimar). 7.1.2013. www.biogasundenergie.de. Ort. Ins1tut.für.Biogas,.Kreislaufwirtscha;.und.

Mehr

Rechtliche Aspekte des Einsatzes von Prozesshilfsstoffen bei der Biogaserzeugung

Rechtliche Aspekte des Einsatzes von Prozesshilfsstoffen bei der Biogaserzeugung Rechtliche Aspekte des Einsatzes von Prozesshilfsstoffen bei der Biogaserzeugung Vortrag Ralf M. Vorstand Forum Contracting e.v. Justiziar der Ingenieurkammer Sachsen-Anhalt 1 Vortragsübersicht Kanzleiprofil

Mehr

Energetische Biomassenutzung in Deutschland

Energetische Biomassenutzung in Deutschland Energetische Biomassenutzung in Deutschland Dr.-Ing. Janet Witt Fachgespräch Feste Biomasse im Rahmen der ENERTEC, Leipzig, 31.01.2013 Einleitung Bioenergie: Das Multitalent V i e l f ä l t i g e R o h

Mehr

. BiomasseVerordnung 21.06.2001 Seite 1 von 8

. BiomasseVerordnung 21.06.2001 Seite 1 von 8 Verordnung über die Erzeugung von Strom aus Biomasse (Biomasseverordnung - BiomasseV) Vom 21 Juni 2001 Auf Grund des 2 Abs 1 Satz 2 des Erneuerbare-Energien-Gesetzes vom 29 März 2000 (BGBI I S 305) in

Mehr

Der Rechtsrahmen für die energetische Nutzung von Klärgas

Der Rechtsrahmen für die energetische Nutzung von Klärgas Der Rechtsrahmen für die energetische Nutzung von Klärgas Christian Buchmüller und Jörn Schnutenhaus 1. Einführung...71 2. Förderung nach dem KWKG...71 2.1. Förderung der Stromerzeugung...72 2.1.1. Anspruchsvoraussetzungen...72

Mehr

Die Flexibilitätsprämie

Die Flexibilitätsprämie Die Flexibilitätsprämie 9. Fachgespräch der Clearingstelle EEG 9. September 2011 in Berlin Dipl. Ing (FH) Uwe Holzhammer Verantwortlich für steuerbare und bedarfsorientierte Stromproduktion aus Biomasse

Mehr

Umdenken. Clevere Lösungen für die Energiezukunft Nachhaltigkeitsdialog, Wiesbaden 4. Februar 2014. Dipl.-Ing. Christian Synwoldt

Umdenken. Clevere Lösungen für die Energiezukunft Nachhaltigkeitsdialog, Wiesbaden 4. Februar 2014. Dipl.-Ing. Christian Synwoldt Umdenken Clevere Lösungen für die Energiezukunft Nachhaltigkeitsdialog, Wiesbaden 4. Februar 2014 Dipl.-Ing. Christian Synwoldt Umdenken Themen Die Rolle der Erneuerbaren Energien bei der Strompreisentwicklung

Mehr

EEG-Synopse EEG 2012 a. F. ( ) - EEG 2012 n. F. ( ) 2

EEG-Synopse EEG 2012 a. F. ( ) - EEG 2012 n. F. ( ) 2 EEG-Synopse 1 2012 EEG 2012 a. F. (01.01.2012) - EEG 2012 n. F. (01.04.2012) 2 EEG 2012 a. F. (01.01.2012) EEG 2012 n. F. (01.04.2012 ) 3 3 Begriffsbestimmungen Begriffsbestimmungen Im Sinne dieses Gesetzes

Mehr

Die Aufgaben der Umweltgutachterinnen und Umweltgutachter nach EEG 2012

Die Aufgaben der Umweltgutachterinnen und Umweltgutachter nach EEG 2012 Die Aufgaben der Umweltgutachterinnen und Umweltgutachter nach EEG 2012 Vortrag von Dr. Markus Racke DAU-Deutsche Akkreditierungs- und Zulassungsgesellschaft für Umweltgutachter mbh anlässlich des 17.

Mehr

Die Rolle von Biomethan bei der Energiewende in Bayern

Die Rolle von Biomethan bei der Energiewende in Bayern Bayerisches Staatsministerium für Die Rolle von Biomethan bei der Energiewende in Bayern Ltd. MR Dr. Rupert Schäfer Vortrag am 03.07.2013 in München Inhalt Bayerisches Energiekonzept: Rahmenbedingung Biogas

Mehr

Genehmigungsrechtliche Aspekte des Zuckerrübeneinsatzes in der Biogasanlage

Genehmigungsrechtliche Aspekte des Zuckerrübeneinsatzes in der Biogasanlage Genehmigungsrechtliche Aspekte des Zuckerrübeneinsatzes in der Biogasanlage Harald Wedemeyer Rechtsanwalt Folie 1 RA Harald Wedemeyer Einführung Was müssen Anlagenbetreiber beim Einsatz von Rüben in Biogasanlagen

Mehr

EEG-Novelle- Auswirkungen auf die Biogasbranche

EEG-Novelle- Auswirkungen auf die Biogasbranche Biogas Fachtagung Rheinland-Pfalz 2008 Kaisersesch EEG-Novelle- Auswirkungen auf die Biogasbranche Manuel Maciejczyk stellvertretender Geschäftsführer des Gliederung 1. Stand der Biogasbranche in Deutschland

Mehr

Das Bio-Energie-Zentrum (BEZ) der infra fürth gmbh

Das Bio-Energie-Zentrum (BEZ) der infra fürth gmbh Das Bio-Energie-Zentrum (BEZ) der infra fürth gmbh Betrieb einer Biogasanlage mit Gasaufbereitung 1. Allgemeine Informationen Die infra fürth gmbh sieht sich als innovatives und umweltfreundliches Unternehmen

Mehr