GUTACHTEN. Entwicklung von Kriterien für ein bundesweites Regionalsiegel

Save this PDF as:

Größe: px
Ab Seite anzeigen:

Download "GUTACHTEN. Entwicklung von Kriterien für ein bundesweites Regionalsiegel"


1 GUTACHTEN Entwicklung von Kriterien für ein bundesweites Regionalsiegel Gutachten im Auftrag des Bundesministeriums für Ernährung, Landwirtschaft und Verbraucherschutz Bietergemeinschaft: FiBL Deutschland/MGH GUTES AUS HESSEN Kasseler Straße 1a, Frankfurt am Main FiBL Deutschland e.v. Forschungsinstitut für biologischen Landbau Kasseler Straße 1a, Frankfurt am Main Tel , Fax MGH GUTES AUS HESSEN GmbH Homburger Straße 9, Friedberg Tel , Fax Projektleitung: Axel Wirz, Tel Projektvertretung: Peter Klingmann, Tel Frankfurt am Main, den FiBL Deutschland e.v. MGH GUTES AUS HESSEN

2 Anbieter Projektpartner Unterstützer FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 2

3 Inhaltsverzeichnis 1 Aufgabenbeschreibung 7 2 Übersicht über die regionalen Vermarktungswege und deren Kennzeichnung Übersicht Regionalsiegel der Bundesländer Regionalsiegel/-marken des Lebensmitteleinzelhandels Regionalinitiativen und -marken Weitere regionale Kennzeichnungsansätze 21 3 Erarbeitung und Darstellung der Kriterien für Regionalität Regionsdefinitionen in Wissenschaft und Praxis Regionsdefinition in der Literatur Regionalität und regionale Lebensmittel Regionalbewusstsein und Heimat Regionsdefinitionen der Regionalinitiativen Regionalinitiativen Begriffsdefinitionen der Regionalinitiativen Überschneidungen und Transparenz Regionsdefinition im Hinblick auf Verbrauchererwartungen Konsummotivationen Kaufentscheidungsverhalten Verbraucherstudien zum Thema Regionalität 30 4 Inhaltliche Definition unter Beachtung der Produktionstiefe Monoprodukte Zusammengesetzte Produkte Pflanzliche Produkte Tierische Produkte Wertschöpfungskette Landwirtschaft und deren Vorstufen Produktion- und naturbedingte Faktoren 41 5 Einbindung weiterer Zusatzkriterien Bedeutung von Zusatzkriterien bei bestehenden Systemen Erwartungen der Verbraucher Auflistung verschiedener Zusatzkriterien Bio-Siegel Tierschutz Nachhaltigkeitskriterien Soziale Kriterien/Fair-Zertifizierung Beispiel: fair & regional. Bio Berlin-Brandenburg Beispiel: Naturland Fair Beispiel: Die faire Milch Ohne Gentechnik 53 6 Realisierungsmodalitäten eines freiwilligen Regionalsiegels Ausgangslage Rechtlicher Rahmen Obligatorische- und fakultative Herkunftskennzeichnung Nationale und gemeinschaftsrechtliche Schutzsysteme Gemeinschaftsrechtliches Schutzsystem 60 FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 3

4 6.2.4 Staatliche Absatzförderung Zeichenvergabe Vorbemerkung Realisierungsmodalitäten eines freiwilligen Regionalsiegels Anwendungsbereich eines Siegels Zeichenvergabe Kontrollen/Dokumentationen Verifizierung der Herkunftsaussagen 71 7 Erfassung der Wünsche der Akteure 73 8 Szenarienbildung Szenario Anpassung/Koordination Szenario Anerkennung Szenario Regionalsiegel Szenario Regionalfenster 83 9 Analyse des Potenzials eines bundesweiten Regionalsiegels Analyse des Absatzpotenzials für Regionalprodukte Absatzpotenziale nach ausgewählten Wirtschaftszweigen der Land- und Ernährungswirtschaft Absatzpotenziale in ausgewählten Bereichen der Landwirtschaft Landwirtschaftliche Direktvermarktung Ökobetriebe Ackerbaubetriebe - Getreide Futterbaubetriebe/Tierhaltung Absatzpotenziale in ausgewählten Bereichen der Ernährungsindustrie Fleischwirtschaft Mühlenwirtschaft Absatzpotenziale in ausgewählten Bereichen des Ernährungshandwerks Fleischereien Bäckereien Absatzpotenziale beim Verbraucher Expertenbefragung: Analyse des Potenzials eines bundesweiten Regionalsiegels Beurteilung der Szenarien Weitere Perspektiven Zusammenfassung Literatur Anhang 116 FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 4

5 Abbildungsverzeichnis Abbildung 1: Edeka Minden - die WEZette, Abbildung 2: REWE-Dortmund, Abbildung 3: Werbematerial von Die Regionalen 16 Abbildung 4: DLG-Medaillen 21 Abbildung 5: Herkunftszeichen: Aus deutschen Landen frisch auf den Tisch 21 Abbildung 6: Schematische Darstellung des Regionalisierungsprozesses und dessen Wirkung auf die Produktwahrnehmung 24 Abbildung 7: Gebietskulissen ausgewählter Regionalinitiativen in Süddeutschland 26 Abbildung 8: Theoretisches Konstrukt der möglichen Einflussfaktoren auf die individuelle Präferenz für regionale Lebensmittel (Henseleit et al. 2007, S. 8; nach Alvensleben 1999, 2001) 28 Abbildung 9: Bandbreite von Regionsbezügen (Rutenberg 2011) 29 Abbildung 10: Schematische Darstellung Wertschöpfungskette 39 Abbildung 11: Wertschöpfungskette in der Schweinemast 40 Abbildung 12: Schematische Darstellung der milchwirtschaftlichen Unternehmensstruktur in Deutschland (nach Wolter, Reinhard, S. 19) 41 Abbildung 13: Logo Biosiegel Rhön 45 Abbildung 14: Logo Beter Leven 46 Abbildung 15: Logo Aktion Tierwohl 47 Abbildung 16: Logo Fairtrade International 49 Abbildung 17: Logo fair & regional. Bio Berlin-Brandenburg 49 Abbildung 18: Logo Naturland Fair 51 Abbildung 19: Die faire Milch 52 Abbildung 20: Logo Ohne Gentechnik 53 Abbildung 21: Internetseiten zur Rückverfolgbarkeit von Lebensmitteln 71 Abbildung 22: Konzept Wasserzeichen 72 Abbildung 23: Positionsebenen der Regionalakteure 75 Abbildung 24: Darstellung der Umsetzungswege 78 Abbildung 25: Kontroll- und Vergabemodell einer Akkreditierung 82 Abbildung 26: Kontroll- und Vergabemodell eines Siegels 83 Abbildung 27: Kontroll- und Vergabemodell des Regionalfensters 84 FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 5

6 Tabellenverzeichnis Tabelle 1: Übersicht der befragten Schlüsselpersonen 7 Tabelle 2: Übersicht Regionalsiegel der Bundesländer 9 Tabelle 3: Übersicht EU-Kennzeichnungen für die Regionalität 11 Tabelle 4: Übersicht EU-Kennzeichnungen für die Regionalität 13 Tabelle 5: Übersicht Werbung des Lebensmitteleinzelhandels mit Regionalität 15 Tabelle 6: Anzahl der betrachteten Initiativen 18 Tabelle 7: Übersicht Vielfalt der Regionalinitiativen 19 Tabelle 8: Abgrenzung von Regionen 26 Tabelle 9: Übersicht Verbraucherstudien zum Thema Regionalität 30 Tabelle 10: Verbraucherstudien zum Thema Regionalität unter Beachtung der Produktionstiefe 33 Tabelle 11: Beispiel Getreide: Weizenbrot 35 Tabelle 12: Beispiel Obst: Erdbeerkonfitüre 36 Tabelle 13: Beispiel Milch: Erdbeerjoghurt (Fruchtjoghurt) 37 Tabelle 14: Beispiel Fleisch: Schinkenwurst 37 Tabelle 15: Überblick Verbrauchererwartungen 43 Tabelle 16: Übersicht Systemzulassungsstellen 68 Tabelle 17: Übersicht Kontrollsystem 69 Tabelle 18: Übersicht Kriterienmodelle 77 FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 6

7 1 Aufgabenbeschreibung Erstellung und Vorlage eines Ergebnisberichtes mit Schlussfolgerung zur Entwicklung von Kriterien für ein freiwilliges Regionalsiegel und der Umsetzung unter Berücksichtigung folgender Punkte: Tabellarischer Überblick über bestehende regionale Vermarktungswege und deren Kennzeichnung Darstellung von Kriterien für Regionalität (Definition von Regionalität, Produktionstiefe, Rohstoffherkunft, weitere Kriterien, Rechtsrahmen) Realisierungsmodalitäten Potenzialanalyse Der Zuschlag für die Bietergemeinschaft erfolgte am Das erste Kick-off Meeting mit dem BMELV erfolgte am in Bonn. Ein erster Zwischenbericht wurde am abgegeben. Die Abgabe des Sachberichtes ist für den festgelegt worden. 2 Übersicht über die regionalen Vermarktungswege und deren Kennzeichnung Um eine verlässliche Übersicht über die verschiedenen regionalen Vermarktungswege zu bekommen, wurden in den nachfolgenden Bundesländern Schlüsselpersonen ausgewählt und zu ihrem Wissensstand über die regionalen Vermarktungsaktivitäten und -organisationen sowie deren Adressen befragt. Die so gewonnenen Adressen wurden für die nachfolgenden Übersichten der regionalen Initiativen und Vermarktungswege benutzt. Tabelle 1: Übersicht der befragten Schlüsselpersonen Land Geschäftsstelle Ansprechpartner Telefon Baden- Württemberg Gemeinschaftsmarketing Baden- Württemberg Katharina von Plocki Bayern Bayerisches Staatsministerium für Ernährung, Landwirtschaft und Forsten Ernst Süß Brandenburg Landesamt für Umwelt, Gesundheit und Verbraucherschutz Brandenburg Dr. Hartmut Kretschmer Mecklenburg- Vorpommern Agrarmarketing Mecklenburg- Vorpommern e.v. Jarste Weuffen FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 7

8 Ökologischer Landbau, Förderung, BIO- Zeichen M-V Dr. Hartmut Cziehso Ministerium für Landwirtschaft, Umwelt und Verbraucherschutz Mecklenburg- Vorpommern Dr. Kai-Uwe Kachel Niedersachsen Marketinggesellschaft der niedersächsischen Land- und Ernährungswirtschaft e.v. Jörg Helmsen Rheinland- Pfalz Ministerium für Umwelt, Landwirtschaft, Ernährung, Weinbau und Forsten Jörg Wagner Rhön Dachmarke Rhön GmbH Hannelore Rundell bzw. -35 Saarland Ministerium für Wirtschaft und Wissenschaft Dr. Arnold Ludes, D. Wehlen bzw Sachsen Agrar-Marketing Sachsen e.v. Lutz Krüger Sächsisches Landesamt für Umwelt, Landwirtschaft und Geologie Catrina Kober (regionale Vermarktungsinitiativen) Sächsisches Landesamt für Umwelt, Landwirtschaft und Geologie Detlev Richter Sachsen- Anhalt Agrarmarketinggesellschaft Sachsen- Anhalt Dr. Thomas Lange bzw. Herr Zahn Netzwerk Zukunft Sachsen-Anhalt Anke Schulze- Fielitz Schleswig- Holstein Landwirtschaftskammer Schleswig-Holstein Frau Sandra van Hoorn Thüringen Agrar-Marketing Thüringen Dr. Norbert Stang Alle Schlüsselpersonen wurden telefonisch und/oder per bis zum kontaktiert und befragt. Auf Basis dieser Befragung sowie durch Rückkopplung durch die verschiedenen Partner der Bietergemeinschaft wurden die nachfolgenden Übersichten erstellt. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 8

9 2.1 Übersicht Regionalsiegel der Bundesländer Für eine Vergleichbarkeit wurden die verschiedenen Ländersiegel (konventionell wie bio) nach den nachfolgenden Kriterien betrachtet: Definition der Region, Anteil der Rohprodukte aus der Region bei zusammengesetzten Produkten, das Zertifizierungs- und Kontrollsystem sowie weitere verbindliche Standards. Tabelle 2: Übersicht Regionalsiegel der Bundesländer Logo/Zeichen Siegel Definition der Region Anteil Rohprodukte aus der Region (zusammengesetzte Produkte) Zertifizierung und Kontrolle Weitere verbindliche Standards Baden- Württemberg 100 % der Hauptzutat (Ausnahmen produktbezogen) 3-stufiges Kontrollsystem, jährliche Kontrollen integrierte Produktion Baden- Württemberg mind. 90 % der Hauptzutat 3-stufiges Kontrollsystem, jährliche Kontrollen, Stichproben Bayern 100 % der Hauptzutat 3-stufiges Kontrollsystem ja, produktbezogen ja, produktbezogen Bayern 80 % des Produkts 3-stufiges Kontrollsystem, Stichproben ja, produktbezogen Biosphärenreservat Hessen, Bayern, Thüringen, 5 LKR Hessen 100 % der Hauptzutat (Ausnahmen produktbezogen) 100 % der Hauptzutat (Ausnahmen produktbezogen) 3-stufiges Kontrollsystem (nur Lizenznehmer) 5-stufiges Kontrollsystem, jährliche Zertifizierung keine ja, produktbezogen Hessen 100 % der Hauptzutat (Ausnahmen produktbezogen) 5-stufiges Kontrollsystem jährliche Zertifizierung ja, produktbezogen Mecklenburg- Vorpommern mind. 90 % Gewichtsanteil 3-stufiges Kontrollsystem (nur Lizenznehmer) ja, produktbezogen Rheinland-Pfalz 100 % (zurzeit nur Obst und Gemüse) 3-stufiges Kontrollsystem, jährlich, keine FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 9

10 Saarland 100 % (zurzeit nur Obst und Gemüse) Erzeuger, Lizenznehmer und Zeichenträger: jährliche Kontrolle keine Schleswig-Holstein Molkereierzeugnisse: 100 % der Hauptzutat, Fleischwaren: mindestens 60 % 3-stufiges Kontrollsystem, Kontrolle mehrmals jährlich ja, produktbezogen Thüringen 50,1 % der Hauptzutat jährliche Kontrolle keine Die zurzeit verwendeten Länderzeichen (konventionell wie bio) unterscheiden sich im Wesentlichen durch den Anteil der Rohprodukte aus der Region bei zusammengesetzten Produkten sowie dem Zertifizierungs- und Kontrollsystem. So wird in Hessen vorgeschrieben, dass der Anteil der Rohstoffe bei zusammengesetzten Produkten für die Hauptzutat zu 100 Prozent aus dem Bundesland kommen muss (produktbezogene Ausnahmen sind möglich). In Thüringen muss der Rohstoffanteil dagegen nur größer als 50,1 Prozent sein. Bei den Zertifizierungs- und Kontrollsystemen reicht die Bandbreite von einem einfachen Kontrollsystem über ein dreistufiges System bis zum fünfstufigen Kontrollsystem in Hessen. Zudem unterscheiden sich die Zeichen in der Anzahl der Lizenznehmer beziehungsweise ihrer Marktdurchdringung und Verbreitung. Da die jeweiligen Listungen in den verschiedenen Bundesländern jedoch nach unterschiedlichen Systematiken gehandhabt werden, kann hier keine einheitliche Darstellung erreicht werden. Festzuhalten bleibt, dass in den meisten Fällen je Bundesland, unabhängig von der Anzahl der Zeichennutzungs- oder Lizenzverträge, mehrere hundert Erzeuger (bzw. in Baden-Württemberg und Bayern jeweils mehrere tausend Erzeuger) in das Zeichensystem eingebunden sind. Inaktivierte Zeichen (z. B. Sachsen: Bewährte Qualität - neutral geprüft ) wurden bei der Aufstellung nicht berücksichtigt. Auch die Überlegungen beziehungsweise Entwicklungen in verschiedenen Bundesländern wie Nordrhein-Westfalen oder Niedersachsen, die beide die Einführung eines eigenen Länderzeichens in Erwägung ziehen, fließen noch nicht mit ein. Ebenso wurden die Überlegungen von Baden-Württemberg zur Erweiterung des QZ - Baden Württemberg mit dem Zusatz Gentechnikfrei nicht berücksichtigt. Zusammenfassung Die Kennzeichnung von Regionalität, besonders die Produktionstiefe und Zertifizierungs- und Kontrollsysteme betreffend, ist bei den Länderzeichen unterschiedlich. Einen vergleichbaren Standard haben bisher nur die Bundesländer Hessen, Baden-Württemberg und Bayern. Rheinland-Pfalz und Saarland haben das Regelwerk aus Baden-Württemberg übernommen. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 10

11 Eine zusätzliche Bedeutung auf Länder- bzw. EU-Ebene haben die drei EU-Kennzeichnungen für die Regionalität: geschützte Ursprungsbezeichnung (g.u.), geschützte geografische Angabe (g.g.a.) und garantierte traditionelle Spezialität (g.t.s.) Die Vergabe dieser Kennzeichnung erfolgt über ein mehrstufiges Anerkennungsverfahren auf EU-Ebene. Tabelle 3: Übersicht EU-Kennzeichnungen für die Regionalität Kürzel Beschreibung Produktgruppe Produkte in Deutschland Käse Allgäuer Bergkäse g.u. Erzeugung, Verarbeitung und Herstellung eines Produkts erfolgen in einem bestimmten geografischen Gebiet nach einem anerkannten und festgelegten Verfahren Fleisch Wasser Allgäuer Emmentaler Altenburger Ziegenkäse Odenwälder Frühstückskäse Diepholzer Moorschnucke Lüneburger Heidschnucke 24 Mineralwasser 4 neue Anträge Käse Hessischer Handkäse Nieheimer Käse Fleisch Ammerländer Dielenrauchschinken/ Ammerländer Katenschinken Ammerländer Schinken/ Ammerländer Knochenschinken Bayerisches Rindfleisch Göttinger Feldkieker Göttinger Stracke Greußener Salami Halberstädter Würstchen Hofer Rindfleischwurst g.g.a. Ausreichend, wenn eine der Herstellungsstufen (Erzeugung, Verarbeitung oder Herstellung) in einem bestimmten Herkunftsgebiet erfolgt Nürnberger Bratwürste/ Nürnberger Rostbratwürste Schwäbische Maultaschen oder Schwäbische Suppenmaultaschen Schwäbisch-Hällisches Qualitätsschweinefleisch Schwarzwälder Schinken Thüringer Leberwurst, Thüringer Rostbratwurst, Thüringer Rotwurst Obst und Gemüse Bayerischer Kren Hopfen aus der Hallertau Lüneburger Heidekartoffeln Rheinisches Apfelkraut Salate, Gurken, Feldsalat und Tomaten von der Insel Reichenau Schrobenhauser Spargel Spreewälder Gurken, Spreewälder Meerrettich Tettnager Hopfen FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 11

12 Backwaren Fisch Bier Öl Wein Aachener Printen Bremer Klaben Dresdner Stollen Lübecker Marzipan Meißner Fummel Nürnberger Lebkuchen Salzwedeler Baumkuchen Holsteiner Karpfen Oberpfälzer Karpfen Schwarzwaldforelle 11 Biere Lausitzer Leinöl Hessischer Apfelwein 18 neue Anträge g.t.s. Keine geografische Herkunft, sondern nur eine traditionelle Rezeptur oder ein traditionelles Herstellungsverfahren des Produkts keine Meldungen für Deutschland Zusammenfassung In Deutschland tragen sechs Lebensmittel und 24 Mineralwasser die EU-Kennzeichnung g.u. Im vergangenen Jahr wurden vier Neuanträge gestellt. Im Vergleich dazu hat allein Italien 162 Produkte in dieser Kategorie registriert oder zur Anmeldung angegeben. Im Bereich g.g.a. sind 49 Produkte registriert und 18 neu angemeldet worden. Italien hat 102 Produkte mit diesem Zeichen registriert oder angemeldet. Das Antragsverfahren ist mit hohem zeitlichem und bürokratischem Aufwand versehen, sodass bisher wenige Organisationen/Antragsteller in Deutschland diesen Weg der Auslobung der Regionalität gegangen sind. Gleichzeitig gibt es eine Diskussion um den Wert der g.g.a.-kennzeichnung, da hier der Rohstoffbezug nicht berücksichtigt wird, was jedoch aus Verbrauchersicht gefordert wird. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 12

13 2.2 Regionalsiegel/-marken des Lebensmitteleinzelhandels Das Thema Regionalität wird beim Lebensmitteleinzelhandel auf zwei unterschiedlichen Wegen angegangen. Auf der einen Seite besitzen einige Handelsketten eine eigene regionale Handelsmarke (Privat-Label). Diese regionalen Handelsmarken treten mit eigenem Logo und Verpackung auf und werden wie klassische Marken durch den Markeninhaber geführt. Es gibt keine einheitlichen Regeln beziehungsweise Qualitätsstandards, besonders was den Rohstoffbezug aus der Region angeht. In den meisten Fällen wird die Definition der Region gleichgesetzt mit der Vertriebsregion, was selten politisch-administrativen Grenzen oder geografischen Landschaftsräumen entspricht. Daher findet man bei den Markennamen der Handelsunternehmen eher Wortfelder mit ungenauer Regionsbeschreibung wie beispielsweise Heimat, Von Hier, Küstengold, Norden/Nordisch. Denn eine klare Regionsabgrenzung über einen Markennamen würde eine Einschränkung des Vertriebsgebietes bedeuten. Bei der Marke Unser Norden ist zum Beispiel nur der Verarbeitungsort ausschlaggebend, der Rohstoffbezug dagegen zweitrangig. Die EDEKA Südwest hat ein anderes Konzept: Bei der regionalen Handelsmarke Unsere Heimat werden nur Rohwaren und Produkte verarbeitet, die den Qualitätsregeln der Länderzeichen Hessen, Baden-Württemberg, Rheinland-Pfalz oder Saarland entsprechen. Damit wird die EDEKA Südwest Marke Unsere Heimat mit einem externen Qualitäts- und Kontrollsystem zusätzlich aufgewertet, um eine größere Glaubwürdigkeit zu erlangen. Bei der Edeka Nord Marke Unsere Heimat wird auf die Qualitätsregeln der oben genannten Länderzeichen verzichtet, da in dem Vertriebsgebiet der EDEKA Nord keine vergleichbaren Länderzeichen vorhanden sind. Tabelle 4: Übersicht EU-Kennzeichnungen für die Regionalität Unternehmen Eigenmarke Logo Regionsdefinition + ggf. Qualitätskriterien Bünting Küstengold (famila) der gesamte Nordwesten NaturWert regional (Combi) COOP Unser Norden ( Aus dem Norden für den Norden ) alle Aufbereitungen und Veredelungen in der Region: SH, MV, NI, BB, gelegentlich Hamburg, Bremen und Berlin FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 13

14 EDEKA Nord Unsere Heimat echt und gut aus dem Absatzgebiet : SH, HH, MV, nördliches NI EDEKA Rhein-Ruhr Mein Land regional angebaut (Obst und Gemüse) EDEKA Südwest Unsere Heimat echt und gut aus der Region : Länder BW, HE, RLP, SL, Rohstoffe müssen die Kriterien des entsprechenden Länderzeichens verbindlich erfüllen Feneberg Von Hier 100 km um Kempten Biolinie LIDL Ein gutes Stück Heimat Ursprung ist Heimat aus deutschen Regionen LIDL Ein gutes Stück Heimat garantiert aus Bayerischer Bauernmilch Bayern, Nutzung Geprüfte Qualität-Bayern Netto Ein Herz für Erzeuger deutsche Erzeuger FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 14

15 Penny/REWE Zentral AG Echt Bayrisch keine Angabe Echt Nordisch real Bauernmilch Deutschland Viele Lebensmitteleinzelhandelsunternehmen werben mit dem Thema Regionalität ausschließlich am POS, mit Handzetteln oder Anzeigen und besitzen keine eigne regionale Handelsmarke. Dabei wird die Definition von Region auf das jeweilige Vertriebsgebiet des Händlers beschränkt, welches jedoch oft bundesländerübergreifend ist. Bei der Zusammenarbeit mit landwirtschaftlichen Direktvermarktern wird oft zusätzlich ein Kilometerradius für die Regionalauslobung benutzt (z. B., maximal 30 Kilometer um den Marktstandort). Tabelle 5: Übersicht Werbung des Lebensmitteleinzelhandels mit Regionalität Unternehmen Werbebotschaft Regionsdefinition (ggf. Qualitätskriterien) EDEKA Minden-Hannover Bestes aus unserer Region REWE Dortmund NRW-Heimatprodukte REWE Erzeuger vor Ort REWE Aus unserer Region Erzeuger vor Ort tegut Regionale Projekte, bevorzugt ca. 150 km um Fulda regionaler Einkauf und ausschließlich regionaler Vertrieb Kaufland Regionale Projekte, Naturschutz - Die Regionalen Regional ist erste Wahl Erzeuger vor Ort (Bio-Fachgroßhandel) Alnatura Aus der Region Erzeuger vor Ort Basic Aus der Region Erzeuger vor Ort max. 30 km Umkreis um den jeweiligen Markt; ab 30 km: Bestes aus [Benennung des Herstellungsortes] Nachfolgend einige Beispiele für die Regionalwerbung des Einzelhandels. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 15

16 Abbildung 1: Edeka Minden - die WEZette, Abbildung 2: REWE-Dortmund, Abbildung 3: Werbematerial von Die Regionalen FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 16

17 Zusammenfassung Der Lebensmittelhandel geht das Thema Regionalität auf zwei Arten an: a) mit regionalen Handelsmarken, wobei der Regionenbegriff dem Vertriebsgebiet entspricht und an erster Stelle der Verarbeitungsort des Erzeugers/Herstellers steht und b) mit Werbung zum Thema Regionalität. Die Werbung zum Thema Regionalität kann dabei für den Verbraucher zu Verwirrung führen, da meistens nur der Standort des Verarbeitungsunternehmens ausgelobt wird, jedoch nicht die Herkunft des Rohstoffes oder die Qualität des regionalen Verarbeitungsprozesses. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 17

18 2.3 Regionalinitiativen und -marken Für die Erfassung der verschiedenen Regionalinitiativen wurden die durch die oben genannten Schlüsselpersonen gewonnen Adressen verwendet. Zusätzlich wurden verschiedene wissenschaftliche Studien, die der Bietergemeinschaft zur Verfügung standen, ausgewertet: zum Beispiel die Studie Regionalsiegel in Deutschland, Dossier für das Jahr 2010 (Familie Redlich) oder die Studie der Bayerischen Landesanstalt für Landwirtschaft Regionale Vermarktung, Projektbericht I, Strukturen und Tätigkeitsfelder, Stand Mai/Juni 2010 Im Rahmen dieser bayerischen Studie wurden insgesamt 336 Regionalinitiativen aus ganz Bayern von lokaler bis überregionaler Marktbedeutung erfasst und ihre Ziele und Regeln in einer gemeinsamen Datenbank veröffentlicht, siehe auch /. Die in dieser Datenbank aufgeführten Initiativen konnten in der Kürze der Zeit für die geforderte Übersicht nicht alle berücksichtigt werden. Vergleichbare Studien, wie die aus Bayern, sind unseres Wissens für andere Bundesländer nicht durchgeführt worden. Die von uns erfassten und betrachteten Adressen von Regionalinitiativen und -marken betragen circa 220. Die betrachteten Initiativen und -marken wurden in eine Übersichtstabelle mit den folgenden Rubriken eingefügt: Bundesland, Marke, Gebietskulisse/Transparenz, Standards, Produktionstiefe, Vergabe/Kontrolle, Zusatzkriterien. Die nachfolgende Übersicht zeigt die betrachteten Initiativen in den verschiedenen Bundesländern. Eine ausführliche Auflistung aller Initiativen befindet sich im Anhang (siehe Anhang 12.1, Übersichtstabelle Regionalinitiativen). Tabelle 6: Bundesland Anzahl der betrachteten Initiativen betrachtete Initiativen Bayern 63 Baden-Württemberg 39 Brandenburg 2 Brandenburg/Berlin 2 Bremen 2 Hamburg 2 Hessen 10 Mecklenburg-Vorpommern 5 Niedersachsen 21 Nordrhein-Westfalen 8 Rheinland-Pfalz 10 Saarland 6 Sachsen 7 Sachsen-Anhalt 1 Schleswig-Holstein 5 Thüringen 2 Gesamt 185 Dabei unterscheiden sich die einzelnen Regionalinitiativen und -marken deutlich in der Definition der Region, der Produktionstiefe bei verarbeiteten Produkten, dem Kontroll- und Zertifizierungssystem und den Zusatzkriterien. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 18

19 So gibt es Regionsdefinitionen, die als Regionsgrenze Landkreise, Stadtgrenzen, Regierungsbezirke, Kilometerangaben oder Landschaftsräumen haben. Bei der Regulierung des Rohstoffbezuges reichen die Kriterienvorgaben von 10 über 50 Prozent (Spreewald) bis zu 90 bis 100 Prozent Bezug (Soo Nahe) der Hauptrohware aus der Region. Bei dem Betrachtungspunkt Kontrollen/Zertifizierung findet man bei den betrachteten Regionalinitiativen die gesamte Bandbreite, von der Selbstkontrolle bis zum fünfstufigen Kontrollsystem. Ebenso findet man bei den Zusatzkriterien Vorgaben wie Fairness, Tierwohl, Umweltschutz bis zum dualen Modell (Kooperation von ideellem Verein und wirtschaftlichem Träger). Nachfolgend eine exemplarische Übersicht der Vielfalt der verschiedenen Regionalinitiativen Tabelle 7: Übersicht Vielfalt der Regionalinitiativen Marke Regionsgrenze Produktionstiefe verarbeitete Produkte Kontrollen/ Zertifizierung Zusatzkriterien Anbauweise Landkreise, Städte Tierzukauf regional/von anerkannten Zulieferern je nach Teilbereich intern/extern Duales Modell bio/konventionell Regierungsbezirke und angrenzende Landschaftsräume - 5-stufiges Kontrollsystem km-radius - eigener Standard und Kontrollen Landkreise Rohstoffe nach Kapazität, Hauptwertschöpfung 3-stufiges Kontrollsystem, Zeichenvergabe für 3 Jahre Duales Modell, Nachhaltigkeit, Fairness Artgerechte Tierhaltung Duales Modell bio/konventionell konventionell konventionell Landschaftsraum mind. 10 % der Verarbeitung/Vermarktung/ Verbrauch intern: jährliche Überprüfungen, terminiert vor Ort, Zertifizierung jährlich Duales Modell, Naturschutz, Schulungen bio/konventionell Landschaftsraum, Landkreise produktspezifisch: 70 bis 100 % regelmäßige externe Kontrollen gentechnikfrei, Tierwohl bio/konventionell Bundesland mind. 70 % Gewichtsanteil, Verarbeitung in der Region mind. 1x jährlich, extern Duales Modell, Fortbildungen, Arbeitsplätze bio/konventionell Landschaftsraum mind. 50 % 3-stufiges Kontrollsystem, intern/extern, Markennutzung für je 1 Jahr; g.g.a. Kontrollen Landschaftsraum 90 % der Rohwaren 3-stufiges Kontrollsystem Umweltschutz, gentechnikfrei, Tierwohl konventionell bio/konventionell FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 19

20 Zusammenfassung Eine allumfassende Übersicht über die existierenden Regionalinitiativen und -marken in ganz Deutschland ist in der vorgegebenen Projektlaufzeit nicht möglich. Nach Auswertung der Literatur und nach Aussagen von Experten kann man davon ausgehen, dass zwischen 120 und 150 Regionalinitiativen eine regionale Marktbedeutung haben, die über dem lokalen Verkauf auf dem Wochen- oder Bauernmarkt liegt. Diese Initiativen haben keinen gemeinsamen oder vergleichbaren Kriterienkatalog für die Auslobung von Regionalität. Die Kriterien bei der Regionenabgrenzung haben entweder rein administrativen bzw. landschaftsräumlichen Charakter oder weisen Mischformen von administrativen und natürlichen Grenzen auf. Gebietskulissen können beispielsweise Kommunen, Landkreise, Bundesländer oder Naturlandschaftsräume sein. Die Kriterien beim Rohstoffbezug reichen von 10 bis 100 Prozent aus der Region und beim verbindlichen Kontroll-/Zertifizierungssystem reicht die Bandbreite von der Selbstkontrolle bis zum fünfstufigen Kontrollsystem. Auch bei den Mitgliedern des Bundesverbandes der Regionalbewegung (BRB), welcher circa 55 Mitglieder vertritt, die in der Regel eine regionale Marktbedeutung haben, sind diese Spannbreiten in der Kriterienauswahl in den einzelnen Statuten und Regelwerken vorhanden. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 20

21 2.4 Weitere regionale Kennzeichnungsansätze Bei verschiedenen Organisationen werden ebenfalls Überlegungen hinsichtlich einer Regionalkennzeichnung angestellt. So wird beispielsweise bei der DLG (Deutsche Landwirtschafts- Gesellschaft e.v.) über dieses Thema nachgedacht. Heute schon ist eine zusätzliche Auslobung des Herstellerortes bei der Prämierung mit den DLG-Medaillen möglich. Abbildung 4: DLG-Medaillen Die Agrikom GmbH, Tochtergesellschaft des Deutschen Bauernverbands, der Bundesvereinigung der Deutschen Ernährungsindustrie und des Zentralverbands des Deutschen Handwerks, promotet zurzeit das alte Herkunftszeichen: Aus deutschen Landen frisch auf den Tisch. Markeninhaber ist die GAL (Gesellschaft für Absatzförderung der Deutschen Landwirtschaft e.v.). Das Zeichen wird vergeben, wenn die Produkte zumindest zu 75 Prozent aus deutschen Rohstoffen bestehen. Abbildung 5: Herkunftszeichen: Aus deutschen Landen frisch auf den Tisch FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 21

22 3 Erarbeitung und Darstellung der Kriterien für Regionalität Ausgangspunkt für die Erarbeitung von Kriterien für die Regionalität ist eine klare Beschreibung und Definition des Regionenbegriffs. Dabei wurde das Thema von zwei Seiten bearbeitet: a) aus Sicht der wissenschaftlichen Literatur, speziell der Geografie und b) aus Sicht des Verbrauchers. 3.1 Regionsdefinitionen in Wissenschaft und Praxis Regionsdefinition in der Literatur Das Wortfeld Region wird beinahe inflationär gebraucht; in allen Bereichen von Wirtschaft über Handel hin zur Alltagssprache und Wissenschaft finden der Begriff der Region und seine Ableitungen Verwendung, was zu einer großen Unschärfe der Begrifflichkeit führt (Hock 2005, S. 9). Der Begriff der Region kann sehr unterschiedlich definiert werden, wobei die jeweilige Definition von der Intention der Regionalisierung abhängt (Werlen 1997). In erster Linie geht es darum, einen konkreten Raum, das heißt einen dreidimensionalen Ausschnitt aus der Erdoberfläche, abzugrenzen. Eine Region wird als eine gewissermaßen homogene Einheit wahrgenommen, die sich durch bestimmte Eigenschaften von den angrenzenden Gebieten unterscheidet. Im Folgenden eine pragmatische Grobeinteilung: 1. Im weitesten Sinne ist eine Region eine geografisch-räumliche Einheit mittlerer Größe, das heißt unterhalb der nationalen und oberhalb der kommunalen/lokalen Ebene: zum Beispiel ein Bundesland, Natur-/Landschaftsraum, Landkreis oder Ähnliches, das sich funktional oder strukturell nach außen abgrenzen lässt (vgl. Blotevogel et al. 1989, S. 70, Hock 2005, S. 13, Leser 2005). 2. In der Landeskunde versteht man unter Region ein meist historisch und/oder administrativ bedingtes Territorium, das manchmal auch mehr oder weniger mit Naturräumen oder Teilen von diesen identisch sein kann. Die Abgrenzung kann sowohl natur- als auch sozialwissenschaftlich abgeleitet sein 1. In Bezug auf Versorgungsstrukturen könnte ein Radius von 50 bis 100 Kilometern gelten (vgl. Leser 2005 sowie Sauter und Meyer 2003, S. 25). 3. In der Raumplanung sind Regionen die Planungseinheit für die Regionalplanung. Dementsprechend geben Verwaltungsgrenzen die Gliederung vor. Eine Region wird in der Regel aus mehreren Landkreisen und eventuell kreisfreien Städten gebildet, wobei man sich heute bei der Einteilung zunehmend an Praxisbedürfnissen orientiert und sozioökonomischpolitische Handlungsprozesse stärker gewichtet (vgl. Leser 2005). 4. Im Verständnis von Region als Handlungs- und Erfahrungsraum stehen die handelnden Menschen im Vordergrund, ihr Handlungsfeld wird zur Bemessungsgrenze für die Region. Auf der lokalen Handlungsebene erfolgt eine Orientierung meist an einem selbst erarbeiteten Verständnis von Regionalität (Czech et al. 2002, S. 10, zit. nach Sauter und Meyer 2003, S. 25). 1 D.h. anhand naturräumlicher/landschaftlicher, politisch-administrativer, kulturell-historischer, demographischer oder wirtschaftlicher Gegebenheiten FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 22

23 Zusammenfassung Unter Region versteht man einen Teilraum Deutschlands, größenmäßig zwischen nationaler und lokaler Ebene, also zum Beispiel ein Bundesland, ein Natur-/Landschaftsraum oder eine kleinere Raumeinheit mit kulturell-historischem Hintergrund, die vom Menschen je nach Intention oder Fragestellung anhand bestimmter Merkmale von anderen abgegrenzt wird Regionalität und regionale Lebensmittel In Bezug auf Regionalvermarktung verbindet man mit Regionalität gemeinhin regionale Lebensmittel, das heißt Erzeugnisse mit geografischer Herkunftsidentität und Produkte, deren Herkunft aus einer bestimmten Region für den Konsumenten erkennbar ist. Die Herkunft eines regionalen Produktes ist also transparent und wird dem Konsumenten kommuniziert. Die meisten Konsumenten haben ein emotional-assoziatives Verständnis für den Begriff Regionalität. (Kaliwoda, 2007, S. 6, zit. nach Fahrner 2010, S. 5). Als regionale Lebensmittel werden solche verstanden, deren Herkunft geografisch verortet und eingegrenzt werden kann. (Sauter und Meyer 2003, S. 28). Sauter und Meyer regen an, die Produkte auch bezüglich ihrer Vermarktung zu unterscheiden: Das heißt aufzuzeigen, ob sich Herkunftsregion und Absatzregion entsprechen oder die Vermarktung auch überregional beziehungsweise im Falle regionaler Spezialitäten international geschieht Regionalbewusstsein und Heimat Als Grundlage für Regionsdefinitionen dient zuweilen auch das jeweilige Regionalbewusstsein oder die regionale Identität. Darunter versteht man das Zusammengehörigkeitsgefühl der Bevölkerung eines bestimmten Teilraums über der lokalen Ebene innerhalb eines Staates. Die Bevölkerung fühlt sich bewusst als Einwohner des betreffenden Raumes, den sie als ihre Heimat betrachtet. Regionalbewusstsein wurzelt häufig in einer gemeinsamen, von den anderen Landesteilen unterschiedlichen Geschichte, in gemeinsamen Sitten und Gebräuchen, im Dialekt usw. und kann gezielt gefördert oder beworben werden. Dabei ist eine erdräumliche Abgrenzbarkeit der Region/Raumeinheit zur Bildung von Identität von Vorteil (vgl. Leser 2005 und Hock 2005, S. 13). Im Zusammenhang mit Regionalität darf auch der Verweis auf die Heimat nicht fehlen. Heimat bedeutet ursprünglich Heimstätte, also Grundbesitz. Mittlerweile versteht man darunter eine relativ eng, aber meist unscharf umgrenzte Umwelt, mit der der Einzelne durch Geburt, lange Wohndauer, Lebensumstände usw. emotional verbunden ist (vgl. Leser 2005). Heimat wird noch weniger als Region nach administrativen Grenzen definiert. Heimat ist das unmittelbare Lebensumfeld, das durch vertraute Normen und Konventionen Sicherheit bietet; ein Ankerpunkt innerhalb einer sich immer schneller wandelnden Welt. Region wird von vielen Akteuren mit Heimat gleichgesetzt, entspricht also einem biografisch definierten Raum. Zur geografischen Lokalisierbarkeit von Heimat darf der Aspekt von Heimat als Beziehungsgeflecht nicht vernachlässigt werden. Wichtig sind dabei Identifikation, Zugehörigkeits- und Zusammengehörigkeitsgefühl. Das Heimatgefühl kann als Voraussetzung für soziales Engagement in der Region sowie für regionalen Konsum angesehen werden. Man kann vermuten, dass Region in gewisser Weise nur Heimat als Begrifflichkeit abgelöst hat, FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 23

24 denn auch in der Kommunikation wird versucht, die Inhalte von Heimat auf Region zu übertragen (Hock 2005, S. 212ff), was in der Regel positive Auswirkungen auf die Wahrnehmung von Produkten hat (vgl. Alvensleben 1999, 2001). Dies wird in der folgenden Abbildung schematisch dargestellt. Abbildung 6: Schematische Darstellung des Regionalisierungsprozesses und dessen Wirkung auf die Produktwahrnehmung Zusammenfassung Heimat als angeeigneter Raum hat sowohl räumliche als auch soziale Komponenten, die sich durch ihre Einmaligkeit in der Wahrnehmung des Menschen auszeichnen. Im Bezug auf Konsum wirkt sich die Verbindung von Heimat mit einem Produkt in der Regel positiv auf dessen Wahrnehmung aus Regionsdefinitionen der Regionalinitiativen Regionalinitiativen sind eine der Hauptakteursgruppen im Themenfeld der Regionalität in Bezug auf die Vermarktung von Lebensmitteln. Im Folgenden wird daher aufgezeigt, wie Regionalinitiativen ihre jeweilige Region definieren Regionalinitiativen Regionalinitiativen sind kleinräumige Produktions-, Verarbeitungs- und Vertriebssysteme, deren Erzeugung und Produktion, Veredelung und Verbrauch in derselben abgegrenzten Region (Gebietskulisse) erfolgt, oder Dienstleister, die durch verschiedene Dienstleistungen die Wertschöpfung in der Region erhöhen (vgl. Bayerische Landesanstalt für Landwirtschaft 2011, FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 24

25 S. 11). Nach Hock (2005, S. 18ff) 2 wollen alle Regionalinitiativen die Entwicklung ihrer jeweiligen Region fördern. Dies betrifft vor allem die nachhaltige Regionalentwicklung, inklusive Naturschutz und die (wirtschaftliche) Stärkung der ländlichen Strukturen. Prämisse ist es dabei, gemäß der Agenda 21-Grundsätze, durch lokales Handeln globalen Problemen zu begegnen 3 (vgl. Hock 2005, S. 21, S. 189). Die Regionalbewegung geht auf unterschiedliche soziale Bewegungen zurück, wobei Regionalisierung als komplementäre Entwicklung zur Globalisierung zu verstehen ist. Das Voranschreiten der Globalisierung bringt wachsendes Unbehagen hervor. Es steigt die Sehnsucht nach Rückhalt in überschaubaren Lebenskreisen und viele Menschen wollen das Gefühl haben, die Dinge überblicken zu können und nicht einem anonymen Geschehen ausgeliefert zu sein (Göppel 2000, S. 6). Die Auswirkungen der Globalisierung werden als Bedrohung empfunden, wenngleich die Vorstellungen von dem, was Globalisierung genau ist, auseinandergehen und die damit verbundene marktwirtschaftlich-kapitalistische Gesellschaftsordnung kaum infrage gestellt wird. Region ist in der Wahrnehmung der von Hock befragten Akteure kein Globalisierungsgegenentwurf, sondern ein Rückzugsgebiet für eine von der Globalisierung überforderte Gesellschaft. Dabei würde aus der Feststellung Jeder Mensch hat Wurzeln die Forderung Jeder Mensch braucht Wurzeln. Es ist die Region, so wird betont, die dieses Wurzeln in einer globalisierten Welt ermöglicht (Hock 2005, S. 196). Die Anzahl von Projekten und Entwicklungskonzepten mit Bezug zur regionalen Land- und Ernährungswirtschaft steigt kontinuierlich, wobei eine vollständige Übersicht bislang offiziell nicht existiert. Die umfassendste Übersicht bietet ein Verzeichnis des Deutschen Verbandes für Landschaftspflege e.v., worin Regionalinitiativen und -projekte aus dem gesamten Bundesgebiet gelistet sind ( Nach der letzten Aktualisierung Ende 2007 waren darin über 500 Regionalinitiativen gelistet, 2001 waren circa 350 und 1996 erst circa 120 gelistet. Dabei wurden klassische Direktvermarkter und etablierte kooperative Vermarktungsformen, wie zum Beispiel Bauernmärkte, nicht berücksichtigt. Ein Großteil der erfassten Projekte und Initiativen befasst sich mit der regionalen Vermarktung landwirtschaftlicher Produkte stammten noch fast 40 Prozent der erfassten Initiativen aus dem Bundesland Bayern, seitdem nahm auch der Anteil von Initiativen aus den östlichen Bundesländern zu (vgl. Kullmann 2007) Begriffsdefinitionen der Regionalinitiativen Die Diskussion über genaue Kriterien für die Definition von Regionen erscheint vielen Mitgliedern von Regionalinitiativen müßig und wird als Lähmung der eigentlichen Arbeit gesehen. Sie wird als wenig zielführend erachtet und birgt das Risiko, pragmatische Abgrenzungen als gegebene Raumeinheiten zu verstehen (vgl. Hock 2005). Klare Abgrenzungen sind darüber hinaus vor allem für Förderanträge sehr wichtig. Zudem stellt die Zweckmäßigkeit der Gebietskulisse ein wichtiges Erfolgskriterium einer Regionalinitiative dar (Kullmann 2004, S. 6). Dementsprechend heterogen sind die vorliegenden Regions- 2 3 Hock definiert nicht nach festgelegten Kriterien. Stattdessen nutzt sie die eigenen Aussagen der Regionalinitiativen, die sich als solche bezeichnen und bleibt damit vorurteilsfrei. Nach Radtke, S. 9, zit. nach HOCK 2005, S. 18) sind Initiativen der Regionalbewegung bzw. alle kooperativen Aktivitäten [ ], die auf lokaler und regionaler Ebene kontinuierlich und institutionalisiert eine verbesserte Zusammenarbeit und Nutzung vorhandener wirtschaftlicher, politischer, administrativer, wissenschaftlicher und anderer Potenziale und Ressourcen zum Ziel haben. Dies ergibt sich auch aus der Entstehungsgeschichte vieler Regionalinitiativen in Folge der Rio-Nachhaltigkeitskonferenz FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 25

26 abgrenzungen der Initiativen. Gemessen daran, dass sämtliche Zielsetzungen und strategischen Orientierungen in der Regionalbewegung untrennbar vom Begriff der Region - vor allem als eine normative Idee - geknüpft ist, [ ] wird der Frage, was eigentlich unter Region und Regionalität zu verstehen ist, jedoch erstaunlich selten nachgegangen (Hock 2005, S. 171). Hock (2005, S. 258) beobachtet, dass die meisten Initiativen die Region als etwas objektiv Gegebenes und Unverrückbares ansehen. Der Entstehungszusammenhang der Region sei sehr schnell vergessen und man rede von der Region, als sei diese schon immer vorhanden. Dies stelle insofern ein Problem dar, als die Regionsabgrenzung selbst Teil der Zielsetzungen der Initiativen würde, statt am Entwurf eines Gegenmodells zu Leitbildern einer globalisierten Welt zu arbeiten. Die gelisteten Regionalinitiativen grenzen ihre jeweilige Region in der Regel pragmatisch anhand folgender Kriterien ab: Administrative Grenzen, Landschaftsräume anhand natürlicher oder angelehnt an administrative Grenzen, oder Radius. Diese sind im Folgenden tabellarisch und grafisch dargestellt. Tabelle 8: Abgrenzung von Regionen Politisch-administrativ Natur-/Landschaftsraum Entfernung Regierungsbezirk (z. B. Genussregion Oberfranken) Einzelner Landkreis (z. B. Berchtesgadener Land) Mehrere Landkreise (z. B. Unser Land) natürliche Grenzen (z. B. Eifel, Dachmarke Rhön) Landkreisgrenzen in Anlehnung an Landschaftsraum (z. B. Schwäbische Alb) km-radius um landschaftliche Besonderheit (z. B. Hesselberger: 30 km um den Hesselberg) km vom Standort (z. B. Von Hier (Feneberg): 100 km um Kempten) Abbildung 7: Gebietskulissen ausgewählter Regionalinitiativen in Süddeutschland FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 26

27 Zusammenfassung Die Regionsdefinitionen von Regionalinitiativen spiegeln die vorangehend erläuterten Möglichkeiten, Regionen abzugrenzen, wider. Es handelt sich dabei um pragmatische Zuschnitte, je nach Intention zumeist unter Zuhilfenahme von bereits existenten Grenzziehungen natur-/landschaftsräumlicher oder politisch-administrativer Art. Alle sind kleiner als das Bundesland, in dem sie liegen und größer als einzelne Orte Überschneidungen und Transparenz Aus den unterschiedlichen Möglichkeiten, Regionen abzugrenzen, ergeben sich zahlreiche Überschneidungen von Gebietskulissen, wie in Süddeutschland an den Beispielen Schwäbische Alb, ProNah, Unser Land und Von Hier (Feneberg) deutlich wird. In der Konsequenz werden manche Gebiete von mehr als zwei Regionalinitiativen gleichzeitig abgedeckt. Damit stehen nach Kullmann (2007, S. 3) die jeweiligen Marken zunehmend miteinander im Wettbewerb um Handelspartner und Kunden. Insofern sind einerseits Forderungen nach einheitlichen Kriterien für die Definition von Regionen im Rahmen der Regionalvermarktung verständlich. Andererseits ist dies aufgrund der Vielzahl der bestehenden und etablierten Initiativen sowie deren unterschiedlichen Entstehungsgeschichten und Marketingstrategien kaum umsetzbar, ohne die Autonomie der Initiativen zu beschneiden und ihrer Entstehungsgeschichte unrecht zu tun. Transparenz und leichte Einsehbarkeit der jeweiligen Regionsdefinition für die Kunden ist daher eine Qualität, durch die sich Regionalinitiativen profilieren können. 3.2 Regionsdefinition im Hinblick auf Verbrauchererwartungen Konsummotivationen Der Kauf regionaler Produkte befriedigt sowohl rationale als auch emotionale Bedürfnisse. Zum einen weiß der Verbraucher, dass er zur wirtschaftlichen Stärkung des ländlichen Raumes/seiner Region beiträgt und befriedigt damit sein ökologisches Gewissen. Zum Anderen ist regionaler Konsum als Ausgleichstrend eine Möglichkeit, das Bedürfnis nach Verankerung zu befriedigen, das durch globalisierungsbedingte Entwurzelung entsteht 4. Die Unschärfe des Begriffes Region erlaubt seine Aufladung mit emotionalen Botschaften wie Heimat, Hier, Gutes oder Ähnlichem. Dadurch gelingt es, sowohl rationale als auch emotionale Bedürfnisse zu befriedigen. Alvensleben (1999, 2001) unterteilt mögliche Einflussfaktoren auf die individuelle Präferenz für regionale Lebensmittel in kognitive, normative und affektive Prozesse, wie folgende Abbildung visualisiert. 4 Dazu passt auch das Motto der Regionalbewegung: Wurzeln in einer globalisierten Welt FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 27

28 Abbildung 8: Theoretisches Konstrukt der möglichen Einflussfaktoren auf die individuelle Präferenz für regionale Lebensmittel (Henseleit et al. 2007, S. 8; nach Alvensleben 1999, 2001) Nicht alle Lebensmittel werden gleich stark mit Regionalität assoziiert. So ist die Präferenz der Verbraucher bei solchen Lebensmitteln am stärksten ausgeprägt, bei denen die Kaufentscheidung hauptsächlich mit Frische sowie Vertrauen und Sicherheit zusammenhängt. Diese Lebensmittel sind Fleisch und Fleischwaren, Milch und Milchprodukte, Eier, Obst und Gemüse sowie Backwaren. Auch bei Mineralwassern existiert ein relativ starker Regionalbezug, teilweise bei alkoholfreien Erfrischungsgetränken sowie bei Bier und Wein. Tendenziell nimmt mit zunehmendem Verarbeitungsgrad die Bedeutung des Kriteriums regionale Herkunft ab (Sauter und Meyer 2003, S. 29). Die Definition des jeweiligen Regionalitätsverständnisses ist sehr heterogen und hat eine große Bandbreite, wie unter anderem die folgende Abbildung aus einer Fokusgruppenerhebung der tegut Gutberlet Stiftung von 2011 exemplarisch aufzeigt. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 28

29 Für Sie als Unternehmen würde ich sagen, ist die Region das gesamte Verbreitungs-Gebiet der tegut Märkte plus 100 Kilometer Umkreis. Das ist die Region, wo Lebensmittel her kommen können, dann müsste man auch in Göttingen, Niedersachsen die gleichen Produkte haben wie in Weimar oder Franken. (Fulda) Meine Region, das ist ganz klar, ist der Kreis Fulda, Main-Kinzig-Kreis schon nicht mehr, Vogelsberg erst recht nicht und Hersfeld oder Hünfeld sowieso nicht. (Fulda) Regional ist Gotha (Gotha) Das Bundesland (Wiesbaden, Gotha) Für mich ist die Region auch das Dreiländereck und die Rhön. (Wiesbaden) Für mich ist der einzelne Landkreis die Region. (Wiesbaden) Abbildung 9: Bandbreite von Regionsbezügen (Rutenberg 2011) Kaufentscheidungsverhalten Verbraucher verhalten sich oft ambivalent, das heißt, ihre Kaufentscheidung entspricht nicht immer ihren eigentlichen Präferenzen beziehungsweise Überzeugungen. So stellen viele Studien einen deutlichen Unterschied zwischen subjektiver Bedeutung regionaler Produkte und der tatsächlichen Kaufentscheidung fest. Dies ist auf die enorme Komplexität der Faktoren, die die Kaufentscheidung beeinflussen, zurückzuführen, von denen nicht zuletzt die Mehrpreisbereitschaft und damit die letztendliche Kaufentscheidung abhängen. Es besteht Einigkeit darüber, dass dem Wunsch nach Regionalität eine jeweils individuelle Überzeugung zugrunde liegt. Wie weit die Erwartung Es soll aus meiner Region kommen geht, darüber machen sich Verbraucher in aller Regel wenig Gedanken. Selten wird beispielsweise die Frage gestellt, ob ein regionales Schwein auch mit regionalen Futtermitteln gefüttert wird oder woher Saatgut und Pflanzensetzlinge kommen. Fragt man Verbraucher jedoch genauer, erwarten sie mit großer Selbstverständlichkeit, dass sowohl landwirtschaftliche Vorstufen als auch die Verarbeitung regional sind. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 29

30 3.2.3 Verbraucherstudien zum Thema Regionalität Tabelle 9: Übersicht Verbraucherstudien zum Thema Regionalität Studie Jahr Inhaltszusammenfassung BVE/GfK: Consumers Choice Lebensmittelqualität im Verbraucherfokus DLG-Studie: Regionalität aus Verbrauchersicht (n=ca ) 2011 Für ca. 50 % stellt die Herkunft aus der Region ein wichtiges Qualitätskriterium dar. Ein Großteil der Befragten hält es für schwierig, die Qualität von Lebensmitteln richtig zu beurteilen und wünscht sich strengere Kontrollen. Das größte Vertrauen in Bezug auf Qualitätsaussagen wird Testberichten und Verbraucherschutzorganisationen entgegengebracht, gefolgt von Erzeugern, NGOs und Qualitätssiegeln Besonderheit der Studie: Unterscheidung nach innerdeutschen Regionen und drei sozialen Milieus. Regionalität als langfristiger Trend, Stichwort: sehr bekannt. Regionalität für fast alle Befragten: Produkte, die aus der eigenen Region kommen. Ca. 50 % verstehen darunter den Großraum um die eigene Stadt, ca. 50 % das eigene Bundesland. Je weiter südlich und je höher das soziale Milieu desto kleinräumlicher wird definiert und desto stärker ist die Identifikation mit Liebe zur Region ausgeprägt. Regionalität betrifft vor allem Frischprodukte wie Obst/Gemüse, Eier, Fleisch/Wurstwaren und Milchprodukte. Zielgruppen für die Vermarktung finden sich eher in höheren Einkommensklassen. Die Sensibilität für die eigene Region korreliert oft mit dem Interesse an Produkten auch aus anderen Regionen. Siegel zur Zertifizierung regionaler Produkte wenig bekannt. Markenentscheidungen hauptsächlich emotional getroffen, wobei sich der Verbraucher auch auf Qualitätssiegel verlässt. Regionalität ist eher Produktthema, kein ethisches Thema. Dies folgt aus der Kaufmotivation: Frische aus der eigenen Region; rationale Aspekte wie Transportwege oder Umweltschonung spielen dagegen eine eher untergeordnete Rolle. Regionalität ist ein sehr emotionales Thema. Daher kann bei undifferenziertem Wissensstand der Verbraucher werblich leicht auf Allgemeinplätze, wie ein Verständnis von Deutschland als Region, zurückgegriffen werden. Dies stellt den Handel in die Verantwortung, die eigene Region zu definieren und authentisch zu kommunizieren. Fresenius Verbraucherstudie: Lebensmittelqualität und Verbrauchervertrauen bzw. Verbrauchermacht (n=je ca ) 2011 und 2010 Verbraucher sind von Verpackungsangaben verunsichert. Angst vor allem vor Falschangaben bezüglich der Inhaltsstoffe, daher Bedürfnis nach Transparenz und Sicherheit in Form glaubwürdiger Orientierungshilfen. Mehrzahl der Verbraucher wünscht sich frische, qualitativ hochwertige und gleichzeitig günstige Produkte, wobei knapp die Hälfte beim Einkauf auf Produkte aus der Region achtet. Ost- und Süddeutsche achten überproportional stark darauf, dass gekaufte Lebensmittel aus der unmittelbaren Umgebung kommen. Für fast 60 % der Verbraucher hängt die Qualität der Lebensmittel von deren Herkunft ab. Nestlé Studie: So is(s)t Deutschland (n=4.203) % der Befragten kaufen regelmäßig, 44 % gelegentlich Produkte aus der Region; dabei ist eine Diskrepanz zwischen subjektiver Bedeutung und Mehrpreisbereitschaft feststellbar. Unter regionalen Produkten verstehen Verbraucher: zu 51 % Produkte aus der näheren Umgebung, zu 23 % aus dem eigenen Landesteil, zu 25 % aus dem eigenen Bundesland, zu 5 % auch von weiter weg. In Ostdeutschland betrifft die Regionsdefinition unterproportional die nähere Umgebung, zugunsten des Bundeslandes (28 % bzw. 43 %). Vergleich der Konsummotivationen regional und bio: Beim Kauf von Bioprodukten folgt der Verbraucher eher einem selbstbezogenen Motiv (z. B. Gesundheit). Regional steht dagegen für nachhaltigkeits- und produktbezogene Themen wie Frische, Förderung der lokalen Wirtschaft, kurze Lieferwege und Wissen um die Herkunft der Produkte. Die Vielzahl an Qualitäts- und Gütesiegeln verwirrt Verbraucher zunehmend. Hinsichtlich deren Bekanntheit und Akzeptanz bestehen große Unterschiede. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 30

31 Otto Group Trendstudie Verbrauchervertrauen (n=1.000) SKOPOS: Studie zu Lebensmittelsiegeln (n= ca ) Dialego: Erhebung zum Konsum von regionalen Produkten (n=1.000) Studie der Verbraucherzentrale Die Ausweise, bitte! (n=ca ) ZMP/CMA: Trendstudie Food 2011 Thema ethischer Konsum mit dem Fokus Verbrauchervertrauen. 77 % der Befragten bringen Regionalität mit Konsumethik in Verbindung. Konsumenten suchen nach klaren Werten und verlässlicher Orientierung, Thema wird wissensintensiver, Reduktionskomplexität nötig, Bekanntheit von Marken gibt Sicherheit. Allgemeine Verwirrung steigt, Interesse für nachhaltigen Konsum wird massentauglich. Großes Vertrauen in Testinstitute, Freunde und Verwandte, Bedeutung von NGOs nimmt zu, dagegen werden Politik, Werbung und Wirtschaft für unglaubwürdiger erachtet. Der Konsument ist kein unmündiges und per se schützenswertes Wesen mehr, die Mehrzahl (vor allem in höheren Einkommensklassen) ist sich ihrer Macht bewusst und honoriert transparente Informationspolitik Wahrnehmung nicht bekannter Siegel zunächst skeptisch, wobei deren Glaubwürdigkeit eher nicht infrage gestellt wird. Fehlendes Vertrauen auf unzureichende Informationen bezüglich Prüfkriterien zurückführbar. Dilemma für den Hersteller: Verbraucher verlangen einerseits mehr Transparenz und Detailinformationen, andererseits gibt ein Drittel seine Überforderung mit der Vielzahl an Zeichen und Aufdrucken an % kaufen bewusst und mit steigender Tendenz regionale Produkte (nicht weiter definiert) ein, verstärkt ab 30 und in Einkommensgruppen ab Euro/Monat. Gründe gegen den Kauf regionaler Produkte sind Desinteresse, Aufwand und Kosten; Gründe dafür sind vor allem die Unterstützung regionaler Betriebe, ausgereifte Produkte und Umweltschutz. Besonders Obst/Gemüse, Eier und Fleisch werden regional gekauft. Kaufstätten sind insbesondere der Supermarkt, Wochenmarkt und Direktvermarkter. Mehr als die Hälfte sind mit dem regionalen Angebot in der Umgebung zufrieden Reges Verbraucherinteresse an Rohstoffherkunft, auch in zusammengesetzten Produkten. Aufklärung darüber ist lückenhaft und die fehlende gesetzliche Regelung wird bemängelt. Herkunftsangaben werden mehr zu Marketing- als zu Informationszwecken eingesetzt. Daher Rahmenbedingungen für Transparenz gewünscht. 85,4 % der Befragten wünschen die Kennzeichnung auf dem verpackten Produkt beziehungsweise auf einem Schild bei loser Ware. Forderungen sind unter anderem die grundsätzliche Kennzeichnung von Monoprodukten, der wichtigsten Zutaten in zusammengesetzten Lebensmitteln, Kennzeichnung von Produkten mit regionalem Bezug und Angabe der Kontaktdaten des Herstellers Regional Food sind Lebensmittel mit einem klar definierten räumlichen wie kulturellen Bezugspunkt für den Konsumenten. Die Definition der Region ist vom jeweiligen situativen Kontext abhängig (aktueller Aufenthaltsort, Fragender, Fragestellung). Regionalität als langfristiger Konsumtrend der Rückbesinnung auf Bewährtes/Vertrautes; stark wachsendes Konsumentenbedürfnis nach regionaler Herkunft der Lebensmittel. Haupttreiber des Trends: durch Globalisierung entstehender Wunsch nach Überschaubarkeit sowie gesundheitliche Aspekte. Kommunikation verbindet durch Markenbildung Herkunft und Qualität. Bewusstsein für Produktherkunft nimmt zu. Heimat als emotionaler Anker vermittelt durch räumliche Nähe das Gefühl von Sicherheit und Vertrauen. Geografische Herkunft wird mit Qualität und Authentizität gleichgesetzt, Herkunftsauslobung steht für Vertrauenswürdigkeit, geschmackliche/gesundheitliche Vorteile und Lebensmittelsicherheit. Regionalität konstituiert sich aus geografischer und kultureller Zugehörigkeit und wirkt identitätsstiftend. Wichtig sind dahin gehend Gefühle von Heimat und Geborgenheit. ZMP-Studie: Nahrungsmittel aus der Region - Regionale 2003 Der Verbraucher versteht unter seiner Region : zu über 40 % sein Bundesland, darauf folgen zu je etwa gleichen Anteilen Stadt, Kreis oder naturräumliche Einheit (Schwaben, Ruhrgebiet oder ähnliches). Knapp 9 % fühlen sich als Nord-, Süd-, Ost-, Westdeutsche. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 31

32 Spezialitäten (n=3.000) Regionalverständnis ist regional unterschiedlich: Verbraucher im Norden Deutschlands fühlen sich tendenziell eher als Norddeutsche, in den neuen Bundesländern verstärkte Identifikation über das Bundesland und vor allem in Bayern und Nordrhein-Westfalen überproportional über kleinere Einheiten wie Naturräume. Ältere Menschen und solche, die ihre Region kleinräumig definieren, identifizieren sich in der Regel auch stärker mit ihrer Region, was mit der Präferenz für den Kauf regionaler Lebensmittel korreliert. Besonders Frischware wie Eier, Fleisch- und Milchprodukte sowie Gemüse und Brot werden bevorzugt aus regionaler Herkunft gekauft, wobei vor allem in Süd- und Ostdeutschland auf die regionale Herkunft von Produkten geachtet wird. Zusammenfassung Verbraucher definieren die eigene Region größenmäßig unterhalb der nationalen/staatlichen und oberhalb der lokalen/kommunalen Ebene. Circa 40 Prozent nennen ihr Bundesland, circa 50 Prozent eine kleinräumigere räumliche Einheit. Regionsdefinitionen und die Stärke der Identifikation mit der eigenen Region sind deutschlandweit uneinheitlich. Verwirrung durch unübersichtliche Kennzeichnungen wird bemängelt, Transparenz dagegen gewünscht und honoriert. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 32

33 4 Inhaltliche Definition unter Beachtung der Produktionstiefe Die Diskussion und Definition der inhaltlichen Vorgaben zur Regionalität hat größte Bedeutung und soll unter Beachtung einer Vielzahl von Gesichtspunkten und deren Abwägung erfolgen. Im Folgenden werden daher die Themenfelder Monoprodukte, zusammengesetzte Produkte und Wertschöpfungsketten ausgewählt und gesondert betrachtet. Außerdem werden die Chancen und Risiken einer Einbindung der Landwirtschaft, der landwirtschaftlichen Vorstufe, des nachgelagerten Bereichs sowie verschiedene Szenarien an Ausnahmeregelungen aufgezeigt. Die zentrale Fragestellung bei allen Betrachtungen ist, ob zur Gewährleistung einer regionalen Auslobung der Hauptrohstoff ausschlaggebend ist oder ob weitere Zutaten berücksichtigt werden müssen und wie umfassend daher die Produktionstiefe ausgelobt werden soll. Zurzeit existieren keine bundesweiten aussagekräftigen Studien, die die Meinung der Verbraucher in Bezug zur Produktionstiefe erfragen. Interpretiert man die Ergebnisse der drei nachfolgend aufgeführten Studien, so kann man die These aufstellen, dass ein großer Teil der Verbraucher von einem regionalen Produkt erwartet, dass die Rohstoffe in der Region erzeugt wurden und dass die Verarbeitung und die Vermarktung in der Region stattfinden. Tabelle 10: Verbraucherstudien zum Thema Regionalität unter Beachtung der Produktionstiefe Studie Jahr Stichprobe Ergebnisse DLG-Studie 2011 Online-Befragung; n=1.350 Vzbv - Kennzeichnung von regionalen Lebensmitteln/ Forsa-Umfrage im Auftrag des BMELV zur biologischen Vielfalt, BMELV 2010 Verbraucherumfrage des Saarländlich-Team 97 % der Befragten verstehen unter Regionalität Produkte aus der Region (angebaut, produziert und verkauft) 2010 keine Angabe Regionalität=Herstellung der Rohstoffe und Verarbeitung in der Region; zusätzliche Produktqualitäten: mehr Frische, ohne Gentechnik, Ökoqualität, artgerechte Tierhaltung 2008 n=50 Herstellung in der genannten Region: 80 % Herstellung der Zutaten in der Region: 74 % Weiterverarbeitung und Herstellung des Endprodukts in der Region: 70 % Vermarktung in der Region: 56 % Eigenschaften regionaler Lebensmittel: nach besonderen Kriterien bezüglich Tierschutz und Pestizideinsatz hergestellt (80 %) gentechnikfrei (92 %) nach biologischen Richtlinien hergestellt (70 %) FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 33

34 4.1 Monoprodukte Für die weitere Betrachtung werden die Produkte in zwei Kategorien aufgeteilt: Monoprodukte zusammengesetzte Produkte Eine einheitliche Definition von Monoprodukten gibt es nicht. Laut Lebensmittelkennzeichnungsverordnung muss eine mengenmäßige Zutatendeklaration in Gewichtsprozent erfolgen, kurz QUID (Quantitative Ingredients Declaration). Im Rahmen dieser Verordnung werden Monoprodukte als Produkte definiert, die aus einer Zutat bestehen. Quasi-Monoprodukte sind solche, die zu 98 Prozent aus einer Zutat bestehen. Für solche Produkte muss kein Zutatenverzeichnis auf der Verpackung angegeben werden. Die Monoprodukte kann man wiederum in zwei Unterkategorien aufteilen: unverarbeitete Monoprodukte wie z. B. Obst und Gemüse etc. verarbeitete Monoprodukte wie z. B. H-Milch, Apfelsaft, Weizenbrot etc. Wie schwierig es ist, eine regionale Wertschöpfungskette umzusetzen, muss man allerdings auch bei den Monoprodukten differenziert betrachten: Monoprodukte, die über einen längeren Zeitraum lagerfähig sind, kann man durch eine Chargenbildung und räumliche Trennung relativ einfach als ein regionales Produkt darstellen. Verarbeitete Monoprodukte, die in einem relativ kleinen Zeitfenster erzeugt, erfasst, verarbeitet und verbraucht werden müssen - wie etwa Milch -, sind in der Umsetzung deutlich komplizierter. 4.2 Zusammengesetzte Produkte Um die Rohstoffbasis darzustellen, werden exemplarisch vier verarbeitete Produkte, je zwei pflanzlicher und zwei tierischer Herkunft, tabellarisch dargestellt. Bei den jeweiligen Anteilen der Zutaten handelt es sich um ungefähre Zahlen, da verschiedene Verarbeitungsunternehmen individuelle Rezepturen haben. Die Wertschöpfungsketten werden in die Bereiche Landwirtschaft und verarbeitende Industrie aufgeteilt, wobei der jeweilige vor- und nachgelagerte Bereich sowie die Zulieferer in dem System nicht gesondert aufgeführt werden. Dies erfolgt im Abschnitt Wertschöpfungskette. Die regionale Verfügbarkeit wird mit Schulnoten von 1=sehr gut (Verfügbarkeit möglichst flächendeckend in der Region gegeben) bis 6=ungenügend (Verfügbarkeit in der Region nicht gegeben) dargestellt. Zusammenfassung Monoprodukte und zusammengesetzte Produkte Da Monoprodukte quasi nur aus einer Zutat bestehen, ist die Definition der Anteile der Rohstoffe, die in der Region erzeugt wurden, relativ einfach. Eine Festlegung auf 100 Prozent Rohstoffe, die in der Region erzeugt wurden, ist bis auf wenige Ausnahmen umsetzbar. Zusammengesetzte Produkte können unter Umständen aus einer Vielzahl von Zutaten bestehen. Analog der gängigen Praxis bestehender Regionalsysteme ist ein Bezug der Mindestanteile an Zutaten, die in der Region erzeugt wurden, zur Hauptzutat bzw. zur Gesamtmasse bzw. zu beiden Gesichtspunkten denkbar. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 34

35 Die Hauptzutat ist die Zutat (außer Wasser), die an erster Stelle vom Zutatenverzeichnis steht. Eine Ausnahme stellt hierbei die Zutat Wasser dar. Das wird am Beispiel Bier deutlich, da hier nach dem Wasser das Malz folgt, welches unter dem Gesichtspunkt der Regionalität die Hauptzutat ist. Bei einem Bezug zur Gesamtmasse sollte man die prozentualen Anteile analog zum Zutatenverzeichnis, somit bezogen auf die Frischmasse, betrachten. Bei einigen Regionalsystemen wird abweichend zum Bezugspunkt der mengenmäßigen Hauptzutat die wertmäßige Hauptzutat betrachtet. Dies hat aber folgende Nachteile: Bestimmung ist nur betriebsindividuell möglich und könnte sich je nach Preisentwicklung der Zutaten verändern. Für den Verbraucher ist diese Festlegung nicht nachvollziehbar, da er die Einkaufspreise der Hersteller nicht kennt Pflanzliche Produkte Als verarbeitete Produkte pflanzlicher Herkunft werden Weizenbrot und Erdbeerkonfitüre herangezogen. Als Region wurde das Bundesland Baden-Württemberg ausgewählt. Weizenbrot Die folgende Tabelle gibt eine Übersicht über die Zusammenstellung der Zutaten, der Wertschöpfungsketten und die regionalen Verfügbarkeiten für Weizenbrot. Für die Herstellung ist die Zugabe der Grundzutat Weizenmehl auf mindestens 90 Prozent vorgegeben. Grundsätzlich wäre es hier möglich, den Anteil an Weizen auf über 90 Prozent zu erhöhen, je nach Backrezeptur. Tabelle 11: Beispiel Getreide: Weizenbrot Zutat Anteil in Prozent Wertschöpfungsketten Regionale Verfügbarkeit (Notensystem 1-6) Weizenmehl mind. 90 Landwirtschaft (Weizen) 1 Landhandel 3 Mühle 3 Wasser Wasserversorger 1 Hefe Hefehersteller 5 Salz Salzbergbau oder Salinen 5 Quelle: MBW, 2011 Der regionale Bezug der weiteren Zutaten, außer Wasser, wird schwer zu gewährleisten sein, da sowohl Hefe als auch Salz nicht in allen denkbar möglichen Regionen (hier die Region Baden-Württemberg) verfügbar sind. Erdbeerkonfitüre Die nachfolgende Tabelle beschreibt die Zusammensetzung, Wertschöpfungsketten und regionale Verfügbarkeit für Erdbeerkonfitüre. Die Einfuhr von Erdbeeren lag mit knapp über FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 35

36 Tonnen 5 im vergangenen Jahr deutlich über den Ausfuhren ( t 6 ). Die Eigenproduktion in Deutschland beläuft sich auf Tonnen 7. Daraus wird ersichtlich, dass ein Großteil der Erdbeeren für den Bereich Frische und Verarbeitung nicht aus Deutschland stammt. Ein regionaler Bezug wäre hier nur für kleinere Konfitürenhersteller möglich, welche in oder bei den Hauptanbaugebieten in Deutschland ansässig sind. Neben der mengenmäßigen Problematik ist es bei der Zusammensetzung von Erdbeerkonfitüre schwierig, über den Fruchtanteil hinaus, der in der jeweiligen Rezeptur vorgesehen ist, regionale Rohstoffe zu beziehen. Die zweite Hauptzutat Zucker ist mit einer Produktion von Tonnen 8 in der Zeit von August 2009 bis Oktober 2010 für die Verwendung in Marmeladen und Konserven ( t 9 ) in Deutschland zwar ausreichend verfügbar. Allerdings sind in der deutschen Zuckerindustrie 2008 nur noch sechs Unternehmen tätig, wodurch der regionale Bezug, je nach Definition der Region, nur sehr selten möglich ist 10. Gleichzeitig fehlen in vielen Regionen die entsprechenden Verarbeitungsstätten. Tabelle 12: Beispiel Obst: Erdbeerkonfitüre Zutat Anteil in Prozent Wertschöpfungsketten Regionale Verfügbarkeit (Notensystem 1-6) Früchte 54 Landwirtschaft 3 Großhandel 3 Verarbeitende Industrie 5 Zucker aus Zuckerrüben 39 Anbau/Landwirtschaft 2 Großhandel 2 verarbeitende Industrie 5 Pektin ca. 6 6 Säuerungsmittel ca. 0,5 6 Quelle: MBW, Tierische Produkte Um die Rohstoffbasis tierischer Produkte darzustellen, wurden Erdbeerjoghurt und Schinkenwurst als verarbeitete Produkte herangezogen. Erdbeerjoghurt Die nachfolgende Tabelle gibt einen Überblick über Zutaten, Wertschöpfungsketten und regionale Verfügbarkeit von Erdbeerjoghurt. Insgesamt macht die Milchverwendung für Joghurt, Sauermilch und Kefirerzeugnisse mit 1,91 Prozent 11 der 2010 in Deutschland verfügbaren 5 Diagramm: Statistisches Bundesamt BLE422, Einfuhr von Erdbeeren nach Deutschland Statistisches Bundesamt, BMELV: Gesamtbericht Ausfuhr von Obst und Gemüse Diagramm: Statistisches Bundesamt, BMELV (123) 8 BLE: Zuckererzeugung, Zuckerabsatz, Zuckerbestände (Tabelle) 9 BLE: Zuckerabsatz der Zuckerfabriken und Handelsunternehmen (Tabelle) 10 Statistisches Bundesamt, BMELV: Unternehmenskonzentration im Produzierenden Ernährungsgewerbe (Tabelle) 11 BLE: Verwendung von Milch in den Molkereien nach Kalenderjahren (Tabelle) FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 36

37 Menge nur einen geringen Anteil aus. Bereits seit 2000 ist der Selbstversorgungsgrad für Fruchtjoghurt dementsprechend hoch und unterschritt bis 2009 nie 110 Prozent 12. Tabelle 13: Beispiel Milch: Erdbeerjoghurt (Fruchtjoghurt) Zutat Anteil in Prozent Wertschöpfungsketten Regionale Verfügbarkeit (Notensystem 1-6) Joghurt ca. 83 Landwirtschaft (Milch) 2 Spedition/Erfassung 2 Molkereiwirtschaft 2 Fruchtzubereitung Landwirtschaft (Obst) 3 (Fruchtanteil muss mind. Großhandel 3 6 % sein) Verarbeitende Industrie 5 Zucker ca. 12 Landwirtschaft (Zuckerrüben) 2 Zuckerfabriken 5 Stärke (Mais, Weizen oder ca. 2 Landwirtschaft 1 Kartoffeln) Stärkeproduzenten 5 Quelle: MBW, 2011 Der Bezug von regionalen Rohstoffen kann, je nach Lage der Molkerei und deren Einzugsgebiet in der definierten Region, eine Herausforderung für das Management der Warenströme sein. Die Situation für die Fruchtzubereitung aus Erdbeeren stellt sich ähnlich dar wie für Erdbeerkonfitüre. Der Rohstoffbezug findet europaweit statt. Eine Erhöhung des Anteils an regionalem Joghurt ist schwierig, da der Anteil an Frucht in einem Fruchtjoghurt mindestens 6 Prozent betragen muss. Daher ergeben sich Zumischungen der Fruchtzubereitungen von 12 bis 20 Prozent. Schinkenwurst Die nachfolgende Tabelle gibt einen Überblick über die Zutaten, Wertschöpfungsketten und regionale Verfügbarkeit für Schinkenwurst. Bei der Zusammensetzung dieses Produktes sind es zwei Hauptzutaten, die regional bezogen werden müssten. Von den weiteren Zutaten wären lediglich die Zwiebeln teilweise regional zu beziehen. Alleine bei einer der beiden Hauptzutaten, dem Schwein, ist die Verarbeitung in Deutschland sehr unterschiedlich angesiedelt. Während in Saarland und Hessen 2010 zusammen nur ca Tiere inländischer Herkunft gewerblich geschlachtet wurden, waren es in Niedersachsen Tiere 13. Tabelle 14: Beispiel Fleisch: Schinkenwurst Zutat Anteil in Prozent Wertschöpfungsketten Regionale Verfügbarkeit (Notensystem 1-6) Schweinefleisch (Brät und Grobeinlage) ca Landwirtschaft (Schwein) 2 Viehhandel 2 Verarbeitung (Fleisch und Wurst) 4 12 BMELV, Statistisches Bundesamt, BLE: Versorgung mit Sauermilch-, Kefir- und Joghurterzeugnissen, Milcherzeugnissen sowie -getränken in Deutschland in den Jahren von 2000 bis 2009 (Tabelle) 13 Statistisches Bundesamt: Geschlachtete Tiere, Schlachtmenge, Bundesländer (Tabelle) FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 37

38 Rindfleisch ca. 42 Landwirtschaft (Rind) 2 Viehhandel 2 Verarbeitung (Fleisch und Wurst) 4 Eis Wasserversorger 1 Zwiebel 1 Landwirtschaft 2 Pfeffer und andere Gewürze oder Gewürzpräparate Großhandel/Lager 2 2 Anbau/Landwirtschaft 5 Großhandel 5 verarbeitende Industrie 5 Salz Salzbergbau oder Salinen 5 Quelle: MBW, Wertschöpfungskette Für zusammengesetzte Produkte und Monoprodukte darf davon ausgegangen werden, dass eine tiefe Einbindung der Wertschöpfungskette die Glaubwürdigkeit regionaler Produkte steigert. Allerdings wächst damit die Gefahr, dass solche regionale Wertschöpfungsketten nicht umsetzbar sind. Im Folgenden werden zwei Teilbereiche näher betrachtet: zum einen die Stufe der Landwirtschaft und deren Vorstufen, zum anderen die Verarbeitungs- und Vermarktungsstufen. Exemplarisch wird dies in der pflanzlichen Produktion anhand von Weizenverarbeitung zu Brot und in der tierischen Produktion anhand von Milchverarbeitung zu Joghurt bzw. der Fleischproduktion dargestellt Landwirtschaft und deren Vorstufen Bei der folgenden Betrachtung der Landwirtschaft und deren Vorstufen wird das Hauptaugenmerk auf die Betriebsmittel mit Wertschöpfungsketten gelegt, welche mengenmäßig den größten Anteil haben. Der Zukauf von Dienstleistungen, Maschinen oder Energie wird nicht berücksichtigt. Obwohl im Jahr 2009/10 der Selbstversorgungsgrad bei Weizen 136 Prozent 14 betrug und die Verfügbarkeit deutschlandweit gegeben ist, liegen hier die Herausforderungen in der Struktur der Wertschöpfungskette, welche in Abbildung 10 schematisch dargestellt ist. Die wichtigsten eingebrachten Betriebsmittel aus dem vorgelagerten Bereich sind Saatgut, Düngemittel und Pflanzenbehandlungs- sowie Schädlingsbekämpfungsmittel (PS-Mittel). Die Gesamtanbaufläche von Weizen (im Folgenden: Winterweizen und Sommerweizen ohne Hartweizen) betrug 2010 in Deutschland Hektar 15. Daran gemessen ist die Vermehrungsfläche für landwirtschaftliches Saatgut mit Hektar 16 verhältnismäßig gering und liegt in der Hand weniger Unternehmen. 14 BLE, BMELV: Versorgung mit Hart- und Weichweizen zusammen (Tabelle) BMELV: Getreideanbauflächen nach Getreidearten und Ländern (Tabelle) Bundessortenamt, BMELV: Vermehrungsflächen von landwirtschaftlichem Saatgut (Tabelle) FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 38

39 Ein Bezug von regional hergestellten Pflanzenschutz-Mitteln und mineralischem Dünger ist aufgrund des Konzentrationsprozesses der Herstellerfirmen in diesem Marktsegment in Deutschland nicht möglich. Hier besteht die Gefahr, dass keine Wertschöpfungsketten entstehen können. Gleiches gilt für die Verwendung von mineralischen Düngern. Anders ist es, wenn tierische Düngemittel zum Einsatz kommen. Vieh haltende Betriebe können teilweise auf eigenen Dünger zurückgreifen oder eine Kooperation mit Vieh haltenden Betrieben eingehen. Hier kann in einem regionalen System die Kreislaufwirtschaft und Zusammenarbeit gefördert werden, wobei insbesondere klein- und mittelständische Betriebe der Landwirtschaft ein Alleinstellungsmerkmal herausarbeiten können. Abbildung 10: Schematische Darstellung Wertschöpfungskette Bei der Milchproduktion sind die Futtermittel der wichtigste Faktor. Die Nachzucht erfolgt häufig in einem geschlossenen System, in dem bei künstlicher Befruchtung lediglich das Bullensperma von außen zugekauft wird. Grundsätzlich können Futtermittel innerbetrieblich erzeugt werden oder bei anderen landwirtschaftlichen Einheiten oder der Futtermittelindustrie zugekauft werden. Bei der Mischfuttermittelproduktion ergibt sich eine vielschichtige Zusammensetzung verschiedener landwirtschaftlicher Erzeugnisse von Getreidearten, Mais, Futtererbsen, Ölsaaten u. a.. Gerade in den Mastbetrieben stellt die notwendige Eiweißversorgung in der Fütterung, welches hauptsächlich über Soja erfolgt und 30 bis 50 Prozent der Futterration ausmacht. Der bisherige Anbau von Soja in Deutschland beträgt ca Hektar und ist noch im Versuchsstadium. Eine regionale Versorgung mit Soja ist zurzeit nicht möglich. Außerdem ist die Anzahl der Futtermittelhersteller für Nutztiere mit (2008) Unternehmen in Deutschland begrenzt. Andererseits wird durch die Einbeziehung der Futtermittel in ein Regionalsystem die Kreislaufwirtschaft auf Betrieben gestärkt. Problematisch kann es in einzelnen Regionen werden. In Deutschland gibt es beispielsweise ein starkes Ost-West- Gefälle. Beträgt die Herstellung von Mischfutter für Rinder und Kälber (Juli 2010 bis August 2011) in den westlichen Bundesländern Tonnen, waren es im Osten nur Tonnen 18. Die monetär bemessene Vorleistung der Landwirtschaft beim Futtermittelkauf gibt für die innerbetrieblich erzeugten Futtermittel in Deutschland über sechs Millionen Euro an. Ebenso für den Zukauf bei der Futtermittelindustrie. Es ist fraglich, ob die zugekauften Futtermittel ohne Statistisches Bundesamt, BMELV: Unternehmenskonzentration im Produzierenden Ernährungsgewerbe (Tabelle) BLE: Herstellung von Mischfutter (Tabelle) FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 39

40 Weiteres durch ein regionales Angebot ersetzt werden können. Mit 66 Millionen Euro 19 ist der Anteil der bei anderen landwirtschaftlichen Betrieben zugekauften Futtermittel äußerst gering. Komplexer wird es bei der Betrachtung der Schweineproduktion bzw. bei der Fleischverarbeitung. Speziell in der Schweinehaltung hat sich der Trend zur arbeitsteiligen Produktion, also Aufteilung der einzelnen Produktionsschritte auf eine Reihe von Betrieben, in den letzten Jahren verstärkt. Wobei es natürlich immer noch den klassischen geschlossenen Betrieb mit eigener Ferkelaufzucht und anschließender Mast gibt. Es existieren aber auch lose Betriebskooperationen, bei denen die Stufe der Jungsauenvermehrung, der Deckbetrieb der Zuchtsauen, der Wartebetrieb, der Abferkelbetrieb, der Babyferkelaufzuchtbetrieb und der Mastbetrieb jeweils als eigenständige landwirtschaftliche Betriebe geführt werden. In der Praxis existieren auch Lieferbeziehungen von Schweinemastbetrieben zu Babyferkelaufzuchtbetrieben, die von einer Vielzahl von Ferkellieferanten bestückt werden. Des Weiteren muss beachtet werden, dass selbst kleinere familiengeführte Schweinemastbetriebe in der Regel im Rein-Raus-System wirtschaften und deshalb nicht kontinuierlich schlachtreife Schweine abgeben können, sodass unter Umständen der Schlachtbetrieb auf eine Vielzahl von Schweinelieferanten zurückgreifen muss. Abbildung 11: Wertschöpfungskette in der Schweinemast Verarbeitungs- und Vermarktungsstufe Bei der Herstellung von Brot aus Weizenmehl (siehe Abbildung 10) spielt insbesondere die Sicherung der Warenströme bei der Erfassung sowie in der Verarbeitungs- und Vermarktungsstufe eine wichtige Rolle. Hier ist der Aufwand groß, um regionale Waren getrennt zu behandeln. Die zunehmende Unternehmenskonzentration verstärkt diesen Effekt. Besonders deutlich wird die Komplexität der möglichen Warenströme auch bei der Betrachtung der milchverarbeitenden Industrie in Abbildung 12. Je größer der Rohstoffeinsatz und je vielfältiger die Wege der Rohstoffbeschaffung umso schwieriger wird es, ein regional 19 BMELV: Vorleistungen für die Landwirtschaft (Tabelle) FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 40

41 nachvollziehbares Produkt herzustellen. Dabei werden in Deutschland mehr als zwei Drittel der verfügbaren Milchmenge durch 28 Unternehmen mit mehr als Tonnen Milchverarbeitung im Jahr bearbeitet 20. Abbildung 12: Schematische Darstellung der milchwirtschaftlichen Unternehmensstruktur in Deutschland (nach Wolter, Reinhard, S. 19) 4.4 Produktion- und naturbedingte Faktoren Einfluss auf die Kriteriengestaltung haben neben der Betrachtung der Produktionstiefe und des Rohstoffanteils aus der Region auch produktions- und naturbedingte Faktoren. In der pflanzlichen Erzeugung, zum Beispiel von Weizen, können es vor allem naturbedingte Faktoren sein wie Ernteausfälle oder Qualitätsverluste aufgrund von Trockenheit, Nässe, Kälte, Hagel, extremer Krankheitsdruck oder Schädlingsbefall. In der tierischen Erzeugung von beispielsweise Molkereiprodukten können naturbedingte Faktoren wie Tierkrankheiten und -seuchen oder alternierende Stallhaltungssysteme dazu führen, dass die Verfügbarkeit von regionalen Rohstoffen eingeschränkt ist oder Qualitäten nicht ausreichen und Ausnahmeregelungen geschaffen werden müssen. In der Weiterverarbeitung von tierischen und pflanzlichen Erzeugnissen können Randlagen von Betrieben und fehlende Lieferstrukturen oder fehlende Verarbeitungsunternehmen in der Wertschöpfungskette ein Hindernis sein, welches nach Ausnahmeregelungen verlangt. 20 Wolter, Reinhard, Die Unternehmensstruktur der Molkereiwirtschaft in Deutschland. Bonn: Bundesministerium für Ernährung, Landwirtschaft und Verbraucherschutz (Hrsg.). S. 18 FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 41

42 Zusammenfassung Produktionstiefe Der Strukturwandel, sowohl in der Landwirtschaft als auch in der Lebensmittelverarbeitung, hat dazu beigetragen, dass die Anzahl der Betriebe deutlich abgenommen hat und in der Regel keine flächendeckende Verfügbarkeit mehr gegeben ist. Besonders in der Landwirtschaft haben sich die Betriebe zum Teil sehr stark spezialisiert und eine arbeitsteilige Produktion aufgebaut. Dies muss bei der Betrachtung der Produktionstiefe sowohl auf der Stufe der Landwirtschaft als auch im Bereich der Verarbeitung beachtet werden. Die Einbindung aller Produktionsstufen bis hin zu den Vorstufen der Landwirtschaft ist theoretisch möglich, praktisch aber bei einer Vielzahl von Produkten in kleinräumigen Regionen nicht umsetzbar. Monoprodukte lassen sich, mit wenigen Ausnahmen, zu 100 Prozent aus regionalen Rohstoffen darstellen. Bei zusammengesetzten Produkten, die aus einer Vielzahl an Zutaten bestehen, ist in der Regel eines hundertprozentigen Rohstoffbezugs aus der Region nicht umsetzbar. Eine Definition der Mindestanteile aus der Region ist notwendig. Hierbei kann man Bezug nehmen zur Hauptzutat oder zu einem prozentualen Anteil an der Gesamtmasse oder einen Bezug sowohl zur Hauptzutat als auch zur Gesamtmasse. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 42

43 5 Einbindung weiterer Zusatzkriterien 5.1 Bedeutung von Zusatzkriterien bei bestehenden Systemen Die geografischen Herkunftsangaben lassen sich in drei Kategorien einteilen. Bei der einfachen Herkunftsangabe steht alleine nur die Herkunft im Vordergrund wie z. B. made in Germany. Bei der kombinierten Herkunftsangabe wird die Herkunftsangabe mit einer Qualitätsaussage verbunden, wie dies z. B. bei den Länderzeichen Geprüfte Qualität - HESSEN oder Gesicherte Qualität - Baden-Württemberg der Fall ist. Bei der letzten Art der Herkunftsangabe, der sogenannten qualifizierten Herkunftsangabe, steht die Herkunft für eine bestimmte Qualität, wie es zum Beispiel bei den geschützten geografischen Angaben (g.g.a.) wie etwa dem Schwarzwälder Schinken der Fall ist (vgl. Becker 2002). Bei einer Reihe von Regionalinitiativen bzw. Regionalsiegeln werden neben den Anforderungen zur Herkunft auch Vorgaben für weitergehende zusätzliche Kriterien gefordert. Bei den von der Europäischen Union (EU) notifizierten Qualitäts- und Herkunftszeichen der Länder werden in der Regel produktbezogene Qualitätsstandards vorgeschrieben, die über das gesetzlich vorgeschriebene Niveau hinausgehen. Dies ist vor allem in der Forderung der EU begründet, dass aus wettbewerbsrechtlichen Gründen keine reinen Herkunftszeichen mit staatlichen Mitteln unterstützt werden dürfen. Hintergrund hierzu ist, dass eine rein herkunftsbezogene Werbung für Lebensmittel den freien Warenverkehr innerhalb des europäischen Binnenmarktes stört. Bei den eher kleinräumig orientierten Regionalinitiativen, bei denen eine nachhaltige Regionalentwicklung und Umwelt- und Naturschutzanliegen im Fokus stehen, sind in der Regel auch eine Reihe von zusätzlichen Kriterien im Regelwerk verankert Erwartungen der Verbraucher Betrachtet man die Ergebnisse von Verbraucherbefragungen, so werden sehr häufig Argumente wie Frische und kurze Transportwege als Kaufargumente für regionale Produkte genannt. Aber auch viele weitere Gesichtspunkten erwartet der Verbraucher von Lebensmitteln aus der Region. Die folgende Auflistung gibt einen kleinen Überblick über die Verbrauchererwartungen: Tabelle 15: Überblick Verbrauchererwartungen Studie Jahr Stichprobe Ergebnisse Vzbv - Kennzeichnung von regionalen Lebensmitteln / Forsa-Umfrage im Auftrag des BMELV zur biologischen Vielfalt, BMELV keine Angabe Regionalität = Herstellung der Rohstoffe und Verarbeitung; zusätzliche Produktqualitäten: mehr Frische, ohne Gentechnik, Ökoqualität, artgerechte Tierhaltung Stockebrand und Spiller 2009 n=261 Distanz zwischen Erzeugung/Herstellung und Einkaufsort; Assoziationen: kurze Transportwege und Frische; Verbindung von ökologischem Landbau mit regionalen LM; Förderung der heimischen Wirtschaft FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 43

44 Banik und Simons 2008 n=632 Aspekte, die in Zusammenhang mit regionalen Lebensmitteln gebracht werden: Unterstützung der Landwirtschaft, Umweltschonung, Produktfrische Nur ein kleiner Teil der Befragten gaben weniger Skandale besser für die Gesundheit und artgerechte Tierhaltung als Kriterien an. Verbraucherumfrage des Saarländlich-Team 2008 n=50 Regionaltypische Rezeptur: 44 % Herstellung in der genannten Region: 80 % Herstellung der Zutaten in der Region: 74 % Weiterverarbeitung und Herstellung des Endprodukts in der Region: 70 % Vermarktung in der Region: 56 % Eigenschaften regionaler Lebensmittel: nach besonderen Kriterien bezüglich Tierschutz und Pestizideinsatz hergestellt: 80 % Gentechnikfrei: 92 % nach biologischen Richtlinien hergestellt: 70 % Leitow 2005 n=440 Gründe für den Kauf regionaler Produkte: Geschmack (68,8 %) Frische (55,8 %) Profeta 2005 n=1.070 Befragung von Rindfleischkäufern Profeta 2005 n=994 Befragung von Bierkäufern Härlen, Simons und Vierboom 2004 n=50; Einzelinterviews und Gruppendiskussionen Folgenden Aussagen stimmen die Befragten voll und ganz zu: Kauf regionaler Lebensmittel um die heimische Wirtschaft zu unterstützen (47,04 %); regionale Produkte sind meistens frischer (38,53 %); regionale Produkte sind umweltschonender (26,17 %); mehr Vertrauen zu regionalen Produkten (31,7 %) Folgenden Aussagen stimmen die Befragten voll und ganz zu: Kauf regionaler Lebensmittel um die heimische Wirtschaft zu unterstützen (34,25 %); regionale Produkte sind meistens frischer (28,79 %); regionale Produkte sind umweltschonender (17,85 %); mehr Vertrauen zu regionalen Produkten (20,33 %) Assoziation mit Regionalität: Frische und artgerechte Tierhaltung (kurze Transportwege); regionale Kennzeichnung als Qualitätsindikator ZMP 2002 n=3.000 Gründe für den Kauf von Produkten aus der eigenen Region: kürzere Transportwege, Unterstützung der heimischen Landwirtschaft, frischere Produkte, Spezialität der eigenen Region, besserer Geschmack, bessere Qualität, strenge gesetzliche Vorschriften, natürliche umweltschonende Produktion, gesündere Produkte Zusammenfassung Hauptargumente für den Kauf von regionalen Produkten beim Verbraucher sind die Frische der Produkte und die kurzen Transportwege. Die Unterstützung der heimischen Landwirtschaft und das Argument, dass die Rohstoffe aus der Region kommen, sind weitere wichtige Punkte. Der Verbraucher verbindet mit regionalen Produkten oftmals Eigenschaften wie natürlich produziert oder geringe Schadstoffbelastung. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 44

45 5.2 Auflistung verschiedener Zusatzkriterien Bio-Siegel Rechtliche Grundlage Rechtsgrundlage für das Bio-Siegel ist das deutsche Öko-Kennzeichengesetz und die Öko- Kennzeichnungsverordnung vom Die Kriterien für die Vergabe nehmen Bezug auf die EG-Verordnung Nr. 834/2007 und deren Durchführungsvorschriften. Produkte und Erzeugnisse, die mit dem Bio-Siegel gekennzeichnet werden, müssen diesen Vorschriften entsprechen. Die Verwendung schreibt eine einmalige Anzeigepflicht für jedes Produkt vor. Der Nachweis der Einhaltung der EG-Verordnung erfolgt über den Zertifizierungsnachweis. Inhaltliche Bedeutung Die Markensatzung des Bio-Siegels lässt es zu, dass zusätzlich zum Bio-Siegel eine Herkunftsauslobung möglich ist. Einige Regionen, wie z. B. die Rhön, haben diese Möglichkeit genutzt und das Bio-Siegel mit einer Herkunftsangabe versehen. Abbildung 13: Logo Biosiegel Rhön Durch die Nutzung des Bio-Siegels mit Herkunftsangabe hat man den Vorteil genutzt, dass das Bio-Siegel einen Bekanntheitsgrad von knapp 90 Prozent (vgl. Buxel 2010) hat und man somit keine hohen werblichen Maßnahmen zur Bekanntmachung aufwenden musste. Durch das neue verpflichtende EU-Bio-Logo kann man allerdings davon ausgehen, dass das deutsche Bio- Siegel an Bedeutung verlieren wird und die Zeichennutzer sich über eine neue Kommunikationsstrategie Gedanken machen müssen. Der Entstehungsweg war allerdings der, dass man ausgehend von einer Produktion nach den Richtlinien des ökologischen Landbau eine zusätzliche Auslobung der Herkunft als ein ergänzendes Kaufargument bewertet hat und nicht, dass eine Regionalinitiative ausgehend von dem regionalen Gedanken entschieden hat, die gesamte Wertschöpfungskette auf Bio- Produktion umzustellen. Da Regionalität auch für Natürlichkeit steht, braucht die Regionalität nicht zwingend die Ergänzung Bio (vgl. Banik und Simons 2007). Eine Verbraucherbefragung in Bayern aus dem Jahr 2001 bestätigt, dass bei Bioprodukten die regionale Herkunft nicht das zentrale Kaufargument ist, aber als abgerundetes Argument, das die Öko-Kompetenz des Anbieters unterstreicht, angesehen wird (vgl. Schaer 2000). Die Bedeutung der Verknüpfung von Bio und Regional hat in den letzten Jahren deutlich zugenommen. Dies liegt sicherlich zum einen in dem allgemeinen Trend zu regionalen FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 45

46 Produkten und zum anderen an der gestiegenen Nachfrage und somit an dem gestiegenen Angebot von Biolebensmitteln mit der Konsequenz, dass vermehrt überregionale Strukturen sowohl in der Erzeugung als auch in der Verarbeitung entstanden sind. Die Bezeichnung Regional hat in den letzten Jahren immer mehr an Bedeutung gewonnen und liegt beim Verbraucher laut DLG-Studie 2011 derzeit oftmals höher als Bio. Zusammenfassung Bioprodukte profitieren von der Herkunftsauslobung, Regionalprodukte brauchen nicht unbedingt Bio Tierschutz Rechtliche Grundlage Neben den gesetzlichen Regelungen zur Tierhaltung im Allgemeinen existiert zurzeit kein staatliches Kennzeichnungssystem, welches freiwillige Bemühungen in Bezug auf den Tierschutz berücksichtigt, die über das gesetzliche Niveau hinausgehen. Der wissenschaftliche Beirat des Bundesministeriums für Ernährung, Landwirtschaft und Verbraucherschutz hat sich im März 2011 für die Einführung einer staatlichen Tierschutzkennzeichnung ausgesprochen (Kurzstellungnahme zur Einführung eines Tierschutzlabels in Deutschland, März 2011). Empfohlen wird ein mehrstufiges System, ähnlich dem Sternesystem der Hotelklassifizierung, bei dem Anreize für eine beständige Weiterentwicklung einer tiergerechten Haltung gegeben werden. Dabei soll die gesamte Prozesskette von der Genetik über die Aufzucht bis hin zur Schlachtung eingebunden werden. Aus Verbrauchersicht spielt das Thema Tierwohl eine immer größere Rolle und nimmt zunehmend Einfluss auf das Verbraucherverhalten (siehe auch Zwischenbericht zur Charta für Landwirtschaft und Verbraucher - Thema Tierhaltung vom unter In einigen europäischen Ländern gibt es bereits verschiedene Ansätze: In Dänemark Good farming practice, in den Niederlanden Beter leven und in Großbritannien Animal welfare. Abbildung 14: Logo Beter Leven Seit Januar 2011 bietet Westfleisch auf dem deutschen Markt mit der Aktion Tierwohl ein System für Handels- und Industriekunden an. Kriterien sind hier die Haltungsbedingungen im Stall, der Freilauf der Muttertiere in Gruppenhaltung, der tierärztliche Gesundheitsplan, die Wasserversorgung und Fütterung sowie Transportzeiten. Fleisch und Wurstwaren, bei deren FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 46

47 Produktion die vorgegebenen Kriterien eingehalten wurden, können mit dem Label Aktion Tierwohl gekennzeichnet werden. Abbildung 15: Logo Aktion Tierwohl Die Initiativgruppe Tierwohl-Label, zu der die Universität Göttingen und die Universität Kassel, der Deutsche Tierschutzbund und der Verein Neuland gehören, entwickelt zurzeit ein Gütesiegel für Fleisch aus besonders tiergerechter Haltung, für welches Anfang 2012 erste verbindliche Standards veröffentlicht werden sollen. Schwerpunkt soll hierbei zum Beispiel für die Mastschweinehaltung der Platzbedarf im Stall, der Verzicht auf das Kupieren der Schwänze sowie die Ferkelkastration ohne Betäubung und weitere Maßnahmen zur Reduzierung der Sterblichkeits- bzw. Verletzungsrate sein. Da sich eine Reihe von Initiativen mit dem Thema Tierschutz beschäftigen, ist ein freiwilliger, von der Wirtschaft getragener, einheitlicher Kriterienkatalog derzeit nicht absehbar. Dies erschwert eine Einbindung in eine Regionalkennzeichnung. Zusammenfassung Aus Verbrauchersicht spielt das Thema Tierschutz eine Rolle. Eine Einbindung als Zusatzkriterium ist derzeit schwierig, da keine staatliche Regelung existiert Nachhaltigkeitskriterien Der Ursprung der Definition der Nachhaltigkeit kommt aus der Forstwirtschaft. Der Begriff selbst wird auf eine Veröffentlichung von Hans Carl von Carlowitz aus dem Jahr 1713 zurückgeführt, in der von einer nachhaltigen Nutzung der Wälder geschrieben wird (vgl. Wikipedia 2011). Eine einheitliche Definition von Nachhaltigkeit existiert leider nicht wurde für eine nachhaltige Entwicklung das Drei-Säulen-Modell entwickelt. Die drei Säulen Ökologie, Ökonomie und Soziale Ziele sollen gleichberechtigt und gleichwertig zueinanderstehen. Rechtliche Grundlage Bisher existiert noch kein Siegel, das alle Kriterien der Nachhaltigkeit berücksichtigt. Es werden in der Regel immer nur Teilbereiche (eine von drei Säulen) betrachtet. Für den Bereich der Ökologie bzw. Umwelt kommen zuerst die Zeichen und Systeme aus dem ökologischen Landbau infrage. Aber auch die Ohne Gentechnik -Kennzeichnung bzw. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 47

48 Regionalsiegel betrachten Teilaspekte der Nachhaltigkeit. Für den Bereich der sozialen Ziele kommen Systeme für faire Produkte in Betracht, die in einem späteren Abschnitt noch einmal genauer erläutert werden. Inhaltliche Bedeutung Nachhaltigkeit im Allgemeinen Im Bereich des Lebensmittelmarketings wird der Begriff Nachhaltigkeit sehr vielfältig verwendet. Aber längst nicht alle Verbraucher können mit dem Begriff Nachhaltigkeit etwas anfangen. Nach einer Umfrage des Instituts für Demoskopie, Allensbach aus dem Jahr 2007 haben 33 Prozent der Verbraucher den Begriff Nachhaltigkeit noch nie gehört. 45 Prozent der Befragten haben den Begriff zwar schon einmal gehört, können aber inhaltlich nichts mit dem Begriff anfangen. Die Verbraucher, die mit dem Begriff etwas verbinden können, haben allerdings unterschiedliche Vorstellungen davon, sodass als Ergebnis festzuhalten ist, dass die Verbraucher im Allgemeinen kein klares Bild vom Begriff der Nachhaltigkeit haben (vgl. Nestlé Deutschland AG 2011). Klimaschutz/Product Carbon Footprint (PCF) Im Bereich des Klimaschutzes wird oft der Hinweis auf Klimalabels wie den Product Carbon Footprint (PCF) gegeben. Zurzeit existiert jedoch auch hier keine verbindliche Berechnungsgrundlage, die von der gesamten Wirtschaft anerkannt wird. Die Kennzeichnung von PCF-Angaben wird nur von einem Teil der Verbraucher verstanden. Dies war Ergebnis zweier Verbraucher-Befragungen aus den Jahren 2009 und Hiernach halten 56 Prozent bzw. 66 Prozent der Verbraucher eine PCF-Angabe für sinnvoll, aber 35 Prozent bzw. 54 Prozent zweifeln an der Umsetzbarkeit. Die Verbraucher scheinen die Berechnung des PCF nicht zu verstehen. Daraus lässt sich schließen, dass eine einheitliche Berechnung und klare Kommunikation erforderlich ist, damit das Konzept des PCF als Unterscheidungsmerkmal genutzt werden kann. (vgl. Schlich und Schlich 2010). Die Klimabilanzen von regionalen Lebensmitteln im Vergleich zu einer überregionalen Produktion werden zurzeit vielfältig diskutiert. Bei gleichen Produktionsbedingungen von regionalen und überregionalen Wertschöpfungsketten schneiden die regional erzeugten Lebensmittel aufgrund der kürzeren Transportwege bei der Klimabilanz deutlich besser ab. Gleiche Produktionsbedingungen sind allerdings in der Realität häufig nicht gegeben, sodass z. B. ein Brot, welches mit überregionalem Getreide in einer modernen energieeffizienten Industriebäckerei produziert wurde, eine bessere Klimabilanz aufweist als ein Brot, welches mit regionalem Getreide in einer Kleinbäckerei produziert wurde. Des Weiteren wirft dieses Thema natürlich die Diskussion von Produkten mit einem hohen CO 2 -Verbrauch, wie etwa Fleisch, auf (vgl. Reinhardt, Gärtner, Münch und Häfele 2009). Zusammenfassung Nachhaltigkeit im Allgemeinen ist für den Verbraucher noch kein klarer Begriff. Für Klimalabels wie den PCF existieren bislang keine einheitlichen Berechnungsstandards und der Verbraucher kann inhaltlich noch nicht viel damit anfangen. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 48

49 5.2.4 Soziale Kriterien/Fair-Zertifizierung Soziale Kriterien in der Lebensmittelproduktion sind die dritte Säule der Nachhaltigkeit. Gegenüber dem Verbraucher wird dies in der Regel mit dem Begriff fair versucht zu verdeutlichen. Seit vielen Jahren wird unter dem Fairtrade-Gütesiegel ein Angebot von Produkten aus Entwicklungsländer bereitgestellt, das Erzeugerpreise oberhalb des Weltmarktpreises gewährleistet. Abbildung 16: Logo Fairtrade International Seit einigen Jahren wird das System der fairen Preise auch auf heimische Produkte übertragen. Dies begründet sich vor allem auf die sehr volatilen Rohstoffmärkte für Agrargüter, wo es in den letzten Jahren vorkam, dass die Erzeugerpreise die Produktionskosten bei Weitem nicht mehr gedeckt haben. Rechtliche Grundlage Eine rechtliche Grundlage zu sozialen Kriterien bzw. einer Fair-Zertifizierung gibt es zurzeit nicht. Es existieren aber eine Reihe von Aktivitäten, die sich selbst einen Rahmen gesetzt haben Beispiel: fair & regional. Bio Berlin-Brandenburg Abbildung 17: Logo fair & regional. Bio Berlin-Brandenburg Bio Berlin-Brandenburg Charta, Stand: Die allgemeinen Ziele werden hier wie folgt definiert: Gemeinsame Weiterentwicklung einer sozialen und umweltverträglichen Biobranche in der Region Berlin-Brandenburg. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 49

50 Fairer Umgang aller Beteiligten entlang der Wertschöpfungskette. Gemeinsames und gerechtes Wirtschaften zur Sicherung einer nachhaltigen Entwicklung. Preis muss so sein, dass er dem Erzeuger eine angemessene Lebenshaltung ermöglicht. Die Kriterien lassen sich wie folgt zusammenfassen: Verbindliche Abnahme- und Lieferverträge der Partner entlang der Wertschöpfungskette über einen längerfristigen Zeitraum. Entwicklung und Umsetzung von gemeinsamen Anbau-, Mengen- und Produktentwicklungsplänen für alle Beteiligten durch gemeinsame Gesprächsrunden. Verbindliche Absprachen über zu zahlende Preise in gemeinsamen Gesprächsrunden. Einvernehmliche Vereinbarung von angemessenen und produktspezifischen Zahlungszielen. Alle Teilnehmer erklären sich bereit, Vertragspartner oder andere Lizenznehmer der fair & regional-charta in betrieblichen und wirtschaftlichen Notsituationen entsprechend eigener Möglichkeiten zu unterstützen. Soziale Kriterien: In den Betrieben dürfen nur sozialversicherungspflichtige Beschäftigungsverhältnisse angeboten werden, regelmäßige Weiterbildung aller Mitarbeiter; Förderung der Übermittlung ökologischer Themen und Inhalte, gesellschaftliche/soziale Projekte entweder selber zu initiieren oder persönlich bzw. mit Spenden oder Sachleistungen zu unterstützen, für die Wissens- und Erfahrungsvermittlung des ökologischen Gedankens geeignete Maßnahmen zu ergreifen. Umweltmanagement: Mitglieder sind verpflichtet, das Ziel eines aktiven Umweltschutzes in ihrer Produktion und in ihren Betrieben zu verfolgen und Umweltaktivitäten ihres Betriebes zu veröffentlichen; Reduktion von Verpackungsmaterialien bzw. Verwendung umweltgerechter Verpackungsmaterialien, Unterstützung und Verwendung erneuerbarer Energien. Transparenz und Kommunikation: umfassende Kommunikation mit den Verbrauchern, Möglichkeit für Verbraucher die Arbeit und Produktion vor Ort kennenzulernen. Anforderungen an die Handelsstufen: Handel verpflichtet sich, die Produkte bei ausreichender Qualität und fairen marktüblichen Preisen zu listen und aktiv zu unterstützen. Unterstützung: hervorgehobene Platzierung und kommunikative Unterstützung. Herkunftsbestimmungen: Anbau von pflanzlichen Produkten zu 100 Prozent in der Region Berlin-Brandenburg, bis 20 Prozent der Hauptzutat eines verarbeiteten Produktes können von außerhalb stammen, wenn nicht in ausreichender Menge in der Region verfügbar, Verarbeitungsstätten für Veredelung müssen in der Region liegen, Tiere müssen spätestens ab dem Alter von sechs Wochen (einer Woche bei Geflügel) in der Region gehalten werden. Bei Verarbeitungsprodukten müssen die jeweiligen Agrarrohprodukte in der Region erzeugt worden sein, übrige Zutaten auch aus anderen Regionen, wenn sie den Anforderungen für Bioware entsprechen. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 50

51 Beispiel: Naturland Fair Abbildung 18: Logo Naturland Fair Naturland Fair Richtlinien Ökologischer Anbau, sozialer Umgang im Miteinander und faire Handelsbeziehungen sind die entscheidenden drei Säulen der Nachhaltigkeit. Sozialer Umgang mit Menschen, die auf den Betrieben leben und arbeiten. Förderung der weltweiten ökologischen Erzeugung und gesellschaftliche Anerkennung des Ökolandbaus, dadurch Beitrag zum Schutz der Umwelt, zur nachhaltigen Nutzung der Ressourcen, zur Ernährungssicherung und zur Verbesserung der Lebensgrundlage der Menschen. Produkt kann als fair bezeichnet werden, sobald der Anteil der Rohstoffe aus fairen Handelsbeziehungen über 50 Prozent (Trockengewicht) im Produkt beträgt und die übrigen Rohstoffe nachweislich nicht in Fair Qualität verfügbar sind. Ziel ist es, das ganze Unternehmen auf Fair umzustellen. Voraussetzung für Unternehmenszertifizierung: mindestens 70 Prozent der Produkte, welche den Hauptumsatz des Unternehmens ausmachen, nach den Richtlinien erzeugt, verarbeitet bzw. gehandelt und der Rest nicht in Fair Qualität verfügbar. Soziale Verantwortung: sozialer Umgang mit Menschen, die auf den Betrieben leben und arbeiten. Verlässliche Handelsbeziehungen: langfristige partnerschaftliche Zusammenarbeit, dadurch mehr Planbarkeit, Sicherheit und Stabilität. Vorfinanzierung: Vorfinanzierung für die Ernten in wirtschaftlich benachteiligten Regionen. Faire Erzeugerpreise: Erhaltung der Existenzgrundlage der Erzeuger durch Abdeckung der in der Region üblichen Produktionskosten und angemessener Gewinn für Zukunftsinvestitionen. Partnerschaftliche Preisfindung: mindestens oberes Drittel der marktüblichen Durchschnittspreise (gleitender Drei-Jahres-Durchschnitt). Faire Mindestpreise: Existiert ein Mindestpreis der FLO, wird mindestens dieser gezahlt, liegt der Marktpreis höher, dann dieser. Faire Prämien: Prämien für Produkte aus wirtschaftlich benachteiligten Regionen, diese dienen ausschließlich der Finanzierung von Sozial-, Bildungs-, Gesundheits- und Umweltprojekten oder als zusätzliche Einnahme für Kleinbauern. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 51

52 Regionaler Rohstoffbezug: Lokale Produktion zur Ernährung der Bevölkerung und eine regionale Vermarktung haben Vorrang. Gemeinschaftliche Qualitätssicherung: Maßnahmen zur Qualitätssicherung werden zwischen Abnehmer und Erzeuger(n) der landwirtschaftlichen Erzeugnisse partnerschaftlich aufeinander abgestimmt. Gesellschaftliches Engagement: Überdurchschnittliches gesellschaftliches Engagement und/oder Förderung von Projekten, Engagement z. B. im praktischen Umweltschutz, bei gemeinnützigen Vereinen und/oder unterstützen Umwelt-, Gesundheits- oder Bildungsprojekte, soziale Projekte oder kulturelle Initiativen und/oder fördern bzw. unterstützen bäuerliche Landwirtschaft; Bevorzugung von Waren von Kleinbauern. Unternehmensstrategie und Transparenz: Die Unternehmen legen fest, wie die Richtlinien umgesetzt werden sollen, Beschäftigte, Mitglieder und Erzeuger sollen in Entscheidungsprozesse eingebunden werden Beispiel: Die faire Milch Die faire Milch ist angetreten, den Milcherzeugern einen auskömmlichen Milchpreis zu gewährleisten. Neben der Regionalität wird auch eine gentechnikfreie Fütterung (entsprechend den Vorgaben des BMELV Logo Ohne Gentechnik) umgesetzt. Abbildung 19: Die faire Milch Verbraucherschützer und die Wettbewerbszentrale kratzen am Image des vom Bundesverband Deutscher Milchviehalter BDM konzipierten Produkts. Sie sei weniger regional als behauptet und nicht fair erzeugt. Die Wettbewerbszentrale hatte Klage gegen den Namen Die faire Milch vor dem Landgericht Landshut eingereicht. Die faire Milch erwecke den Eindruck, sie sei die einzige fair erzeugte Milch. Die Verbraucherzentrale Baden-Württemberg hatte Angaben, die Milch stamme aus Ihrer Region und die heimische Produktion spart unnötige Transportwege, gerügt. Dies träfe nicht zu, so Verbraucherschützer Eckhard Benner, die Milch der MVS, die in Stuttgart verkauft wird, stamme nicht aus der Region, sondern von Höfen aus dem Allgäu, sagt Benner, zur Abfüllung werde sie zudem ins osthessische Schlüchtern transportiert. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 52

53 Das Landgericht Landshut hat mit Urteil vom , Az. 1 HK O 1426/10 der Milchvermarktungsgesellschaft verboten, mit der Bezeichnung Die faire Milch zu werben. Daneben darf auch die Aussage kommt ausschließlich von Höfen aus Ihrem Bundesland nicht weiter verwendet werden (Börnecke 2010). Die MVS Milchvermarktungsgesellschaft ging in Berufung. Das Verfahren läuft zurzeit noch, bis zum Berufungsurteil muss nichts an der Auslobung der fairen Milch geändert werden (Niedermaier 2011). Zusammenfassung Die Verbindung von Regionalität und einem fairen Preis für die Erzeuger, aber auch für die Verarbeitungsunternehmen, gewinnt an Bedeutung. Einen rechtlichen Rahmen gibt es nicht, aber eine Reihe von privaten Initiativen. Am Beispiel der fairen Milch wird deutlich, dass der Begriff fair rechtliche Risiken birgt Ohne Gentechnik Abbildung 20: Logo Ohne Gentechnik Rechtliche Grundlage Seit dem besteht in der gesamten EU eine Kennzeichnungspflicht für alle Lebensmittel und Futtermittel, die gentechnisch veränderte Bestandteile enthalten, aus ihnen hergestellt wurden oder aus ihnen bestehen. Keine Kennzeichnungspflicht besteht hingegen für Produkte von Tieren, die mit gentechnisch veränderten Futtermitteln gefüttert wurden. Um dem Wunsch der Verbraucher und Hersteller gerecht zu werden, eine Auslobung mit dem Zusatz Ohne Gentechnik zu ermöglichen, regelt seit dem eine Vorschrift und damit verbunden eine Nachweispflicht die Verwendung dieses einheitlichen Zeichens. Die Maßstäbe für die Verwendung sind sehr eng gefasst und umfassen bei pflanzlichen Lebensmitteln: Bestandteile aus gentechnisch veränderten Pflanzen sind nicht erlaubt. Nachweisbare zufällige oder technisch unvermeidbare GVO-Beimischungen werden nicht toleriert. Lebensmittelzusatzstoffe, Vitamine, Aminosäuren, Aromen oder Enzyme, die mit Hilfe von gentechnisch veränderten Mikroorganismen hergestellt werden, dürfen in der Verarbeitung nicht verwendet werden. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 53

54 Für tierische Lebensmittel gilt zusätzlich: Bei der Fütterung der Tiere wurden keine als genetisch veränderte (gv) gekennzeichneten Futtermittel verwendet. Eine Ausnahme von der Kennzeichnungspflicht besteht nur für zufällige oder technisch unvermeidbare Verunreinigungen unter 0,9 Prozent. Futtermittelzusatzstoffe, die von gentechnisch veränderten Mikroorganismen produziert werden, sind nur zulässig, wenn sie nicht als gentechnisch verändert zu kennzeichnen sind. Es sind tierartspezifische Mindestfütterungszeiten vorgeschrieben, ab denen keine gentechnisch veränderten Futterpflanzen mehr verfüttert werden dürfen. Die Anwendung von Tierarzneimitteln oder Impfstoffen aus gentechnischer Herstellung ist zulässig. Die Nutzung des Zeichens kann jeder beantragen, der die Anforderungen des EG-Gentechnik- Durchführungsgesetzes (EGGentDurchfG) erfüllt und einen Lizenzvertrag mit dem privaten Zeicheninhaber, dem VLOG - Verein Lebensmittel ohne Gentechnik, abschließt. Zurzeit gibt es ca. 100 Zeichennutzer. Inhaltliche Bedeutung Die Auslobung des Zeichens Ohne Gentechnik kommt vor allen für tierische Lebensmittel infrage. Dies wird auch durch die derzeitigen Zeichennutzer deutlich. Bis auf wenige Ausnahmen tragen vor allem Eier, Milchprodukte und einige Fleischprodukte das Ohne Gentechnik -Logo. Eine kombinierte Auslobung der Regionalität ist möglich und wird bereits praktiziert. Zusammenfassung Zusatzkriterien Aufgrund der Tatsache, dass es eine gesetzliche Regelung und ein verbindliches Logo gibt, ist eine kombinierte Auslobung im Zusammenhang mit der Regionalität möglich. Bei zwei der hier aufgezeigten Zusatzkriterien existieren gesetzliche Vorgaben, wie die EG- Öko-Verordnung und die Ohne Gentechnik -Kennzeichnung. Das erleichtert eine inhaltliche Einbindung als zusätzliches Kriterium für eine Regionalkennzeichnung. Bei einer Vielzahl von weiteren Möglichkeiten existieren keine gesetzlichen Vorgaben, sondern privatwirtschaftliche Lösungen, die in der Regel keine bedeutende Marktdurchdringung haben. Für die Einbindung solcher Kriterien sollten verbindliche Vorgaben definiert werden, damit man nicht Gefahr läuft, an Glaubwürdigkeit zu verlieren. Da der Verbraucher mit regionalen Produkten sehr oft auch Eigenschaften wie natürlich produziert oder geringe Schadstoffbelastung verbindet, müsste man der Fragestellung nachgehen, inwieweit der Verbraucher bereit ist, für regionale Produkte mit weiteren zusätzlichen Kriterien mehr Geld auszugeben, denn jedes weitere Kriterium verursacht weitere Kosten, die letztendlich der Erzeuger zu tragen hat. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 54

55 6 Realisierungsmodalitäten eines freiwilligen Regionalsiegels 6.1 Ausgangslage Unter einem regionalen Lebensmittel versteht man zunächst jedes Lebensmittel, dessen Werbung oder dessen Art der Kennzeichnung, Aussagen zu dessen regionalen Herkunft tätigt und dadurch einen Bezug zu einem bestimmten Ort, einer bestimmten Region, einer Landschaft oder einem Land herstellt. Bevor auf die rechtlichen Vorgaben zu den geografischen Herkunftsangaben eingegangen wird, soll jedoch eine erste Annäherung an den Begriff des regionalen Lebensmittels unter Berücksichtigung der Erwartungen der Marktbeteiligen an eine solche Kennzeichnung erfolgen. Die Herausarbeitung der Interessenlage der verschiedenen Marktbeteiligten ist eine notwendige Voraussetzung, um in Verbindung mit der Beschreibung der bestehenden rechtlichen Bestimmungen zu einer Beschreibung derjenigen Rahmenbedingungen zu gelangen, unter denen die Einführung eines bundesweiten freiwilligen Regionalsiegels erfolgen kann. Interesse der Marktbeteiligen an der regionalen Kennzeichnung Die Verbraucher haben ein berechtigtes Interesse an der Kennzeichnung von Lebensmitteln hinsichtlich ihrer regionalen Herkunft. Mit der geografischen Herkunftsangabe geht oftmals eine bestimmte Verbrauchererwartung an ein so gekennzeichnetes Produkt einher. Das dem Interesse des Verbrauchers zugrunde liegende Bedürfnis zu erfahren, woher ein Lebensmittel stammt, unterscheidet sich jedoch maßgeblich von der Intention der Zeichennutzer. Mit einer bestimmten regionalen Herkunft symbiotisch verknüpft ist eine bestimmte Erwartung des Nutzers (Verbraucher) an ein so gekennzeichnetes Lebensmittel. Dies kann einerseits aus der besonderen Affinität des Einzelnen zu einer bestimmten Region herrühren und/oder aus der Erwartungshaltung resultieren, dass mit einer bestimmten regionalen Herkunft auch besondere Eigenschaften hinsichtlich der Güte oder der spezifischen Eigenschaften der so gekennzeichneten Produkte einhergeht. Dies hat häufig seinen Grund darin, dass die dem Lebensmittel zugeschriebenen charakteristischen Eigenschaften, der Gegend oder der in dieser Region gebräuchlichen Art und Weise der Herstellung, der kulinarischen Tradition oder der regionalen Rezeptur zugeschrieben werden. Besonders deutlich wird dieser Zusammenhang beim Wein, dessen Güte und Beschaffenheit erheblich von der Bodenbeschaffenheit sowie den örtlichen klimatischen Bedingungen abhängig ist (Haß 1980, S. 87). Das vorhandene Angebot kann durch die Regionalkennzeichnung für den Nutzer (Verbraucher) transparenter werden, weil ihm ein weiteres Entscheidungskriterium an die Hand gegeben wird, das ihm erlaubt, die teils unüberschaubare Angebotsvielfalt zu individualisieren (vgl. Brethauer o. J.). Es ist ihm somit möglich, die Gattung des gewünschten Lebensmittels weiter - anhand der durch die regionale Aussage implizierten Eigenschaften - zu konkretisieren und somit eine Auswahl zu treffen, die seinen individuellen Präferenzen entspricht. Hierin, so Grube, liegt der eigentliche Wert geografischer Herkunftsangaben, der häufig unterschätzt wird (Grube 2011, S. 1). Hiermit wird vor allem das Ziel verfolgt, dem Verbraucher die Zuordnung eines Lebensmittels zu einer bestimmten Region zu vermitteln. Für den Verbraucher ist die regionale Herkunft eines Produkts vor allem eine wichtige Information, weil sie auch ein wichtiges Kriterium für die Kaufentscheidung darstellt (Nestlé Deutschland AG 2011, S. 96). FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 55

56 Den Verwendern dient die Regionalkennzeichnung vorwiegend als Marketinginstrument im Rahmen der Absatzförderung (Kopp 2009, S. 19 f.). Bei den Verwendern handelt es sich nicht um eine homogene Gruppe. Vielmehr sind zwei Gruppen auszumachen, deren Intentionen hinsichtlich der regionalen Kennzeichnung teils diametral entgegenstehen: Zum einen sind hier die Lebensmittelindustrie und der Lebensmittelhandel, zum anderen die Direktvermarkter und Regionalinitiativen zu nennen. Während Erstere insbesondere ein Interesse daran haben, möglichst viele Produkte (insbesondere auch verarbeitete Lebensmittel) regional ausloben zu können, haben Letztere ein Interesse daran, den Anwendungsbereich der Regionalkennzeichnung (insbesondere im Hinblick auf die Produktionstiefe der Produkte) möglichst schmal zu halten. Die hier zum Ausdruck kommenden unterschiedlichen Auffassungen der Verwender regionaler Aussagen darüber, welche Kriterien der Regionalkennzeichnung zugrunde gelegt werden, gepaart mit dem großen Spielraum, den die nationalen- und europäischen Normierungen in diesem Bereich ermöglichen, birgt gleichsam die Gefahr der Irreführung des Verbrauchers, insbesondere, wenn Marketing oder staatliche Absatzförderung eine Korrelation zwischen der Herkunft und der besonderen Qualität eines Produktes herstellen, dieser Zusammenhang aber tatsächlich nicht nachweisbar ist (Brethauer o. J.) Diese rudimentäre Darstellung der Interessen der Marktteilnehmer zeigt, dass sich die Interessen, die an eine regionale Kennzeichnung gestellt werden in Teilbereichen decken, andererseits aber auch stark voneinander abweichen können. Dem Verwender einer regionalen Kennzeichnung steht somit ein weiter Rahmen zur Verfügung, innerhalb dessen die Regionalkennzeichnung zulässig ist. Ziel dieser Darstellung soll es zunächst sein, aufzuzeigen, welche Aussagen im Rahmen einer Regionalkennzeichnung schützfähig sind und welche nicht. Dies bedarf zunächst der Darstellung der bestehenden Gesetzessystematik, um gewährleisten zu können, dass es nicht zu Überschneidungen kommt. Im Hinblick auf eine privat- oder öffentlich-rechtliche Ausgestaltung eines bundesweiten und freiwilligen Regionalsiegels muss der Bereich der staatlichen Absatzförderung erörtert werden. Festgehalten werden kann an dieser Stelle, dass trotz der unterschiedlichen Interessen der beteiligten Marktakteure, allgemein ein Bedürfnis nach Transparenz im Rahmen der Regionalkennzeichnung besteht. 6.2 Rechtlicher Rahmen Die Herkunftskennzeichnung wird durch diverse nationale und europäische Normen reguliert und kann dabei obligatorisch oder fakultativ ausgestaltet sein Obligatorische- und fakultative Herkunftskennzeichnung Herkunftsangaben finden sich in zweierlei Gestalt: zum einen die obligatorische und zum anderen die fakultative Herkunftskennzeichnung. Bei bestimmten Produkten ist eine Herkunftskennzeichnung verpflichtend. So muss zum Beispiel bei Rindfleisch und bei Honig das Herkunftsland angegeben werden. Diese verpflichtenden Herkunftsangaben dienen jeweils einem spezifischen Ziel, das eine obligatorische Kennzeichnung rechtfertigt. So ist beispielsweise bei der Pflichtangabe des Herkunftslandes bei der Rindfleischetikettierung die Rückgewinnung des Verbrauchervertrauens in die Qualität von Rindfleisch Ziel dieser FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 56

57 Verpflichtung. Hierdurch soll für jedermann die Herkunft des Rindfleisches transparent gemacht werden. So verweist die Verordnung (EG) Nr. 1760/2000 in Erwägungsgrund vier auf Folgendes: Um das Vertrauen der Verbraucher in die Qualität von Rindfleisch zu erhalten und zu stärken und um Irreführungen der Verbraucher zu vermeiden, muss der Rahmen entwickelt werden, in dem die Verbraucher durch eine angemessene und klare Etikettierung des Erzeugnisses informiert werden. Die Rindfleischetikettierungs-Richtlinie (RL 2000/13/EG) verweist in Erwägungsgrund sechs darauf, dass jede Regelung der Etikettierung von Lebensmitteln vor allem der Unterrichtung und dem Schutz der Verbraucher dienen soll. In Erwägungsgrund acht heißt es: Eine detaillierte Etikettierung, die Auskunft gibt über die genaue Art und die Merkmale des Erzeugnisses, ermöglicht es dem Verbraucher, sachkundig seine Wahl zu treffen, und ist insofern am zweckmäßigsten, als sie die geringsten Handelshemmnisse nach sich zieht. Die Vorgaben der Rindfleischetikettierungsrichtlinie wurden vom deutschen Gesetzgeber in das Rindfleischetikettierungsgesetz transformiert. Bei Honig ist ebenfalls die obligatorische Angabe des Herkunftslandes vorgeschrieben. So heißt es im fünften Erwägungsgrund der Richtlinie 2001/110/EG: Im Anbetracht des engen Zusammenhangs zwischen der Qualität des Honigs und seiner Herkunft ist unbedingt sicherzustellen, dass vollständige Informationen zu diesen Aspekten gegeben werden, damit der Verbraucher nicht über die Qualität des Erzeugnisses irregeführt wird. Damit den besonderen Interessen der Verbraucher bezüglich der geografischen Merkmale von Honig Rechnung getragen wird, und eine vollständige Transparenz in dieser Hinsicht sichergestellt ist, ist es erforderlich, dass das Ursprungsland, in dem der Honig erzeugt wurde, auf dem Etikett angegeben wird. Eine ebenso große Rolle, als Beispiel für eine obligatorische Angabe des Ursprungs der Erzeugung, spielt die EU-Verordnung 1182/2007 für den Obst- und Gemüsesektor. Durch die Verordnung (EU) Nr. 1169/2011 (Lebensmittelinformationsverordnung) werden möglicherweise weitere Herkunftskennzeichnungen von Lebensmitteln verpflichtend (vgl. Art. 26). Neben den obligatorischen gibt es fakultative Herkunftskennzeichnungen, deren Verwendung freiwillig ist. Im Falle der fakultativen Herkunftskennzeichnung sind seitens des Verwenders indes die allgemeinen rechtlichen nationalen- und gemeinschaftsrechtlichen Vorgaben zu beachten Nationale und gemeinschaftsrechtliche Schutzsysteme Der Schutz der geografischen Herkunftsangaben wird durch verschiedene Normierungen auf nationaler und europäischer Ebene gewährleistet. Nationales Schutzsystem Der Schutz der geografischen Herkunftsangaben und Qualitätszeichen für Lebensmittel im deutschen Rechtssystem findet sich zum einen im Gesetz über den Schutz von Marken und sonstigen Kennzeichen (MarkenG) sowie im Gesetz gegen den unlauteren Wettbewerb (UWG) sowie im Lebensmittel-, Bedarfsgegenstände- und Futtermittelgesetzbuch (Lebensmittel- und Futtermittelgesetzbuch - LFGB). Darüber hinaus finden die europäischen Verordnungen, die geografischen Angaben und Ursprungsbezeichnungen für Agrarerzeugnisse und Lebensmittel in der Bundesrepublik Deutschland betreffen, unmittelbare Anwendung. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 57

58 Diese gesetzlichen Bestimmungen geben - neben den gemeinschaftsrechtlichen Normierungen - den Rahmen vor, innerhalb dessen eine fakultative Herkunftskennzeichnung zulässig ist. Markengesetz Das MarkenG bietet einen umfassenden Schutz für den Bereich der geografischen Herkunftsangaben im wettbewerbsrechtlichen Bereich. Geregelt ist dieser wettbewerbsrechtliche Schutz in den 126 bis 129 MarkenG. Ergänzend hierzu treten die 130 bis 136 MarkenG, die den Schutz geografischer Angaben und Ursprungsbezeichnungen gemäß der Verordnung (EG) Nr. 510/2006 regeln (hierzu siehe unten). Durch die Regelung des Markengesetzes, die die geografischen Herkunftsangaben betreffen, wird vor allem der Schutz vor Irreführungen über die Herkunft einer Ware oder Dienstleistung statuiert (Kopp 2009, S. 66). Das MarkenG unterscheidet dabei zwischen einfachen und qualifizierten Herkunftsangaben. Bei einfachen Herkunftsangaben gemäß 127 Abs. 1 MarkenG handelt es sich um solche, die lediglich auf die Herkunft des Lebensmittels abstellen, mit dieser aber nicht eine bestimmte Qualitätserwartung verknüpfen. Dies ist jedoch bei qualifizierten Herkunftsangaben der Fall (Kopp 2009, S. 68). So ist zum Beispiel der geografische Bezeichnungsschutz (g.g.a. und g.u.) gemäß der Verordnung (EG) Nr. 510/2006 eine qualifizierte Herkunftsangabe. Der Europäische Gerichtshof hat in diesem Zusammenhang entschieden, dass nur qualifizierte Herkunftsangaben unter die Definition des Art. 2 Abs. 2 lit. b der Verordnung (EWG) Nr. 2081/92 (diese Verordnung wurde durch die Verordnung (EG) Nr. 510/2006 abgelöst) fallen. Dies hat zu Folge, dass einfache Herkunftsangaben nicht unter das Gemeinschaftsrecht fallen und somit im Schutzsystem des nationalen Gesetzgebers verbleiben (EuGH, GRUR Int. 2001, S. 51 ff). Der Schutz der geografischen Herkunftsangaben durch das MarkenG ist ein unmittelbarer wettbewerbsrechtlicher Schutz (Knaak 1995, S. 103). Folglich wird hierdurch die Lauterkeit des Wettbewerbs geschützt. Die Verwendung (einfacher und qualifizierter) geografischer Herkunftsangaben richtet sich dabei nach den Vorgaben der 126 ff. MarkenG. Unter einer geografischen Herkunftsangabe versteht man dabei die Verwendung von Orten, Gegenden, Gebieten oder Ländern sowie sonstige Angaben oder Zeichen, die im geschäftlichen Verkehr zur Kennzeichnung der geografischen Herkunft von Waren oder Dienstleistungen benutzt werden. Was hierunter im Einzelnen zu verstehen ist, besagt das Gesetz nicht. Insoweit ist es eine Einzelfallentscheidung, ob eine bestimmte geografische Herkunftsangabe korrekt ist. Die Verwendung einer geografischen Herkunftsangabe darf gemäß 127 zudem nicht irreführend sein. Das MarkenG stellt somit auf die Verwendung einer Aussage zur geografischen Herkunft ab, ohne dabei Aussagen zu weiteren Kriterien, wie etwa der Produktionstiefe zu liefern. Gesetz gegen den unlauteren Wettbewerb (UWG) Nach 5 Abs. 2 Nr. 1 UWG kann derjenige auf Unterlassung oder Schadensersatz in Anspruch genommen werden, der im geschäftlichen Verkehr zum Zwecke des Wettbewerbs über Ursprung oder Herkunft der Ware irreführende Angaben macht. In Bezug auf das MarkenG sind die Regelungen des UWG jedoch subsidiär (BGH Grur 1999, S. 252). FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 58

59 Irreführungsverbot, 11 LFGB Nach 11 Abs. 1 Satz 1 LFGB ist es verboten, Lebensmittel unter irreführender Bezeichnung, Angabe oder Aufmachung gewerbsmäßig in den Verkehr zu bringen oder für Lebensmittel allgemein oder im Einzelfall mit irreführenden Darstellungen oder sonstigen Aussagen zu werben. In 11 Abs. 1 Satz 1 Nr. 1 wird diese sogenannte Generalklausel noch weiter konkretisiert. Hiernach liegt eine Irreführung insbesondere dann vor, wenn bei einem Lebensmittel zur Täuschung geeignete Bezeichnungen, Angaben, Aufmachungen, Darstellungen oder sonstige Aussagen über Eigenschaften, insbesondere über Art, Beschaffenheit, Zusammensetzung, Menge, Haltbarkeit, Ursprung, Herkunft oder Art der Herstellung oder Gewinnung verwendet werden. Somit sind Herkunftsangaben grundsätzlich geeignet, den Verbraucher in die Irre zu führen. Eine Irreführung liegt - genauso wie im Wettbewerbsrecht - vor, wenn bei den angesprochenen Verkehrskreisen aufgrund der Aufmachung eines Lebensmittels oder der hierfür geschalteten Werbung falsche Vorstellungen über die tatsächlichen Verhältnisse hervorgerufen werden. Dass es tatsächlich zu einer Täuschung kommt, ist nicht erforderlich. Bereits die Möglichkeit einer Täuschung reicht aus (Streinz 2011, Rn. 428). Mit der Herkunftsangabe wird verbraucherseitig oftmals eine besondere Qualität, zumindest aber eine spezielle Wertschätzung verbunden, sodass nicht korrekte Herkunftsangaben irreführend sein können (Rathke 2011, 11 LFGB, Rn. 120). Das Irreführungsverbot ( 11 LFGB) zielt auf den Schutz der Verbraucher vor Täuschungen ab, denen er vor und beim Erwerb von Lebensmitteln in mannigfacher Weise ausgesetzt sein kann (Leible in Streinz 2011, Rn. 424). Die Bezeichnung, Angabe oder Aufmachung (Aussage) eines Lebensmittels ist also dann irreführend, wenn die Ist- mit der Sollbeschaffenheit nicht übereinstimmt. Um jedoch bestimmen zu können, wann eine solche Irreführung vorliegt, muss zunächst bestimmt werden, ob die angesprochenen Verkehrskreise durch diese Aussagen falsche Vorstellungen über die tatsächlichen Verhältnisse hervorgerufen werden können (Leible in Streinz 2011, Rn. 428). Von maßgeblicher Bedeutung ist hier das zugrunde zu legende Verbraucherleitbild. Je nachdem, welche Anforderungen an den Verbraucher gestellt werden, desto unterschiedlicher fällt die Bewertung aus, wann im Einzelfall falsche Vorstellungen hervorgerufen werden können. Zunächst ist darauf hinzuweisen, dass 11 LFGB auf der Richtlinie 2000/13/EG (Etikettierungsrichtlinie) beruht und somit das Verbraucherleitbild gemeinschaftsrechtlich auszulegen ist. Der EuGH definierte in einem Urteil den Verbraucher als durchschnittlich informierten, aufmerksamen und verständigen Durchschnittsverbraucher (EuGH, ZLR 1998, S. 459). Dem flüchtigen Durchschnittsverbraucher, von dem das deutsche Recht bis dato ausging, ist hiermit eine Absage erteilt worden. Dem Verbraucher wird nunmehr einiges zugetraut. Er muss folglich nicht mehr vor sich selbst beschützt werden. Vielmehr wird ihm eine hohe Beurteilungskompetenz attestiert. Durch geeignete Informationen auf der Etikettierung oder in der Werbung ist er in einem gewissen Rahmen selbst in der Lage, zu beurteilen, ob die Angaben, Bezeichnungen oder Aufmachungen stimmig sind und ob die Ist- mit der Sollbeschaffenheit übereinstimmt. Zusammenfassung Das nationale Recht gibt den Rahmen vor, innerhalb dessen die Verwendung geografischer Herkunftsangaben geregelt wird. Es zielt dabei vorwiegend auf den Schutz der Lauterkeit des Handelsverkehrs sowie auf den Schutz vor Irreführung bei der Verwendung von FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 59

60 Herkunftsaussagen ab. Kriterien, anhand derer sich bestimmen ließe, was ein Lebensmittel erfüllen muss, um als regional zu gelten, werden nicht getätigt. Es bleibt bei den allgemeinen Vorgaben des 126 MarkenG, die auf den Ort, die Gegend, das Gebiet oder das Land abstellen. Hiermit werden indes keine Vorgaben gemacht, ob zum Beispiel die Zutaten eines Lebensmittels aus dem benannten geografischen Gebiet stammen müssen Gemeinschaftsrechtliches Schutzsystem Auch auf Gemeinschaftsebene finden sich Vorschriften, die dem Schutz der geografischen Herkunftsangabe dienen. Hier sind insbesondere die allgemeine Verordnung (Verordnung (EG) Nr. 510/ vormals Verordnung (EG) Nr. 2081/92) sowie die produktspezifischen Verordnungen (Verordnung (EG) Nr. 1493/1999, Verordnung (EWG) Nr. 1576/88) für den Schutz geografischer Angaben in den Bereichen Lebensmittel, Wein und Spirituosen zu nennen. Von besonderer Bedeutung für die vorliegende Begutachtung ist die Verordnung (EG) Nr. 510/2006 zum Schutz geografischer Angaben und Ursprungsbezeichnungen für Agrarerzeugnisse und Lebensmittel. Hiernach sind bestimmte geografische Namen bestimmten Agrarerzeugnissen und Lebensmitteln vorbehalten (Kopp 2009, S. 106). Sie bildet dabei ein gemeinschaftsweites Schutzsystem für einen Teilbereich der geografischen Herkunftsangaben. Es gibt zwei verschiedene Gemeinschaftszeichen, die die Verwendung geografischer Herkunftsangaben regeln: Geschützte Ursprungsbezeichnung (g.u.): Die geschützte Ursprungsbezeichnung sagt aus, dass dieses Lebensmittel in einem abgegrenzten geografischen Gebiet erzeugt und hergestellt wurde (z. B. Allgäuer Bergkäse, Parmaschinken, Mozarella di Bufala). Geschützte geografische Angabe (g.g.a.) Voraussetzung zum Führen des g.g.a. Zeichens ist, dass das Lebensmittel in mindestens einer seiner Produktionsstufen in dem bezeichneten Herkunftsgebiet erzeugt, hergestellt oder verarbeitet wurde (z. B. Münchner Bier, Tiroler Speck, Schwarzwälder Schinken). Das Schutzsystem reserviert die Verwendung von Ursprungsbezeichnungen und geografischen Angaben ausschließlich für solche Agrarerzeugnisse und Lebensmittel, die im definierten geografischen Gebiet unter bestimmten, von den Erzeugern im Eintragungsantrag beschriebenen Erzeugungs-, Verarbeitungs- und Herstellungsbedingungen erzeugt und verarbeitet werden (Grube 2011, S. 10). Bei den geografischen Herkunftsangaben nach der Verordnung (EG) Nr. 510/2006 handelt es sich um qualifizierte Herkunftsangaben. Denn die Qualität - und somit die besondere Schutzwürdigkeit - beruht hier auf der Annahme, dass die Qualität bestimmter Agrarerzeugnisse oder Lebensmittel auf die Besonderheiten eines genau abgegrenzten geografischen Gebietes zurückzuführen ist (vgl. hierzu den fünften Erwägungsgrund der Verordnung (EG) Nr. 510/2006). Die Eintragung eines Agrarerzeugnisses oder Lebensmittels in das entsprechende Register führt zu einer Sperrung dieses Namens für Agrarerzeugnisse und Lebensmittel, die die betreffende Spezifikation nicht erfüllen. Jedoch kann jeder Marktteilnehmer den eingetragenen Namen verwenden, sofern die von ihm vermarkteten Agrarerzeugnisse oder Lebensmittel den betreffenden Spezifikationen entsprechen (vgl. Artikel 8 der Verordnung (EG) Nr. 510/2006). Dies führt zu einem umfassenden Schutz der eingetragenen Bezeichnungen. Der Kennzeichenschutz durch dieses System schließt somit eine nationale Regelung aus. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 60

61 Artikel 2 der Verordnung (EG) Nr. 510/2006 führt aus, was unter Ursprungsbezeichnung und geografischer Angabe zu verstehen ist: 1. Ursprungsangabe (bedeutet) den Namen einer Gegend, eines bestimmten Ortes oder in Ausnahmefällen eines Landes, der zur Bezeichnung eines Agrarerzeugnisses oder eines Lebensmittels dient, das aus dieser Gegend, diesem bestimmten Ort oder diesem Land stammt, das seine Güte oder Eigenschaften überwiegend oder ausschließlich den geografischen Verhältnissen einschließlich der natürlichen und menschlichen Einflüsse verdankt und das in dem abgegrenzten geografischen Gebiet erzeugt, verarbeitet oder hergestellt wurde; 2. geografische Angabe (bedeutet) den Namen einer Gegend, eines bestimmten Ortes oder in Ausnahmefällen eines Landes, der zur Bezeichnung eines Agrarerzeugnisses oder Lebensmittels dient, das aus dieser Gegend, diesem Ort oder diesem Land stammt und bei dem sich eine bestimmte Qualität, das Ansehen oder eine andere Eigenschaft aus diesem geografischen Ursprung ergibt und das in dem abgegrenzten geografischen Gebiet erzeugt und/oder verarbeitet und/oder hergestellt wurde. Auch die gemeinschaftsrechtliche Regelung weist keine dezidierten Kriterien auf; sie bleibt insoweit eher allgemein. Erwähnung finden soll noch die garantiert traditionelle Spezialität (g.t.s.) gemäß der Verordnung (EG) Nr. 509/2006. Hierbei handelt es sich nicht um eine Herkunftsbezeichnung wie die geschützte geografische Angabe (g.g.a.) und die geschützte Ursprungsbezeichnung (g.u.) sondern um eine Kennzeichnung für ein traditionelles Agrarerzeugnis oder Lebensmittel, dessen besondere Merkmale von der Gemeinschaft durch Eintragung entsprechend dieser Verordnung anerkannt worden sind. Verhältnis des nationalen zum gemeinschaftsrechtlichen Schutz Das Verhältnis zum nationalen Schutzsystem ist weder in der Verordnung (EG) Nr. 510/2006 noch in zweiseitigen Abkommen geregelt. Festhalten lässt sich hier, dass eine geografische Bezeichnung, die nach der Verordnung registriert und geschützt ist, darüber hinaus nicht zusätzlich durch nationale Schutzsysteme geschützt wird. Das nationale Recht tritt in diesem Fall hinter das europäische Recht zurück (EuGH Grur Int. 1999, 443 Rn. 18; Grur Int. 2003, 543 (545): Nach dem Grundsatz des Geltungsvorranges können Bestimmungen des Gemeinschaftsrechts durch nationales Recht nicht abgeändert oder aufgehoben werden. Im Kollisionsfall mit nationalem Recht geht das Gemeinschaftsrecht - dem Grundsatz des Anwendungsvorrangs folgend - diesem vor. Ist der Anwendungsbereich der Verordnung (EG) Nr. 510/2006 eröffnet, ist die Regelung abschließend; für eine nationale Sonderregelung bleibt dann kein Raum mehr. Diesbezüglich hat der EuGH entschieden, dass einfache Herkunftsangaben nicht unter das Gemeinschaftsrecht fallen und somit im nationalen Schutzsystem verbleiben (EuGH Grur Int. 2001, S. 51ff). FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 61

62 Zusammenfassung der Schutzsysteme Nach der Darstellung der nationalen- und gemeinschaftsrechtlichen Schutzsysteme bedarf es noch der Klärung der Frage, welche Rechtsgüter hierdurch geschützt werden sollen, um im Anschluss hieran die Frage beantworten zu können, ob und inwieweit ein freiwilliges bundesweites Regionalsiegel sich in dieses Schutzsystem einfügen lässt und ob hierdurch nicht sogar die verschiedenen Rechtsgüter noch besser geschützt werden können. Auf nationaler Ebene geht es vorwiegend um den Schutz vor Irreführung, ergänzt durch den Schutz der Lauterkeit des Handelsverkehrs sowohl für einfache als auch für qualifizierte Herkunftsangaben. Das gemeinschaftsrechtliche Schutzsystem zielt auf den Schutz eingetragener Bezeichnungen ab, behält aber seinen Schutz den qualifizierten Herkunftsangaben beziehungsweise Ursprungsbezeichnungen vor (Kopp 2009, S. 126). Die nationalen als auch die gemeinschaftsrechtlichen Schutzsysteme gewähren primär einen Schutz vor Irreführung und einen wettbewerbsrechtlichen Schutz. Dabei geben sie nur begrenzte Vorgaben hinsichtlich der Frage, welche Anforderungen an ein Lebensmittel bei Angabe einer geografischen Herkunftsangabe oder Ursprungsbezeichnung zu stellen sind. Insbesondere verbleibt für den Bereich der einfachen geografischen Herkunftsangabe die Möglichkeit einer nationalstaatlichen Regelung. Diese kann privat- oder aber auch öffentlichrechtlich ausgestaltet sein. Für letzteren Bereich ist jedoch die Problematik der staatlichen Absatzförderung, insbesondere im Hinblick auf die Vereinbarkeit mit der Warenverkehrsfreiheit, zu beachten Staatliche Absatzförderung Schließlich ist noch der Bereich der Auswirkungen der staatlichen Absatzförderung auf ein bundesweites freiwilliges Regionalsiegel zu untersuchen. Dies insbesondere im Hinblick auf dessen privat- oder öffentlich-rechtliche Ausgestaltung. Zu beachten ist in diesem Zusammenhang die Unterscheidung zwischen der herkunftsbezogenen Kennzeichnung eines dem Staat zuzuordnenden Zeichens einerseits und die Verwendung regionaler Aussagen durch private Institutionen. Label bzw. Siegel, die Aussagen zur geografischen Herkunft tätigen, unterliegen, sofern sie zweifelsfrei dem Staat zugeordnet werden und somit für die nationalen Produkte absatzfördernd wirken können, den Vorgaben des EU-Vertrages, insbesondere im Hinblick auf die Warenverkehrsfreiheit (Art. 28 AEUV). Zeichen hingegen, die von Privatrechtssubjekten, die autark vom Staat tätig werden, verwendet werden, unterfallen nicht unmittelbar dem Anwendungsbereich der Vorschriften über die Warenverkehrsfreiheit. Der Europäische Gerichtshof (EuGH) urteilte im Jahre 2002 in der Rechtssache CMA- Gütezeichen (EuGH, NJW 2002, 3609), dass ein staatliches Qualitätszeichen, bei dem der Hinweis auf die Qualität mit der Herkunft aus einem bestimmten Mitgliedstaat verbunden war, unvereinbar mit der Warenverkehrsfreiheit sei, die Gütezeichenwerbung Markenqualität aus deutschen Landen sei eine öffentliche Vermarktungshilfe und untersagte diese aufgrund fehlender spezifischer Qualitätsnormen. In der Folge wurden entsprechende Zeichen der deutschen Bundesländer diesem Urteil angepasst. In der Einleitung der Gemeinschaftsleitlinien für staatliche Beihilfen zur Werbung für in Anhang I des EG-Vertrages genannte Erzeugnisse und bestimmte nicht in Anhang I genannte Erzeugnisse (siehe 0005:0014:DE:PDF, zuletzt abgerufen am ) wird festgestellt, dass sich in fast allen FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 62

63 Mitgliedstaaten die öffentliche Hand an der Finanzierung und Förderung des Absatzes und der Werbung für die entsprechenden Produkte beteiligt. Diese sind dann zulässig, wenn sie bestimmte Kriterien erfüllen und von der Kommission befürwortet werden. Für die Entwicklung der Kriterien eines freiwilligen nationalen Regionalsiegels bedeutet dies, dass ein staatliches Zeichen diesen Anforderungen genügen muss und auch das Genehmigungsverfahren erfolgreich durchlaufen muss. Dabei muss darauf geachtet werden, dass die Ausgestaltung des Zeichens mit der Warenverkehrsfreiheit im Einklang steht. Ein (privates) Zeichen, das zweifelsfrei dem Staat nicht zugeordnet werden kann, unterfällt hingegen nicht den Vorschriften über die Warenverkehrsfreiheit. Im Hinblick auf ein bundesweites freiwilliges Regionalsiegel hat dies zur Folge, dass die privatrechtliche Ausgestaltung weniger Hürden zu überwinden hätte als eine entsprechende öffentlich-rechtlich verankerte Ausgestaltung. Denn ein privatrechtlich organisiertes Siegel müsste nicht das Genehmigungsverfahren durch Institutionen der EU durchlaufen, da es von der Problematik der staatlichen Absatzförderung nicht betroffen ist. Zusammenfassung Die nationalen und die gemeinschaftsrechtlichen Schutzsysteme geben den Rahmen vor, die ein bundesweites und freiwilliges Regionalsiegel zu beachten hat. Die Ausgestaltung ist in privater, aber auch in öffentlich-rechtlicher Form möglich. Im letzteren Fall hat der nationale Gesetzgeber jedoch die Vorgaben der Warenverkehrsfreiheit zu beachten. Rechtliche Vorgaben, die eine einheitliche Herkunftsangabe vorschreiben, existieren nur in Teilbereichen. Zudem wird die Herkunftskennzeichnung - so sie denn überhaupt rechtlich normiert ist - sowohl durch das gemeinschaftsrechtliche als auch das nationalstaatliche Recht normiert. Was unter einem regionalen Lebensmittel genau zu verstehen ist, ergibt sich dabei jedoch nicht explizit aus dem nationalen und europäischen Normengefüge. Kriterien anhand derer sich bestimmen lässt, wann ein Lebensmittel regional ist und wann nicht, sind nur für bestimmte Bereiche (g.g.a., g.u.) festgelegt. Außerhalb dieses rechtlich geschützten Bereiches gelten indes die allgemeinen rechtlichen Vorgaben, zum Beispiel aus dem Lebensmittelrecht und dem Wettbewerbsrecht. Die Schutzsysteme zielen dabei primär auf den Schutz vor Irreführung, der Lauterkeit des Handelsverkehrs sowie auf einen kennzeichenrechtlichen Schutz ab. Vor dem Hintergrund der divergierenden Interessen der Marktakteure sowie deren unterschiedliche Sichtweise, wie der Begriff der Region zu verstehen ist, kann ein bundesweites und freiwilliges Regionalsiegel seinen Beitrag dazu leisten, Transparenz zu schaffen. Dies kann in einer Festlegung von Kriterien sein, die den Begriff der Region genauer spezifizieren, aber auch in der transparenten Kommunikation dessen, was der Verwender unter dem Begriff der Region, den er verwendet, versteht. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 63

64 6.3 Zeichenvergabe Vorbemerkung Im folgenden Text werden die Begrifflichkeiten Kontrolle, Zertifizierung, Zulassung/Genehmigung sowie Akkreditierung verwendet. Nachfolgende Definitionen dienen der Klarstellung, was mit diesen Begrifflichkeiten im Rahmen des Gutachtens gemeint ist. Kontrolle Überprüfung von Betrieben sowie ggf. Unterauftragnehmern und/oder Lieferanten. Die Kontrolle umfasst in der Regel auch Inspektionen in einem definierten zeitlichen Rhythmus. Ergebnis der Kontrolle ist ein Bericht, in dem der Kontrolleur die während des Kontrollbesuches festgestellten Sachverhalte dokumentiert. Die Kontrolle wird in der Regel durch eine Kontrollstelle durchgeführt. Zertifizierung (oder Konformitätsbewertung) Bewertung der Einhaltung bestimmter privater oder gesetzlicher Vorschriften durch ein Unternehmen/einen Betrieb. Die Zertifizierung erfolgt in der Regel auf Grundlage der im Kontrollbereich dokumentierten Sachverhalte. Das Unternehmen/der Betrieb erhält ein Zertifikat, welches ihn berechtigt, eine Marke oder ein Zeichen zu verwenden. Das Zertifikat kann sich auf ein Unternehmen/einen Betrieb oder nur auf bestimmte Betriebsbereiche oder Produkte beziehen. Die Zertifizierung wird in der Regel vom Zeichen-/Markeninhaber (Zertifizierungsstelle) durchgeführt. Die Zertifizierungsstelle kann auch eine andere Stelle mit der Zertifizierung beauftragen. Zulassung/Genehmigung Die Begriffe Zulassung und Genehmigung werden synonym verwendet. Eine Zulassung/Genehmigung ist im Falle einer Kontroll- und/oder Zertifizierungsstelle eine Bestätigung, dass die beantragende Stelle die Kompetenz besitzt, bestimmte Kontroll- und Zertifizierungsaufgaben durchzuführen und die Erlaubnis hat, diese Tätigkeit im Rahmen der definierten Systeme auszuüben. Im Falle von Lizenznehmern einer Dachmarke bedeutet Zulassung/Genehmigung die Bestätigung, dass die beantragende Stelle über ein System verfügt, mit welchem sie sicherstellt, dass die Anforderungen der Dachmarke erfüllt werden. Mit der Zulassung/Genehmigung erhält die beantragende Stelle die Erlaubnis, die Dachmarke im Rahmen der Lizenzvereinbarung zu verwenden und die Genehmigung ggf. an Unterlizenznehmer weiterzugeben. Akkreditierung Akkreditierung ist die Bestätigung durch eine dritte Stelle, die formal darlegt, dass eine Konformitätsbewertungsstelle die Kompetenz besitzt, bestimmte Konformitätsbewertungsaufgaben durchzuführen. In Deutschland dürfen Akkreditierungen nur durch die Deutsche FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 64

65 Akkreditierungsstelle GmbH/DAkkS) durchgeführt werden. Für die Zulassung als Ökokontrollstelle ist eine Akkreditierung gemäß EN Voraussetzung Realisierungsmodalitäten eines freiwilligen Regionalsiegels Bestehende Verordnungen, wie z. B. die EG-Öko-Verordnung oder die Ohne Gentechnik - Kennzeichnungsverordnung, sind Regelsysteme, die als Beispiele dafür herangezogen werden können, wie die Vergabe und die Absicherung der Nutzung eines bundesweiten Regionalsiegels gestaltet werden könnten. Nachfolgend ein Überblick über die bestehenden Systeme Anwendungsbereich eines Siegels Der Geltungsbereich einer Regionalmarke sollte sich am Geltungsbereich bestehender Regelwerke für Produkte orientieren, für die eine Regionalkennzeichnung Relevanz haben könnte. Im Folgenden werden die Geltungsbereiche relevanter Regelwerke für die Zusatzkennzeichnung von Lebensmitteln sowie landwirtschaftlichen Ausgangserzeugnissen aufgeführt. EG-Öko-Verordnung Der Geltungsbereich der EG-Rechtsvorschriften für den ökologischen Landbau umfasst den folgenden Produktbereich: Lebende oder unverarbeitete landwirtschaftliche Erzeugnisse, verarbeitete landwirtschaftliche Erzeugnisse, die zur Verwendung als Lebensmittel bestimmt sind, Futtermittel, vegetatives Vermehrungsmaterial und Saatgut für den Anbau sowie für als Lebensmittel oder Futtermittel verwendete Hefen. Ausgenommen sind Erzeugnisse der Jagd und der Fischerei wild lebender Tiere. Verordnung zum Schutz von geografischen Angaben und Ursprungsbezeichnungen Die Verordnung (EG) Nr. 510/2006 vom zum Schutz von geografischen Angaben und Ursprungsbezeichnungen für Agrarerzeugnisse und Lebensmittel gilt für folgende Produktbereiche: Lebensmittel einschließlich Bier, Getränke auf der Grundlage von Pflanzenextrakten, Backwaren, feine Backwaren, Süßwaren oder Kleingebäck, natürliche Gummis und Harze, Senfpaste, Teigwaren. Agrarerzeugnisse einschließlich Heu, ätherische Öle, Kork, Cochenille (Rohstoff tierischen Ursprungs), Blumen und Zierpflanzen, Wolle, Korbweide, Schwingflachs. Ohne-Gentechnik-Kennzeichnung Gemäß dem EG-Gentechnik-Durchführungsgesetz - EGGenTDurchfG gelten die Bestimmungen für eine Ohne-Gentechnik -Kennzeichnung für Lebensmittel. Gemäß der EU- FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 65

66 Basisverordnung zum Lebensmittelrecht VERORDNUNG (EG) Nr. 178/2002 sind Lebensmittel alle Stoffe oder Erzeugnisse, die dazu bestimmt sind oder von denen nach vernünftigem Ermessen erwartet werden kann, dass sie in verarbeitetem, teilweise verarbeitetem oder unverarbeitetem Zustand von Menschen aufgenommen werden (Artikel 2). [ ] Zu Lebensmitteln zählen auch Getränke, Kaugummi sowie alle Stoffe, einschließlich Wasser, die dem Lebensmittel bei seiner Herstellung oder Be- oder Verarbeitung absichtlich zugesetzt werden. Keine Lebensmittel hingegen sind Futtermittel, lebende Tiere, Pflanzen vor dem Ernten, Arzneimittel, kosmetische Mittel sowie Tabak und Betäubungsmittel. Fair-Zertifizierung Eine privatrechtliche Fair-Zertifizierung erfolgt auf Basis der Anerkennung des eigenen Regelund Kriterienwerkes durch die Fairtrade Labelling Organizations International (FLO), Bonn. Basis für die Entwicklung eigener Mindestkriterien sind die Grundsätze von FINE, der internationalen Dachorganisation des Fairen Handels. Die Zertifizierung wird durch die FLO- CERT GmbH durchgeführt. FLO-CERT hat sich nach ISO 65 als unabhängige Zertifizierungsorganisation akkreditieren lassen. Ein Beispiel ist die Fair-Zertifizierung von Naturland, sie kann für alle Naturland Produkte zusätzlich durchgeführt und vergeben werden. Neben den Produkten, die über den Geltungsbereich der EG-Öko-Verordnung geregelt sind, betrifft dies die folgenden Produktgruppen: Fisch und Meeresfrüchte (auch Wildfisch) sowie Wald, Holz und Holzverarbeitung. Zusammenfassung Der Geltungsbereich für ein Regionalsiegel kann relativ weit gefasst werden. Mit einem wie folgt definierten Geltungsbereich Agrarerzeugnisse inklusive lebender Tiere sowie Saat- und Pflanzgut sowie Lebens- und Futtermittel sind die in den vorgenannten Regelwerken angeführten Geltungsbereiche weitgehend abgedeckt. Ergänzt werden kann dieser bei Bedarf durch Produktgruppen wie Wild, Wildfisch, Wald/Holz und daraus hergestellte Produkte sowie durch aus Agrarerzeugnissen herstellte Produkte, die keine Lebensmittel sind (z. B. Textilien) Zeichenvergabe Es muss eine Zeichenvergabestelle geschaffen werden, die die Einhaltung der definierten Vorgaben für die Verwendung einer bundesweiten Dachmarke sicherstellt. Die Zeichenvergabestelle prüft, ob das vom Antragsteller definierte System und die damit verbundenen Aussagen mit den Anforderungen der Dachmarke kompatibel und mit entsprechenden prüfbaren Kriterien gestützt sind. Nachfolgend sind einige Varianten bestehender Zeichenvergabestellen bzw. Systemzulassungsstellen aufgeführt: Bio-Siegel Die Nutzung des staatlichen Biosiegels muss vor der erstmaligen Verwendung bei der Informationsstelle Bio-Siegel (angesiedelt bei der Bundesanstalt für Ernährung) angezeigt FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 66

67 werden. Voraussetzung ist eine gültige Zertifizierung gemäß den EU-Rechtsvorschriften für den ökologischen Landbau. Die Nutzung des Bio-Siegels ist kostenfrei. Ohne Gentechnik -Label Das BMELV ist Markeninhaber des einheitlichen Ohne Gentechnik -Siegels. Der Verband Lebensmittel ohne Gentechnik e.v. (VLOG) ist Lizenznehmer der Marke und alleinig befugt, Unterlizenzen an interessierte Unternehmen zu verteilen. Jeder, der die Anforderungen des EGGenTDurchfG erfüllt und dem VLOG diesen Standard glaubhaft macht, kann eine Lizenz zur Nutzung des einheitlichen Siegels erhalten. Die Nutzung des Siegels ist kostenpflichtig. Das Lizenzentgelt richtet sich nach der Größe des Unternehmens und beginnt bei 100 Euro im Jahr. Im Gegensatz zu der österreichischen Gentechnik-frei erzeugt - bzw. Ohne Gentechnik hergestellt -Kennzeichnung ist für die Ohne Gentechnik -Kennzeichnung kein Kontroll- und Zertifizierungsverfahren vorgeschrieben. Rindfleischetikettierung (fakultative Kennzeichnung) Voraussetzung für die Kennzeichnung von Rindfleisch über die gesetzlich vorgeschriebenen Angaben hinaus (fakultative Kennzeichnung) ist die Genehmigung durch das Rindfleischetikettierungssystem der zuständigen Stelle der Bundesanstalt für Ernährung (BLE). Mit dem Antrag sind umfangreiche Unterlagen einzureichen. Diese umfassen unter anderem eine Beschreibung der Kennzeichnungsvorschriften, des Kontroll- und Zertifizierungsverfahrens, der Dokumentationspflichten, der Vorschriften zur Chargenbildung, -abgrenzung und Sicherstellung der Rückverfolgbarkeit. Weiterhin müssen die Kontrollstellen, die mit der Kontrolle des Systems beauftragt werden, durch die BLE anerkannt werden. Die Kontrollstellen müssen hierzu die Voraussetzungen des einschlägigen Fachrechts und der DIN EN erfüllen. Eine Akkreditierung der Kontrollstelle ist allerdings nicht erforderlich. Geprüfte Qualität - HESSEN Inhaber der Marke Geprüfte Qualität - HESSEN ist die Marketinggesellschaft GUTES AUS HESSEN e.v. Für die Zeichenvergabe ist die MGH GUTES AUS HESSEN GmbH (100 Prozent Tochter des e.v.) zuständig. Für die Nutzung des Zeichens ist eine Teilnahmeerklärung an die Zeichenvergabestelle zu senden und eine zugelassene Kontrollstelle mit der Kontrolle zu beauftragen. Eine erste Nutzung des Zeichens ist erst nach erfolgter Erstkontrolle und Ausstellung eines Zertifikates durch die beauftragte Kontrollstelle möglich. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 67

68 Tabelle 16: Übersicht Systemzulassungsstellen Geprüfte Qualität - HESSEN Marke Markeninhaber Bundesministerium für Ernährung, Landwirtschaft und Verbraucherschutz Vergabestelle Siegel/System Bio-Siegel Ohne Gentechnik Rindfleischetikettierung Antragsverfahren Kontrolle und Zertifizierung Überwachung der Kontrolle Staatlich durch Bundesbehörde Anzeige der Nutzung Abgedeckt über EU- Rechtsvorschriften für den ökologischen Landbau Abgedeckt über EU- Rechtsvorschriften für den ökologischen Landbau Bundesministerium für Ernährung, Landwirtschaft und Verbraucherschutz Privatrechtlich durch Vergabestelle Lizenznehmer Verband Lebensmittel ohne Gentechnik e.v. (VLOG) Plausibilitätsprüfung durch Vergabestelle auf Grundlage eines Fragebogens Kein Kontroll- und Zertifizierungsverfahren Keine Marke. Freiwillige Angaben zu z. B. regionaler Herkunft, Tierkategorien, besonderen Aufzuchtverfahren Keine Marke vorhanden Staatlich durch Bundesanstalt für Landwirtschaft und Ernährung (BLE) Zulassung des Systems auf Grundlage umfangreicher Unterlagen. Zusätzlich Zulassung der Kontrollstelle notwendig Verfahren ist Bestandteil der Antragstellung. Meldepflichten durch Systeminhaber und Kontrollstelle an die BLE Durch die BLE Marketinggesellschaft GUTES AUS HESSEN e.v. Privatrechtlich durch MGH GUTES AUS HESSEN GmbH Teilnahmeerklärung und Beauftragung einer zugelassenen Kontrollstelle Kontrolle durch zugelassene Kontrollstellen. Zulassung erfolgt durch das Regierungspräsidium Gießen Durch das Regierungspräsidium Gießen Für die Nutzung einer Dach -Marke bzw. die Teilnahme an einem übergeordneten System sind folgende Maßnahmen relevant, um die Marke und die Markennutzer zu schützen: Zulassung und Registrierung von Organisationen (Lizenznehmer) und deren Etikettierungssystemen durch den Dach-Markeninhaber oder eine von diesem beauftragte Organisation. Zusätzlich Registrierung aller Unterlizenznehmer der registrierten Organisationen. Verfahren zur Zulassung von Kontrollstellen. Definition des Kontrollverfahrens und der Mindestkontrollanforderungen zur Absicherung der Einhaltung der Regeln durch die Markennutzer/Systemteilnehmer. Mit diesen Instrumenten wird auch gegenüber dem Verbraucher sichergestellt, dass die mit der Marke/dem System kommunizierten Erklärungen zu Produkteigenschaften, Produktqualität und Qualitätssicherungsmaßnahmen eingehalten werden. Eine Akkreditierung von Lizenznehmern FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 68

69 wäre sehr aufwendig und teuer und würde einen erheblichen Hinderungsgrund für die Nutzung einer Regionaldachmarke darstellen Kontrollen/Dokumentationen Der Sonderbericht Nr des Europäischen Rechnungshofs stellt fest, dass in zahlreichen Fällen geografische Angaben genutzt wurden, ohne dass die Produkte die Voraussetzungen hierfür erfüllen. Weiterhin stellt er fest, dass im Zusammenhang mit der Umsetzung der Regelungen für geografische Angaben (geschützte geografische Angabe (g.g.a.)) die Ausgestaltung des Kontrollverfahrens unzureichend ist. Um die unzulässige Kennzeichnung in Zukunft zu vermeiden, fordert der Rechnungshof, Mindestanforderungen für die Kontrolle der Einhaltung von Produktbeschreibungen zu formulieren. Diese sollten zumindest die Kontrollhäufigkeit und Kontrollmethoden regeln sowie eine Definition enthalten, welche Unternehmen sich dem Kontrollverfahren unterziehen müssen. Ebenso wie bei Bioprodukten basiert der Mehrwert von Produkten mit einer Regionalkennzeichnung auf dem Vertrauen der Konsumenten in diese. Deshalb ist es unerlässlich, die Wahrhaftigkeit der Aussagen über ein funktionierendes Kontrollsystem zu gewährleisten. In folgender Tabelle sind beispielhaft die Kontrollsysteme für vier verschiedene Marken bzw. Etikettierungssystem aufgeführt. Tabelle 17: Übersicht Kontrollsystem Siegel/System EU-Bio-Logo und Bio- Siegel Ohne Gentechnik Rindfleischetikettierung Geprüfte Qualität - HESSEN Marke Keine Marke. Freiwillige Angaben zu z. B. regionaler Herkunft, Tierkategorien, besonderen Aufzuchtverfahren Standards Zulassung Kontroll- und Zertifizierungsverfahren Kontrollverfahren EU-Rechtsvorschriften für den ökologischen Landbau Zulassung der Kontrollstelle durch Bundesanstalt für Landwirtschaft und Ernährung (BLE). Voraussetzung für die Zulassung ist eine Akkreditierung nach EN Mindestens jährlicher Kontrollbesuch beim Unternehmen. Zusätzlich in zehn EG-Gentechnik- Durchführungsgesetz (EGGenTDurchfG) Kein Kontroll- und Zertifizierungsverfahren vorgeschrieben. Die Teilnahme an einem freiwilligen Kontroll- und Zertifizierungsverfahren wird seitens des VLOG den Siegel-Nutzern jedoch angeraten. VERORDNUNG (EG) Nr. 1760/2000 in Verbindung mit nationalem Rindfleischetikettierungsgesetz und -verordnung Zulassung der Kontrollstelle durch Bundesanstalt für Landwirtschaft und Ernährung (BLE). Voraussetzung für die Zulassung ist die Erfüllung der Anforderungen der EN Eine Akkreditierung ist nicht vorgeschrieben. Mindestens jährlicher Kontrollbesuch beim Unternehmen. Zusätzlich in zehn Privater Standard mit Richtlinien für die Erzeugung, Verarbeitung und Vermarktung Zulassung der Kontrollstelle durch das Regierungspräsidium Gießen Mindestens jährlicher Kontrollbesuch beim Unternehmen. Zusätzlich in zehn FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 69

70 Zertifizierung/ Konformitätsbewertung Überwachung der Kontrolle Prozent der Unternehmen Stichprobenkontrollen Prozent der Unternehmen Stichprobenkontrollen Prozent der Unternehmen Stichprobenkontrollen Durch Kontrollstelle Durch Kontrollstelle Durch Kontrollstelle im Auftrag der Zeichenvergabestelle Überwachung durch zuständige Länderbehörden. Umfangreiche Meldepflichten der Kontrollstellen an die Überwachungsbehörden Überwachung durch die BLE. Umfangreiche Meldepflichten der Kontrollstellen an die Überwachungsbehörden Überwachung durch Regierungspräsidium Gießen. Umfangreiche Meldepflichten der Kontrollstellen an die Überwachungsbehörden Bis auf die Ohne Gentechnik -Kennzeichnung verfügen alle Systeme über folgende Elemente: Zulassung der Kontrollstellen auf Basis eines Anforderungskataloges Definition von Mindestkontrollanforderungen Überwachung der Kontrollstellen inklusive Meldeverfahren Zertifizierung Dieses Verfahren hat sich in den vergangenen Jahren bewährt und kann eine gute Grundlage für die Ausgestaltung eines Kontrollverfahrens einer Regionaldachmarke sein. Für die Durchführung von Kontrollen kann auf die bereits im Bereich von Bioprodukten oder der Rindfleischetikettierung tätigen Kontrollstellen verwiesen werden. Als Voraussetzung für die Durchführung der Kontrolle in diesen Produktbereichen müssen die Kontrollstellen die Anforderungen der EN erfüllen. Bezüglich der Zertifizierung muss der Inhaber der Regionaldachmarke entscheiden, ob er diese Aufgabe selbst wahrnimmt oder wie im Falle der Marke Geprüfte Qualität - HESSEN, eine dritte Stelle hiermit beauftragt. Unter dem Aspekt der Verwendung der Regionalkennzeichnung für Produkte, die bereits andere Siegel tragen (z. B. Bio-Siegel), sollten bereits durchgeführte Kontrollverfahren im Hinblick auf die Vermeidung einer Doppel-Kontrolle anerkannt und ggf. um für die Regionalkennzeichnung relevante Aspekte ergänzt werden. Im Rahmen eines Gespräches mit Handelsvertretern wurde die Problematik von Kleinsterzeugern angesprochen. Kleinsterzeuger sind insbesondere im Spezialitätenbereich (z. B. Wachteleier oder Honig) wichtige regionale Lieferanten. Aufgrund des häufig geringen Erzeugungsvolumens wären für solche Erzeuger die Kosten für eine eigenständige Anmeldung zu einem Kontrollverfahren ein Hinderungsgrund zur Teilnahme an einem solchen System. Eine Möglichkeit zur Lösung des Problems wäre die Einbindung der Kontrollen von Herstellern, die nur selbst erzeugte Ware in ein solches System liefern, in die Kontrolle des abnehmenden Betriebes. Zusammenfassung Für eine für den Verbraucher transparente Regionalkennzeichnung ist das Vorhandensein eines glaubwürdigen Kontroll- und Zertifizierungssystems notwendig. Das Kontroll- und Zertifizierungssystem sollte ein mehrstufiges System sein, bestehend aus Eigenkontrolle, neutraler Kontrolle und der Kontrolle der Kontrolle. Die Mindestanforderungen sollten die Kontrolle der Einhaltung der Produktionsregeln, die Kontrollhäufigkeit, die Kontrollmethode und die Kontrolltiefe entlang einer Wertschöpfungskette beinhalten. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 70

71 6.3.6 Verifizierung der Herkunftsaussagen Kernaussage von Regionalsiegeln ist die Zusicherung der Herkunft der Rohwaren aus einer bestimmten Region sowie der Herstellung der Produkte in einer bestimmten Region. Um die Einhaltung der regionalen Rohwarenherkünfte und Verarbeitung zu dokumentieren sowie transparent und verifizierbar zu machen, bietet sich eine lückenlose Rückverfolgbarkeit durch Dokumentation der Rohwarenherkünfte und der Produktionsprozesse entlang der Wertschöpfungskette an. Zwar gibt es eine gesetzliche Vorgabe für die Rückverfolgbarkeit von Produkten, sie beinhaltet jedoch keine Vorschriften für die praktische Umsetzung. Ein privatwirtschaftlicher Ansatz der Umsetzung ist die datenbankbasierte Rückverfolgbarkeit. Datenbanktechnische Rückverfolgbarkeit Mittels einer internetbasierten Datenbank kann eine Rückverfolgbarkeit der Produkte bis zum Erzeuger gewährleistet werden. Voraussetzung für dieses System ist die Kennzeichnung der Produkte mit einem eindeutigen Code. Beispiele für solche Systeme sind die KAT-Datenbank für Eier (, die Rückverfolgbarkeitsdatenbank der Bio mit Gesicht GmbH ( und der fish & more GmbH ( Abbildung 21: Internetseiten zur Rückverfolgbarkeit von Lebensmitteln Diese Systeme ermöglichen eine Rückverfolgbarkeit im Beschwerde- oder Krisenfall für die betroffenen Unternehmer, beteiligte Kontrollstellen sowie die Markeninhaber und bieten gleichzeitig die Basis für eine Kundenkommunikationsplattform, die im Bereich von Produkten mit Regionalkennzeichnung unerlässlich ist. Analytische Herkunftsverifizierung Als ein neuer, ebenfalls privatwirtschaftlicher Ansatz zur Verifizierung der Herkunft, kann die Methode der Herkunftsanalyse angesehen werden. Die Verifizierung von regionalen Herkünften mittels Untersuchung des Verhältnisses von stabilen Isotopen ( Wasserzeichen ) bietet eine gute Möglichkeit, die Rohwarenherkünfte abzusichern. Inhalt eines parallel laufenden Projektes in Unterfranken und Hessen ist die Prüfung der Praxistauglichkeit der Isotopenanalytik zur Verifizierung von Herkunftsangaben. Basierend auf den Ergebnissen des Projektes wird die Möglichkeit der Verwendung der Isotopenanalytik als ergänzende Maßnahme zur Absicherung der Rohstoffherkünfte für mit dem Regionalzeichen gelabelte Produkte erörtert. Die notwendige Basis dafür ist der Aufbau einer Datenbank, in der die unterschiedlichen Isotopenmuster landwirtschaftlicher Produkte aus den verschiedenen Regionen (deutschlandweit, später weltweit) als Referenzmuster hinterlegt werden. Die Datenbank steht mit ihrem öffentlichen Bereich allen Interessierten zur Verfügung. Gleichzeitig ist die FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 71

72 Hinterlegung von Referenzdaten in der Datenbank notwendiger Teil eines ganzheitlichen Qualitätssicherungssystems entlang der gesamten Lebensmittel-Wertschöpfungskette. In der Datenbank werden die regionalen Isotopenmuster des Wassers, welches in allen Lebensmitteln vorhanden ist, gesammelt. Als Regionen werden die naturräumlichen Gebiete, definiert nach der Aufteilung des Bundesamt für Naturschutz (1994), angenommen. Diese naturräumlichen Gebiete (für Deutschland 72) haben den Vorteil, dass sie durch abiotische und biotische Faktoren definiert sind und unabhängig von politischen Grenzen innerhalb Deutschlands bestimmt werden. Abbildung 22: Konzept Wasserzeichen Zukünftiger Anwendungsbereich der Referenzdatenbank kann zum Beispiel die Beantwortung der nachfolgenden Fragen sein: Deklariertes Herkunftsland: Kommt der Spargel tatsächlich, wie deklariert, aus Deutschland oder könnte es sich auch um Ware aus Südeuropa handeln? Deklarierte Region: Stammt das Putenfleisch, wie deklariert, aus Norddeutschland? Deklarierter Erzeugerbetrieb: Wurden die Kartoffeln tatsächlich auf den Feldern des angegebenen Produzenten geerntet oder könnte es sich auch um zugekaufte Ware handeln? Im Falle eines Lebensmittelskandals: Stammen die Eier tatsächlich aus einer bestimmten Region oder von einem bestimmten Betrieb? Im Falle einer öffentlich gewordenen Reklamation: Stammt dieses Produkt tatsächlich aus dem deklarierten Betrieb? Vergleichbare Systeme wurden schon für die Bereiche Spargel (vgl. und Holz ( pdf) entwickelt. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 72

73 7 Erfassung der Wünsche der Akteure Um die verschiedenen Vorstellungen zu dem Thema Kriterienentwicklung für ein bundesweites Regionalsiegel zu erfassen, wurde mit den wichtigsten Vertretern der verschiedenen Akteursgruppen gesprochen. So gab es Gesprächsrunden mit dem Bundesverband der Regionalbewegung, dem BVL als Dachorganisation des Lebensmitteleinzelhandels, dem BÖLW als Dachorganisation der Biobranche und dem hessischen Verbraucherschutz. Durch die Mitglieder der Bietergemeinschaft waren auch die Meinungen der meisten Länderzeichen- Träger vertreten. Zur Vervollständigung wurden die verschiedenen Stellungnahmen und Positionspapiere der verschiedenen Akteure mitberücksichtigt. Die Protokolle der Gespräche, Stellungnahmen und Positionspapiere sind im Anhang aufgeführt. Auf einer Beiratssitzung wurden die verschiedenen Positionen der Akteure nochmals überprüft und, wo notwendig, korrigiert. Die Teilnehmerliste und das Protokoll der Beiratssitzung sind im Anhang aufgeführt (siehe Anhang 12.3, Protokoll Beiratssitzung vom ). Auf dieser Basis entstanden die nachfolgenden Positionsbeschreibungen der einzelnen Akteursgruppen für eine Kriterienentwicklung für ein bundesweites Regionalsiegel. Verbraucherschützer Die Verbraucherschutzorganisation wünscht sich eine klare gesetzliche Regelung des Themas Regionalität. Hierbei sollen die drei Kriterien Regionaldefinition, Rohstoffherkunft und Herstellungs-/Verarbeitungsort rechtlich geregelt werden. Als Kriterien für den Rohstoffbezug sollen die Monoprodukte zu 100 Prozent aus der Region stammen und bei zusammengesetzten Produkten muss der Rohstoff zu 95 Prozent aus der definierten Region stammen. Die Verarbeitung muss ebenfalls in der Region stattfinden. Die Überprüfung der Einhaltung der Regeln soll durch ein unabhängiges Kontrollsystem mit staatlicher Überwachung erfolgen (siehe Anhang 12.11, Positionspapier VZ). Handel/BVL Die Vertreter des Handels wünschen sich eine stärkere Ausschöpfung und Nutzung der bestehenden Regelungen, bis auf EU-Ebene. Dabei sind sie an der Beibehaltung bzw. Ausweitung der schon existierenden Regionalzeichen der Länder interessiert. Es wurde der Wunsch geäußert, dass alle Bundesländer vergleichbare Ländersiegel wie Hessen und Baden- Württemberg erhalten, damit diese wie bei EDEKA genutzt werden können. Unterstützt werden sollen die zukünftigen Regionalaktivitäten des Handels durch eine freiwillige Umsetzung von mehr Transparenz und einer Informationskampagne zum Verbraucher. Zusätzliche Kontrollen im Rahmen der Regionalauslobung sind nicht gewünscht, die bisherigen Systeme seien ausreichend, die finanzielle Mehrbelastung von kleinen Herstellern soll vermieden werden (siehe Anhang 12.9, Positionspapier BVL vom ). Länder Die Vertreter der Regionalzeichen der Länder wünschen sich eine kompatible Regionaldefinition zu ihren eigenen Definitionen. Wichtig ist dabei die Einführung von Mindestkriterien für den Rohstoffbezug und den Herstellungs-/Verarbeitungsort der regionalen Produkte sowie ein neutrales mehrstufiges Kontrollsystem. Aus Sicht der Länder wäre die FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 73

74 Erstellung eines Kriterienkataloges mit bundesweit einheitlichen Mindeststandards für die Verwendung von Regionalzeichen bzw. Qualitätszeichen wünschenswert (siehe Anhang 12.10, Protokoll AMK vom ). Biobranche Der BÖLW als Vertreter der Biobranche wünscht sich eine klare Definition, was ein regionales Lebensmittel ist. Dies umfasst eine regionale Eingrenzung sowie einen Mindestanteil von regionalem Rohstoff in der Rezeptur. Das Kontrollsystem sowie die Auslobung der Regionalität müssen aus Verbrauchersicht neutral und überprüfbar sein. Aus Sicht der Bioverbände ist ein weiteres staatliches Zeichen nicht gewünscht, ebenso bedarf es keiner weiteren Aufladung durch zusätzliche Kriterien wie Tierwohl oder Nachhaltigkeit. Wünschenswert wäre die weitere Förderung regionaler Wirtschaftskreisläufe (siehe Anhang 12.12, BÖLW vom ). Lebensmittelhandwerk/Lebensmittelhersteller Die Vertreter des Lebensmittelhandwerks und der Lebensmittelhersteller (BVE Bundesvereinigung der Deutschen Ernährungsindustrie e.v., VdF Verband der Fleischwirtschaft e.v., BVEO Bundesvereinigung der Erzeugerorganisationen Obst und Gemüse e.v. und VDM Verband Deutscher Mühlen e.v.) stehen einem bundesweiten Regionalsiegel eher ambivalent gegenüber. So sollte die Wirtschaft, wenn überhaupt, Träger eines Regionalzeichens sein. Die Nutzung des Zeichens sollte freiwillig sein. Die Kriterien sollen nicht zu eng gefasst werden. Es soll keine zu kleinräumige Regionendefinition geben sowie keine prozentuale Festlegung des Rohstoffbezuges oder des Verarbeitungsortes. Ein bundesweites Regionalsiegel soll nicht durch weitere Zusatzkriterien wie Nachhaltigkeit oder Tierwohl aufgeladen werden. Für die Einführung eines solchen Regionalsiegels sollte es eine staatliche Förderung geben (siehe Ergebnis Expertenbefragung, Kapitel 9). Bundesverband der Regionalbewegung e.v. (BRB) Der BRB, als Vertreter von marktbedeutenden Regionalinitiativen, wünscht sich ein Regionalsiegel, welches in einem ersten Schritt ausschließlich an Regionalinitiativen vergeben wird. Die Vergabekriterien sollen eine schlüssige und sinnvolle Regionenabgrenzung besitzen, Monoprodukte kommen zu 100 Prozent aus der Region, bei zusammengesetzten Produkten sollen die Rohstoffe weitestgehend aus der Region stammen, bei der Verarbeitung sollen so viele Akteure wie möglich einer Wertschöpfungskette aus der definierten Region stammen (Ausnahmen sind möglich). Die Vermarktung der Produkte soll überwiegend in der definierten Region stattfinden, um die Wertschöpfung in der Region zu behalten. Die Einhaltung der Kriterien soll durch interne und externe Kontrollen, als privatrechtliches Zertifizierungssystem, gewährleistet werden. Zusätzlich fordert der BRB auf EU-Ebene fakultative Qualitätsangaben für den Begriff Region und regional, sodass missbräuchliche Verwendung der Begrifflichkeiten geahndet werden kann (siehe Anhang 12.5, Positionspapier BRB vom ). FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 74

75 Abbildung 23: Positionsebenen der Regionalakteure Abschlussbericht FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 75

76 Zusammenfassung Die Wünsche und Forderungen der einzelnen Akteure an die Kriterienentwicklung für ein bundesweites Regionalsiegel reichen von klaren staatlichen Regelungen über ein privatrechtliches, freiwilliges System bis zur moderaten Anpassung des Status quo durch das BMELV. Auch bei der Beschreibung der verschiedenen Kriterien sind keine Gemeinsamkeiten aufgetreten. Hier reichen die Vorstellung von 100 Prozent (Monoprodukte)/95 Prozent (zusammengesetzte Produkte) des Rohstoffbezugs aus der Region bis hin zu Formulierungen wie weitestgehender Rohstoffbezug aus der Region. Auch bei der Frage eines Kontroll- und Zertifizierungssystems wird eine Bandbreite von staatlicher Überwachung bis zur Selbstkontrolle gefordert. Die schon oben aufgeführte Vielfalt bei den verschiedenen Akteuren lässt sich am besten an einer Übersicht der verschiedenen Kriterienmodelle aufzeigen. Die nachfolgende Übersicht zeigt vereinfacht die Wünsche der Akteure auf, wie und welche Kriterien aus ihrer Sicht notwendig wären. Wobei jedes Kriterienmodell schon einer aktuellen Handlungsweise der verschiedenen Akteure entspricht. Modell 1 Ganzheitliches Modell hat eine kleinräumige Regionendefinition (kleiner als ein Bundesland), bezieht die Vorstufe der Landwirtschaft mit ein und verlangt beim Rohstoffbezug eine Verwendung von 95 bis 100 Prozent regionaler Rohstoffe. Sowohl die Verarbeitung als auch die Vermarktung muss in der Region stattfinden. Weitere Zusatzkriterien sind verpflichtend. Modell 2 Wertschöpfung in der Region sieht eine klare Regionendefinition vor, die kleiner als die Bundesrepublik Deutschland ist (also Bundesland oder kleiner) und integriert die Vorstufe ebenso mit in das System. Auch der Rohstoffbezug ist mit 95 bis 100 Prozent aus der Region geregelt, genauso wie die Verarbeitung in der Region zu erfolgen hat. Jedoch wird kein Wert auf eine ausschließliche Vermarktung in der Region und auf Zusatzkriterien gelegt. Modelle 3 und 4 aus der Region für die Region beschreiben den Ansatz einer klaren Regionenbegrenzung unterhalb der Grenzen der Bundesrepublik Deutschland, jedoch ohne Berücksichtigung der landwirtschaftlichen Vorstufe und einer klaren Regelung der Produktionstiefe. Der Rohstoffbezug kann in einer Bandbreite von 50 bis 95 Prozent aus der Region erfolgen. Verarbeitung in der Region ist gewünscht, jedoch nicht verbindlich. Alle weiteren Vorgaben sind offen. Modell 5 Erzeugung in der Region verlangt nur einen Rohstoffbezug zwischen 50 bis 95 Prozent aus der Region. Modell 6 Verarbeitung in der Region sieht nur die Verarbeitung in der Region vor, ohne den Rohstoffbezug zu regeln. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 76

77 Tabelle 18: Übersicht Kriterienmodelle Kriterienmodell 1 Ganzheitliches Modell 2 Wertschöpfung in der Region 3 aus der Region für die Region 4 aus der Region für die Region - flexibel 5 Erzeugung in der Region 6 Verarbeitung in der Region Abgrenzung der Region kleinräumig, natürliche Grenzen, kleiner als ein Bundesland kleiner Deutschland kleiner Deutschland kleiner Deutschland kleiner Deutschland kleiner Deutschland Vorstufen der Landwirtschaft Produktionstiefe Landwirtschaft (z. B. Geburt, Aufzucht, Mast) Anteil Rohstoffe Zusatzkriterien Monoprodukte Zusammengesetzte Produkte Gesamt/Hauptzutat Verarbeitung in der Region Verbindliche Vermarktung in der Region ja alles 100 % > 95 % / 100 % ja ja ja, z. B. ohne Gentechnik, Bio etc. ja alles 100 % > 95 % / 100 % ja nein nein nein überwiegend 100 % > 51 % / 100 % wenn möglich nein nein nein überwiegend > 90% > 51 % /100 % wenn möglich nein nein nein überwiegend > 90 % > 51 % / 100 % nein nein nein nein nein nein nein ja ja nein FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 77

78 8 Szenarienbildung Als Ergebnis der gesamten Ist-Analyse wurden die vier nachfolgenden Szenarien als mögliche Umsetzungswege entwickelt. Diese Szenarien wurden mit den einzelnen Akteuren abgestimmt und entsprechen in den wesentlichen Zügen den Vorstellungen der verschiedenen Akteursgruppen. Die Vorstellung der Verbraucherschutzorganisationen mit einer staatlichen/gesetzlichen Regelung als weiteres Szenario wurde nicht weiter verfolgt, da das BMELV einen staatlichen Weg ausgeschlossen hat. Die ersten Ansätze der Szenarien Anerkennung, Regionalsiegel und Regionalfenster wurden dem BMELV am vorgestellt und ausführlich besprochen. Als Ergebnis wurde festgehalten (siehe Anhang 12.2, Protokoll BMELV vom ): Das Szenario Regionalsiegel erscheint am einfachsten zu kommunizieren. Eine Umsetzung durch die Wirtschaft erscheint jedoch nicht realistisch. Es wird dementsprechend nicht weiter verfolgt. Das Szenario Regionalfenster erscheint als eine attraktive Lösung und soll weiterentwickelt werden. Szenario Anerkennung soll ebenso optional weiter ausgearbeitet werden. Durch die intensiven Gespräche mit dem Handel wurde das zusätzliche Szenario Anpassung/Koordination mit aufgenommen. Abbildung 24: Darstellung der Umsetzungswege Die erarbeiteten Szenarien stellen ein Grundgerüst dar und sollten in einem Praxistest auf die praktikable Umsetzung überprüft werden. Bei der Erarbeitung der notwendigen Mindestkriterien für die Regionalität, vor allem in den beiden zu vertiefenden Szenarien, wurde stets abgewogen, ob der Anspruch besteht, möglichst viele existierende Initiativen/Systeme einzubinden oder ob die Vorgaben so streng gewählt werden, dass nur wenige Initiativen/Systeme das entsprechende Szenario nutzen können. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 78

79 Wählt man einfach zu erfüllende Kriterien, können zwar sehr viele bereits bestehende Initiativen oder Handelsmarken daran teilnehmen. Doch Initiativen, die für sich in Anspruch nehmen, hohe Standards zu erfüllen, werden ein bundesweites Regionalzeichen dann tendenziell eher nicht nutzen. Deshalb wurde es bei der Entwicklung der Mindestkriterien für die beiden Szenarien Anerkennung und Regionalfenster als sinnvoll erachtet, sich an bestehenden Systemen zu orientieren. Sie haben zum einen eine gewisse Marktbedeutung und zum anderen praxis- und verbrauchergerechte Standards entwickelt. Wie bereits zuvor beschrieben, erwartet der Verbraucher von einem regionalen Produkt, dass vor allem die Rohstoffe aus einer definierten Region kommen und die Verarbeitung in der Region stattgefunden hat. Als notwendige Voraussetzung zur Entwicklung von Mindestkriterien werden klare Definitionen zur Regionenabgrenzung, zur Produktionstiefe der Landwirtschaft, dem Anteil des Rohstoffbezuges aus der definierten Region und dem Standort der Verarbeitung angesehen. Auf Basis dieser Vorgaben sind die nachfolgenden Szenarien entwickelt worden. 8.1 Szenario Anpassung/Koordination Das Szenario Anpassung/Koordination geht vom Status quo der Ländersiegel in Hessen, Baden-Württemberg, Rheinland-Pfalz, Saarland und den regionalen Handelsmarken, die eine Kooperation mit diesen Länderzeichen haben, aus. Dabei werden die schon bestehenden EU-notifizierten Kennzeichnungssysteme für Qualitätsprodukte aus regionalen Herkünften genutzt, wie zum Beispiel die regionalen Länderzeichen der oben genannten Bundesländer. Diese EU-konformen Regelwerke sollen allen anderen Bundesländern aktiv zur freiwilligen Verwendung angeboten werden. Diese aktive Vorgehensweise soll durch die Moderation des BMELV beziehungsweise eines Dienstleisters erfolgen, der den Ländern die Chancen regionaler Qualitäts- und Herkunftszeichen und der zukünftigen europäischen Qualitätspolitik aufzeigt (z. B. VO (EG) 510/2006). Als Beispiel für diese Vorgehensweise wird die erfolgreiche Übernahme des notifizierten Herkunfts- und Qualitätsprogramms von Baden Württemberg in Rheinland-Pfalz angesehen. Während des Moderationsprozesses soll eine Anpassung der bestehenden Kriterienkataloge an die Gegebenheiten des jeweiligen Bundeslandes erfolgen, wobei das Anpassungsziel die Mindestkriterien von Hessen und Baden-Württemberg sein sollen. Der gewünschte Moderationsprozess soll von einer gemeinsamen Kommunikationskampagne, getragen von Bund und Länder, begleitet werden, um Regionalinitiativen verschiedene Umsetzungsoptionen für regionale Ansätze aufzuzeigen, wie zum Beispiel die Individualisierung der Kennzeichnungssysteme auf ihre Region (siehe z. B. PLENUM-Gebiete). Optional können Zusatzkriterien, die über dem Herkunfts- und Qualitätsprogramm des entsprechenden Bundeslandes liegen, verwendet werden. Durch die bestehenden Regelwerke ergibt sich die Möglichkeit einer EU-konformen öffentlichen Förderung, zum Beispiel durch einen Landkreis oder einen Naturpark. Aus Kostengründen werden die bereits vorhandenen Kontroll- und vor allem Akkreditierungssysteme genutzt, um eine höhere Akzeptanz der potenziellen Verwender, wie etwa die Handelsunternehmen, zu gewinnen. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 79

80 8.2 Szenario Anerkennung Das Szenario Anerkennung geht von einer klassischen Dachmarkenstrategie aus. Eine Dachmarke ist eine übergeordnete Marke eines Markensystems. Es hat den Vorteil eines hohen Wiedererkennungswertes durch eine hohe Reichweite. Das positive Image von einer Dachmarke kann auf die Einzelmarken übertragen werden. Die Dachmarke ist als ergänzendes Element zu bestehenden Systemen zu sehen. Zielgruppe für dieses Szenario sind schwerpunktmäßig bestehende Regionalinitiativen, aber auch die Qualitäts- und Herkunftszeichen der Bundesländer sowie Handels- und Herstellermarken. Das Szenario Anerkennung beschreibt die notwendigen Rahmen- bzw. Mindestkriterien, die für die Vergabe des Dachzeichens an Regionalinitiativen/Markeninhaber notwendig sind. Dazu gehören auch die Vorgaben für ein erforderliches Zertifizierungssystem sowie ein Anerkennungsrat, der die Einhaltung der Kriterien bei den verschiedenen Institutionen überprüft (Anerkennung/Akkreditierung). Die Mindestkriterien im Szenario Anerkennung umfassen auch Definitionen zur Regionenabgrenzung, zur Produktionstiefe der Landwirtschaft, dem Anteil des Rohstoffbezuges aus der definierten Region und dem Standort der Verarbeitung. Mindestkriterien für die Vergabe eines Dachzeichens sind: Abgrenzung der Region Die Region muss klar abgegrenzt und kleiner als Deutschland sein. Produktionstiefe Landwirtschaft Der überwiegende Teil der landwirtschaftlichen Urproduktion muss in der angegebenen Region stattgefunden haben (Beispiel Schweinefleisch: Die gesamte Schweinemast muss in der Region erfolgen, die Geburt kann in einer anderen Region erfolgen). Anteil Rohstoffe bei Monoprodukten 100 Prozent der Hauptzutat muss aus der angegebenen Region kommen. Anteil Rohstoffe bei zusammengesetzten Produkten 100 Prozent der Hauptzutat muss aus der angegebenen Region kommen. Macht die Hauptzutat weniger als 50 Prozent an der Gesamtmasse des Produktes aus, so müssen auch weitere Zutaten aus der angegebenen Region kommen, bis mindestens 50 Prozent der Gesamtmenge. Wasser gilt nicht als Hauptzutat und wird somit nicht beachtet (Beispiel Bier: Wasser an erster Stelle im Zutatenverzeichnis, die relevante Hauptzutat für die Regionalität ist jedoch Gerste/Malz). Verarbeitung Die Verarbeitung muss in der angegebenen Region stattfinden. Nur in Ausnahmefällen, wenn keine geeigneten Verarbeitungsstätten in der Region vorhanden sind, kann die Verarbeitung auch in angrenzenden Regionen stattfinden. Zusatzkriterien Zusatzkriterien wie die Vermarktung in der Region, Einbeziehung der Vorstufen der Landwirtschaft (z. B. Futtermittel) oder Auslobung ohne Gentechnik bleiben für die Vergabe eines Dachzeichens unberücksichtigt. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 80

81 Vorgaben für das Kontroll- und Zertifizierungssystem bei einer Vergabe eines Dachzeichens: Für die Vergabe des Dachzeichens an Regionalinitiativen oder Regionalmarkeninhaber müssen diese ein eigenes Kontroll- und Zertifizierungssystem haben, das dem klassischen dreistufigen Kontrollsystem entspricht. Ein klassisches dreistufiges Kontrollsystem besteht aus: Eigenkontrolle Neutrale Kontrolle Kontrolle der Kontrolle Die Eigenkontrolle muss eine umfangreiche Dokumentation der Prozesse, eine transparente Darstellung der Warenströme und definierte Kontrollpunkte aufweisen. Dies gilt nicht nur für den einzelnen Erzeuger, sondern auch für die gesamte Wertschöpfungskette. Es muss klare Vorgaben für Umfang und Häufigkeit der Eigenkontrolle geben, inklusive der Kontrollhäufigkeit für alle Stufen der Wertschöpfungskette sowie Sanktionsvorgaben für die Teilnehmer. Regelmäßige Vor-Ort-Überprüfung durch neutrale Kontrollstellen mit anschließender Zertifizierung der Teilnehmer muss gegeben sein. Die beauftragten neutralen Kontrollstellen müssen den Vorgaben der DIN EN entsprechen. Die Anerkennung der verschiedenen Kontrollsysteme bei den unterschiedlichen Teilnehmern, Regionalinitiativen oder Regionalmarkeninhabern beziehungsweise die Überprüfung der durchgeführten externen Kontrollen sowie die Arbeit der zertifizierenden Stellen müssen von einer dritten Stelle überprüft werden. Diese dritte Stelle hat die Aufgabe, formal darzulegen, dass die Kontroll- und Zertifizierungsstellen die Kompetenz besitzen, bestimmte Konformitätsbewertungsaufgaben durchzuführen. Die dritte Stelle könnte ein selbst gewähltes Organ sein, das die Anerkennung ausspricht, oder es erfolgt die Akkreditierung durch die Deutsche Akkreditierungsstelle DAkkS. Das selbst gewählte Organ (Anerkennungsrat), das sich zu gleichen Teilen aus Vertretern der Regionalinitiativen, Herstellern/Erzeugern/Handwerk und Verbraucherschutzorganisationen zusammensetzt, übernimmt auch die Verwaltung beziehungsweise die Weiterentwicklung des Dachzeichens und ist gleichzeitig Dachmarkeninhaber. Lizenzvertrag Der Dachmarkeninhaber wird zur Absicherung der Dachmarke mit allen Teilnehmern einen Lizenzvertrag über die Nutzung der Marke abschließen. Die Arbeit des Anerkennungsrates finanziert sich durch die anfallenden Lizenzgebühren. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 81

82 Abbildung 25: Kontroll- und Vergabemodell einer Akkreditierung 8.3 Szenario Regionalsiegel Das Szenario Regionalsiegel geht von einer klassischen Siegelstrategie aus. Ein Siegel ist eine Beglaubigung. Es wird beglaubigt, dass der Siegelnutzer eine bestimmte Voraussetzung, wie die Einhaltung von Kriterien (z. B. Einhaltung der EG-Verordnung Nr. 834/2007 = Bio- Siegel), erfüllt hat. Die Vergabe des Siegels basiert auf der Vorlage eines Zertifikats. Ein Siegel kann mit anderen Zeichen, Marken oder Siegeln verwendet werden, es kann aber auch alleine stehen. Das Szenario Regionalsiegel umfasst die notwendigen Vergabekriterien und die Vorgaben, die ein Kontroll- und Zertifizierungssystem erfüllen muss. Mindestkriterien für die Vergabe eines Siegels Der Siegelnutzer muss nachweisen, dass er folgende Voraussetzungen erfüllt: klare Regionenbeschreibung einen prozentualen Rohstoffbezug aus der definierten Region eine Aussage zum Verarbeitungsort ein neutrales Kontroll- und Zertifizierungssystem Durch ein entsprechendes Zertifikat kann das Siegel vergeben werden. Vergabeverfahren Ein zu bildender Vergaberat, der auch gleichzeitig Siegelinhaber ist, vergibt über einen Lizenzund Nutzungsvertrag das Regionalsiegel. Der Vergaberat ist ebenso für die Weiterentwicklung und Kommunikation, inklusive der Einführung des Siegels verantwortlich. So kann er eine Abstufung des Siegels vornehmen, indem er etwa unterschiedliche Stufen für den regionalen FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 82

83 Rohstoffbezug festgelegt, wie zum Beispiel 50 Prozent, 70 Prozent und 90 Prozent regionaler Rohstoffbezug und dies durch eine farbliche Differenzierung symbolisiert. Abbildung 26: Kontroll- und Vergabemodell eines Siegels 8.4 Szenario Regionalfenster Das Szenario Regionalfenster verfolgt den Ansatz einer Herkunftsdeklaration. Der Begriff Deklaration (lat. declaratio: Kundmachung, Offenbarung) im wirtschaftlichen Gebrauch ist eine Inhalts- oder Wertangabe eines Handelsgutes (z. B. Zutatenliste gemäß Lebensmittel- Kennzeichnungsverordnung). Das Szenario Regionalfenster beschreibt die Vorgehensweise der Herkunftsdeklaration sowie die notwendigen Rahmen- beziehungsweise Mindestkriterien inklusive des Kontroll- und Zertifizierungssystems, die für die Nutzung des Regionalfensters notwendig sind. Vorgehensweise im Szenario Regionalfenster Das Regionalfenster ist nicht als zusätzliches Markenzeichen zu verstehen, sondern als konkretes Informationsfeld neben der Zutatenliste, in dem die Herkunft der Zutaten deklariert werden kann. Das Informationsfeld besteht aus drei Bereichen: dem Claim/der Aussage (z. B. aus der Region oder Woher kommen die Zutaten ); der Auslobung beziehungsweise dem Informationsfeld (z. B. die Herkunft der ersten drei Zutaten aus dem Zutatenverzeichnis, der Herstellungs-/Verarbeitungsort und/oder der Rohstoffbezug); dem Hinweis auf die neutrale Überprüfung der im Informationsfeld getätigten Auslobung. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 83

84 Vergaberahmen des Regionalfensters Für die Nutzung des Regionalfensters müssen die nachfolgenden Rahmenbedingungen erfüllt werden: Abgrenzung der Region und des Rohstoffbezuges: Die Region muss klar benannt werden und kleiner als die Bundesrepublik Deutschland sein. Die erste Hauptzutat muss aus dieser Region stammen. Beträgt die Hauptzutat weniger als 50 Prozent des Gesamtgewichts, so müssen weitere Zutaten aus der Region stammen, bis die 50 Prozent erreicht sind. Vorhandensein eines Qualitätssicherungssystems mit nachvollziehbarer Dokumentationspflicht beziehungsweise eines neutralen Kontroll- und Zertifizierungssystems. Die Vergabe des Regionalfensters erfolgt nach Überprüfung der angemeldeten Auslobung im Informationsfeld. Die Überprüfung erfolgt auf Basis einer neutralen jährlichen Prozesskontrolle, die beispielsweise durch einen analytischen Herkunftsnachweis mit Hilfe stabiler Isotopen ergänzt werden kann. Für die Vergabe und die Beauftragung der neutralen Überprüfung wird ein Vergabeverein gegründet, in dem das Stimmverhältnis der Mitglieder aus einem Drittel Erzeuger/Verarbeiter, einem Drittel Handel und einem Drittel Verbrauchervertretern besteht. Der Vergabeverein ist auch Zeicheninhaber und zuständig für die Betreuung und Weiterentwicklung des Regionalfensters. Dazu gehört auch die notwendige Kommunikation zur Einführung des Regionalfensters. Abbildung 27: Kontroll- und Vergabemodell des Regionalfensters FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 84

85 Zusammenfassung Die vier aufgeführten Szenarien verfolgen grundsätzlich unterschiedliche Ansätze und spiegeln teilweise die Wünsche und Positionen der verschiedenen Akteure wider. Das Szenario Anpassung/Koordination umschreibt ein gemeinschaftliches Vorgehen von Bund und Länder mit dem Ziel, bestehende Regelwerke der Länder für alle Bundesländer einzuführen bzw. anzupassen. Bei diesem Szenario besteht die Schwierigkeit, die politischen Wünsche der Akteure mit der politischen Wirklichkeit und den Möglichkeiten des BMELV in Einklang zu bekommen, besonders in Bezug auf die hoheitlichen Rechte zwischen den Ländern und des Bundes. Das Szenario Anerkennung umschreibt eine Dachmarkenstrategie, hinterlegt mit einem Akkreditierungsmodell und definierten Mindestkriterien. Es dient zur zusätzlichen Anerkennung bereits bestehender Regionalinitiativen. Nicht geklärt ist hier die Frage der Einführungskosten, die eine solche Dachmarkenstrategie benötigt, um beim Verbraucher überhaupt wahrgenommen zu werden. Das Szenario Regionalsiegel umschreibt eine Siegelstrategie mit einem mehrstufigen Kontrollsystem. Dabei kann das Siegel eigenständig, losgelöst von bestehenden Regionalzeichen eingesetzt werden. Die Vergabe kann durch ein Stufenmodell, z. B. Höhe des prozentualen Rohstoffbezuges, differenziert werden. Hier wurde ebenfalls die Frage der Einführungskosten nicht berücksichtigt, die für die Bekanntmachung eines Siegels notwendig sind (siehe Einführungskosten Bio-Siegel). Da in einem frühen Stadium dieses Szenario auf große Ablehnung stieß, wurde es nicht weiter verfolgt. Das Szenario Regionalfenster umschreibt eine Strategie der Herkunftsdeklaration mit Mindestkriterien sowie einem mehrstufigen Kontrollsystem gekoppelt, z. B. mit einem analytischen Herkunftsnachweis. Die Deklaration erfolgt über ein eigenständiges Informationsfeld, die darin getroffenen Aussagen werden neutral überprüft. Eine weitere Ausgestaltung kann erst mit den teilnehmenden Akteuren in der Praxis vorgenommen werden. Der Kostenaspekt der Einführung erscheint bei diesem Szenario deutlich niedriger zu liegen, da ein Deklarationsfenster selbsterklärend ist und daher einen geringeren Kommunikationsaufwand bedarf. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 85

86 9 Analyse des Potenzials eines bundesweiten Regionalsiegels Die Analyse des Potenzials eines bundesweiten Regionalsiegels sollte zum einen eine Analyse des Absatzpotenzials für Regionalprodukte beinhalten, um die potenziellen Mengenströme (u. a. nach Warenbereichen und Vertriebsschienen geordnet) zu quantifizieren, die einem bundesweiten Regionalsiegel zugrunde liegen können. Zum anderen gilt es, das Potenzial eines bundesweiten Regionalsiegels bei den Akteuren zu ermitteln. Hier sind eher grundsätzliche Beurteilungen und Einlassungen zu den Eckpunkten eines solchen Regionalsiegels von den maßgeblichen Marktakteuren gefragt. Das Absatzpotenzial für Regionalprodukte kann aufgrund fehlender belastbarer Marktforschungsergebnisse - insbesondere auf der Anbieterseite - nur in Ansätzen quantifiziert werden. Die vorliegenden, auch in jüngster Zeit angestellten Verbraucherbefragungen, beleuchten ausschließlich die Nachfrageseite und sind unter anderem für die Abschätzung von Trends hilfreich. Aus den Erfahrungen, die beispielsweise für die Abschätzungen der Entwicklung des Ökobereichs ab circa 1985 gemacht wurden - die Entwicklung wurde zum Teil auf Basis der jeweiligen Verbraucherbefragungen maßlos überschätzt -, sollte hier unbedingt die Anbieterseite integriert werden. Da eigenständige Marktforschungsarbeiten im Rahmen der Studie nicht vollzogen werden konnten, wurde eine Auswertung der vorliegenden Fachliteratur und der vorliegenden Fachstatistiken vorgenommen. Auf Basis dieser Auswertungen wurden - exemplarisch für einige wesentliche Warenbereiche und Vertriebsschienen des Lebensmittelbereichs - Hilfestellungen gegeben, die eine Einschätzung des Angebotspotenzials für Regionalprodukte erleichtern können. Es bleibt einer weiteren Beauftragung vorbehalten, belastbare Daten zur Quantifizierung des Absatzpotenzials zu erheben und auszuwerten. Im Nachgang der Analyse des Absatzpotenzials für Regionalprodukte wurde in einem weiteren Schritt die Potenzialermittlung für ein bundesweites Regionalzeichen vorgenommen. Ohnehin setzt die Potenzialermittlung für ein Zeichensystem eine Grobfestlegung der Zeichenkriterien und deren Aufgabenbestimmung voraus. Eine solche Festlegung gab es jedoch erst zum Ende des Vorhabens in Form zweier möglicher Alternativen, sodass schlussendlich nur eine sehr eingeschränkte Analyse vorgenommen werden konnte. Da wesentliche Akteursgruppen in der Anfangsphase schon eingebunden waren, erfolgte die weitere Befragung zur Akzeptanz in Form von Expertengesprächen bei den Sparten- und Spitzenverbänden BVE, BVEO, VDF und VDM. Diese Expertengespräche auf Basis eines Gesprächsleitfadens bilden die erfahrungsund praxisbasierten Beurteilungen, Einlassungen und Relativierungen ab. Sie erlauben keine abschließende Beurteilung, stellen aber eine Basis des vorhandenen Potenzials dar. 9.1 Analyse des Absatzpotenzials für Regionalprodukte Aufgabe der Recherche zur Fachliteratur und der vorliegenden Statistiken ist die Identifizierung belastbarer Forschungsergebnisse zur Frage des Absatzpotenzials für Produkte mit Regionalhintergrund und von Hinweisen auf das Potenzial eines bundesweiten Regionalsiegels. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 86

87 Eine Literaturauswertung 21 der ecco GmbH der Jahre 1994 bis 2007 hat ergeben, dass in dem genannten Zeitraum der zahlenmäßige Höhepunkt der Veröffentlichungen zu diesem Thema um die Jahrtausendwende liegt. Folgende Themen wurden im Kontext Regionalvermarktung bearbeitet: Management regionaler Vermarktungsansätze Kommunikationspolitische Themen Produkt- und Sortimentspolitiken Wertschöpfungsketten, distributionspolitische und logistische Fragestellungen Untersuchungen zu Preisbereitschaften für regionale Lebensmittel Untersuchungen zu regionalen Energiebilanzen Fragen zur Vernetzung/zur Bedeutung regionaler Kooperationen und Netzwerke Fragen zum richtigen Zuschnitt der Region(en) Regionalität, Nachhaltigkeit und Kultur Zusammenfassend halten die Autoren fest: Es wurde bereits einiges bearbeitet - aber nicht immer mit der als notwendig erscheinenden empirischen Fundierung 22. Die Durchsicht der als relevant angesehenen Studien im Beobachtungszeitraum von 2006 bis heute und deren datenbankbasierte Zuordnung zu Warengruppen und Vertriebsschienen (siehe Anhang 12.13, Matrix Potenzialanalyse) hat hinsichtlich der Fragestellung nach dem Potenzial für ein bundesweites Regionalsiegel nur wenig Erhellendes und nahezu keine belastbaren Quantifizierungen zutage gefördert. Von wenigen Ausnahmen abgesehen, handelt es sich um politisch intendierte Handlungsempfehlungen für Politik und Praxis auf Grundlage eines gefühlten Bedarfes. Unterschiedliche Auffassungen gibt es in der Literatur insbesondere zur Frage, welche Eigenschaften regionale Produkte aufweisen, beziehungsweise wofür Regionalvermarktung steht oder stehen sollte. Regionalität gibt dem Zeitgeist ein Zuhause, Regionalität ist ein frisches Produkt mit kurzen Transportwegen, keinesfalls aber ein ethisches Thema, so die DLG-Studie Ganz anders sehen das Autoren wie Wagenhofer 24 und Fahrner 25, die stellvertretend für die Autoren erwähnt werden, die Regionalität und regionale Produkte als Alternativentwurf zur wachstumsbasierten internationalen Arbeitsteilung, Globalisierung genannt, sehen. Von Kulturkampf über solides Herkunftsmarketing bis hin zur mogelnden Handelsmarke: Regionalität steht heute für vieles und entwickelt sich dynamisch. Zur Vereinfachung werden im Folgenden Produkte, deren regionale Herkunft als explizite Eigenschaft herausgestellt wird, als regionale Produkte bezeichnet. 21 Ecco GmbH, Zum Stand der Forschung, Vortrag Verbraucherzentrale Bundesverband - Seminar V 812 Regional erzeugte Lebensmittel: Trends, Definitionen, Qualität 19. Bis 21. Mai 2008 in Hannover. 22 ebda 23 DLG, Neue DLG-Studie: Regionalität aus Verbrauchersicht. 24 vgl. Wagenhofer, Gertraud, Globalisierung versus Regionalisierung: Lebensmittel zwischen Regionalisierung und Globalisierung. Innsbruck: Leopold-Franzens-Universität Innsbruck. 25 vgl. Fahrner, Andreas, Potentialanalyse für die b2b-vermarktung regionaler Lebensmittel im Wechselland. Diplomarbeit. Wien: Universität Wien. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 87

88 Dimensionierung der Absatzpotenziale nach Vertriebsschienen Zur dimensionsgerechten Einordnung regionaler Produkte wird zunächst die Vielfalt an Lebensmitteln beschrieben. Dazu dient der Blick in die Logistik/Warenwirtschaft: Ein Großteil aller gehandelten Food-Artikel ist mit Barcodes aus dem GS1-System versehen. Für den deutschen Markt werden dort zwischen und Food-Artikel gekennzeichnet. Von diesen werden beispielsweise durchschnittlich in/bei SB-Warenhäusern rd Großen Supermärkten rd Supermärkten rd Discountern rd Artikel vorgehalten, ein Indiz dafür, dass die wesentlichen Akteure im Handelsbereich sich dem Thema regionale Herkunft unter dem Aspekt Nischenmarketing nähern müssen. Des Weiteren werden die Versorgungsalternativen (Bezugsquellen) privater Haushalte für Lebensmittel aufgezeigt. Danach tragen die einzelnen Bereiche 27 zur Versorgung wie folgt bei 28 : Hersteller, Landwirte, Winzer, Beziehungskäufe 2,6 % Bäckereien, Konditoreien, Metzgereien 9,3 % C+C Großhandel 1,1 % Universaleinzelhandel 45,8 % Spezialeinzelhandel 14,3 % Versandhandel 0,2 % Verkaufswagen, Heimdienste, Wochenmärkte 2,2 % Gastronomie, Hotels, Kantinen, Imbiss 24,5 % Auch wenn regionale Produkte grundsätzlich über alle Absatzmittler vertrieben werden können, ist davon auszugehen, dass insbesondere der stationäre Einzelhandel mit einem Anteil von rund 60 Prozent ein gewichtiges Wort mitredet, wenn es um die Ausgestaltung von und seine Anforderungen an regionale Lebensmittel geht. Verbraucher berichten, dass sie vor allem im Supermarkt und in den Medien etwas über das Thema Regionalität hören 29. Es ist davon auszugehen, dass der Absatz explizit als regional beworbener Produkte ursprünglich vor allem über die Schienen Landwirte, Winzer, Verkaufswagen, Wochenmärkte, Gastronomie erfolgte. Der Beitrag des LEH nimmt stetig zu, dazu tragen Handelsmarken, Regionalecken, der Naturkosthandel und die Neuentdeckung bereits eingeführter Regionalprodukte wie etwa im Segment Getränke bei. Die deutsche Ernährungsindustrie, die den inländisch erzeugten Anteil an der Vielzahl der Food-Produkte verantwortet, befasst sich, wenn überhaupt, im Bereich der Markenführung oder 26 Lorry, Burkhard, SA2 Worldsync GmbH. Telefonische Auskunft am ohne Berücksichtigung der Selbstversorgung 28 Quelle: Dr. Lademann & Partner In: The Nielson Company (Germany) 2011 TOP-Firmen Quelle: DLG, Neue DLG-Studie: Regionalität aus Verbrauchersicht. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 88

89 im Rahmen von Premiumstrategien für den heimischen Markt mit der regionalen Herkunft und deren Auslobung. Landwirtschaftliche Direktvermarkter und kleinere Getreidemühlen sind im Wesentlichen per se regional, auch wenn diese Eigenschaft nicht bei allen hervorgehoben wird. Dieses gilt, wenn auch nicht im selben Umfang, für das Ernährungshandwerk. 9.2 Absatzpotenziale nach ausgewählten Wirtschaftszweigen der Land- und Ernährungswirtschaft Absatzpotenziale in ausgewählten Bereichen der Landwirtschaft Für den Bereich Landwirtschaft werden nachfolgend exemplarisch die landwirtschaftliche Direktvermarktung, Ökobetriebe, Ackerbaubetriebe (Getreideerzeugung) und Futterbaubetriebe/Tierhaltungsbetriebe vor dem Hintergrund ihres Absatzpotenzials für Produkte mit regionalem Hintergrund analysiert und quantifiziert Landwirtschaftliche Direktvermarktung Unter Berufung auf Recke und Wirthgen (2004a) und die ZMP (2002) geht Hasan 30 davon aus, dass in Deutschland circa landwirtschaftliche Betriebe ihre Produkte ohne Zwischenhändler absetzen, darunter seien circa professionelle Direktvermarkter ( ökologische und konventionelle Betriebe). Dies entspräche etwa 3,68 Prozent aller landwirtschaftlichen Betriebe, wenn man eine Gesamtzahl von ca Betrieben zugrunde legt. Geografisch verteilen sich die professionellen Direktvermarkter mit circa Betrieben auf Westdeutschland und mit Betrieben auf Ostdeutschland. Als Folge der Anzahl großer Betriebe gäbe es in einigen Regionen Ostdeutschlands, wie zum Beispiel in Berlin, Sachsen und Thüringen eine relativ starke Entwicklung in Richtung Direktvermarktung. Dagegen schätzt die Fördergemeinschaft Einkaufen auf dem Bauernhof die Zahl der direktvermarktenden Bauernhöfe in Ermangelung offizieller Statistik auf bis Betriebe 31. Auch Recke und Wirthgen 32 können nur grob schätzen : Sie beziffern die Zahl der Betriebe, bei denen die Direktvermarktung einen bedeutenden Anteil habe auf circa , bei denen es sich überwiegend um Vollerwerbsbetriebe handele 33. Das theoretische Potenzial liegt bei bis Betrieben Ökobetriebe Im Jahr 2010 bewirtschaften in Deutschland Betriebe Hektar landwirtschaftlich genutzte Fläche nach den Richtlinien des ökologischen Landbaus. Somit sind fast sechs 30 Hasan, Yousra, Einkaufsverhalten und Kundengruppen bei Direktvermarktern in Deutschland: Ergebnisse einer empirischen Analyse. Göttingen: Georg-August-Universität Göttingen. 31 Quelle: 32 Quelle: 33 vgl. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 89

90 Prozent aller Landwirtschaftsbetriebe dem Ökolandbau zuzurechnen und praktizieren diesen auf sechs Prozent der landwirtschaftlich genutzten Fläche. Dabei gibt es zwischen den Bundesländern erhebliche Unterschiede. Prozentual gesehen liegt der Anteil der Ökobetriebe in Mecklenburg-Vorpommern (15 Prozent) und Brandenburg (12 Prozent) am höchsten. Im Verhältnis zu diesen agieren die Landwirte in Niedersachsen (3 Prozent), Schleswig-Holstein (3 Prozent) und Nordrhein-Westfalen (4 Prozent) aus ökologischer Sicht eher zurückhaltend. Absolut gesehen wirtschaften sehr viele Ökobetriebe in Bayern (5.700), gefolgt von Baden- Württemberg (3.000), auch bedingt durch die hohe Gesamtzahl an Agrarbetrieben in diesen Bundesländern. 34 Bei entsprechender Ausgestaltung des bundesweiten Regionalsiegels käme ein Großteil der Ökobetriebe als Vorlieferanten in ein Herkunftszeichen-System infrage. Das theoretische Potenzial liegt bei Betrieben Ackerbaubetriebe - Getreide Rund 25 Prozent aller landwirtschaftlichen Betriebe sind auf den Marktfruchtanbau fokussiert 35. Diese rund Getreideerzeuger vermarkten im Wesentlichen an die Erfassungsstufe und/oder - in Gänze oder zu Teilen - direkt an Mühlen. Beide Gruppen kommen in der Funktion des Rohstofflieferanten als Systempartner für ein Regionalsiegel infrage. Voraussetzung ist dafür ein entsprechendes Engagement der nachgelagerten Stufen für einen vertikalen Verbund und dessen einladende Ausgestaltung. Limitiert ist die derart absetzbare Menge und dafür benötigte Zahl der Marktfruchtbetriebe a) vom Anteil der für die Vermahlung zur menschlichen Ernährung angebauten Getreidesorten und b) vom regionalen Absatz der Mühlen an Regionalmarketing treibende Mehlabnehmer. Das theoretische Potenzial liegt bei Betrieben Futterbaubetriebe/Tierhaltung Von direktvermarktenden Betrieben abgesehen können landwirtschaftliche Erzeuger nur im Rahmen von vertikalen Verbünden die regionale Karte spielen. Diese setzen in der Regel eine Zertifizierung voraus. Zur Abschätzung des Potenzials für ein bundesweites Regionalsiegel im Bereich der Schlachttierproduktion werden hier die Angaben der QS-Organisation 36 verwendet. Danach sind (Stand 2011) insgesamt Rinderhalter, Schweinehalter und Geflügelhalter nach QS-Kriterien zertifiziert. Nach eigenen Angaben beträgt die Marktdurchdringung bei den Rinderhaltern rund 60 Prozent, bei den Schweinehaltern und den Geflügelhaltern je rund 95 Prozent. 100 Prozent der Schlacht- und Zerlegebetriebe (361), 27 Prozent der Fleischverarbeitungsbetriebe (259) und 83 Prozent des Lebensmitteleinzelhandels (23.132) sind Systempartner der QS-Organisation. Ein nicht näher zu bezifferndes theoretisches Potenzial besteht für den Anteil an Schlachttieren, deren Folgeprodukte im Inland und insbesondere im regionalen Umkreis der jeweiligen Erzeuger-, Schlacht- und Verarbeitungsbetriebe vermarktet werden. Aufgrund der Anzahl und Größe der Schlachtstätten, deren räumlicher Verteilung und dem Vorhandensein von Schlachttieren, dürfte das Potenzial 34 Quelle: Statistische Ämter des Bundes und der Länder - Agrarstrukturen in Deutschland 2010 (24) 35 Quelle: Statistische Ämter des Bundes und der Länder - Agrarstrukturen in Deutschland 2010 (18) 36 Verfügbar unter: FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 90

91 für ein bundesweites Regionalsiegel für Schlachttiererzeuger im Süden Deutschlands höher sein als in den anderen Landesteilen Absatzpotenziale in ausgewählten Bereichen der Ernährungsindustrie Die Bundesvereinigung der Deutschen Ernährungsindustrie positioniert sich zum Thema Regionalität wie folgt 37 : Lebensmittel aus der Region sind ein Trend, der sowohl beim Verbraucher als auch bei den Erzeugern immer beliebter wird. Gerade kleinere und mittelständische Erzeuger und Verarbeitungsunternehmen haben so die Chance, die Vorzüge ihrer Region mit dem Produkt und der Herstellung zu verknüpfen. Gleichzeitig entwickelt der Verbraucher ein tieferes Verständnis für Lebensmittel, ihre Herkunft und die Wertschöpfungsprozesse, was zu höherer Wertschätzung und Zahlungsbereitschaft führt. Der Markt für regionale Produkte wächst dynamisch. Aus gleicher Quelle weiter zum Thema Rohstoffbezug: Zu den wichtigsten Rohstoffen zählen neben Fleisch und Milch, Getreide, Ölsaaten, Gemüse und Hackfrüchte wie Kartoffeln und Zuckerrüben. Rund drei Viertel der verarbeiteten Rohstoffe stammen aus Deutschland. Ein Viertel der Rohstoffe wird im Ausland eingekauft, da sie in Deutschland nicht in ausreichenden Mengen vorhanden sind oder nicht angebaut werden können wie Kaffee und Kakao ( ). Die Ernährungsindustrie erwirtschaftet 28,7 Prozent ihres Umsatzes im Auslandsgeschäft. Aus den genannten Zahlen ergibt sich ein erhebliches Potenzial für ein bundesweites Regionalsiegel, das nach Festlegung des Zeichensystems näher untersucht werden kann. Für den Bereich Ernährungsindustrie werden nachfolgend exemplarisch die Fleischwirtschaft und die Mühlenwirtschaft vor dem Hintergrund ihres Absatzpotenzials für Produkte mit regionalem Hintergrund analysiert Fleischwirtschaft Die in der Landwirtschaft erzeugten und gehandelten Tiere werden geschlachtet und weiterverarbeitet und gelangen über mehrere Stufen zu den Verbrauchern. In Deutschland haben die Landwirte die Möglichkeit, ihre Tiere an den privaten oder genossenschaftlichen Viehhandel, an Erzeugergemeinschaften oder direkt an Schlachtunternehmen zu verkaufen. Außerdem kann der Landwirt als Direktvermarkter seine Fleisch- und Wurstwaren unmittelbar an den Verbraucher absetzen. Über Verbrauchermärkte, Discountgeschäfte, Fleischerfachgeschäfte, sonstige Lebensmittelgeschäfte einschließlich Supermärkte, Wochenmärkte und Direktbezug gelangen die Fleisch- und Wurstwaren zu den Endverbrauchern. Daneben wird Fleisch auch in der Gastronomie und in Großverbrauchereinrichtungen wie Mensen und Heimen verzehrt. 38 Wie unter dem Bereich Futterbaubetriebe/Tierhaltungsbetriebe erläutert, besteht auch hier ein nicht näher zu bezifferndes theoretisches Potenzial an Fleisch und Wurstwaren, die im Inland und insbesondere im regionalen Umkreis der jeweiligen Schlacht- und Verarbeitungsbetriebe vermarktet werden können BVE Bundesvereinigung der Deutschen Ernährungsindustrie Jahresbericht 2010_2011. Gurrath, Peter, Fleischversorgung in Deutschland Ausgabe Wiesbaden: Statistisches Bundesamt. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 91

92 Mühlenwirtschaft Heute gibt es in Deutschland rund 600 Mühlen, von denen 308 mit einer Vermahlung von mindestens 500 Tonnen im Jahr meldepflichtig sind. 61 große Mühlen mit einer Jahresvermahlung von Tonnen und mehr haben einen Anteil an der Gesamtvermarktung von 84,9 Prozent. 272 Mühlen mit einer Jahresvermahlung zwischen 500 und Tonnen besitzen einen Marktanteil von 15,1 Prozent. 39 Die Verteilung der Mühlenbetriebe in Deutschland lässt sich als südlastig beschreiben und spiegelt die Strukturen in Land- und Ernährungswirtschaft wider. Von den kleinen Mühlen (500 bis unter Tonnen Jahresvermahlung) sind im Süden rund 60 Prozent, im Westen und Osten je rund 17 Prozent und nur etwa 4 Prozent im Norden. Bei den Mühlen mit einer Jahresvermahlung von bis unter Tonnen sind 51 Prozent im Süden, 14,5 Prozent im Westen, 12,2 Prozent im Osten und 14 Prozent im Norden. Bei den 63 Mühlen mit einer Jahresvermahlung von über Tonnen sind im Süden 38 Prozent, im Westen 25 Prozent, im Osten 17,4 Prozent und im Norden 15,8 Prozent. 40 Von Bedeutung für die Potenzialanalyse sind Angaben über die räumliche Ausgestaltung des Mehlabsatzes und des Rohstoffbezugs. Nach Schmidt et. al. 41 setzten die Mühlen Prozent ihres Mehles im Umkreis bis zu 100 Kilometer ab, die 247 kleineren Mühlen (bis unter Tonnen Jahresvermahlung) sogar bis zu 96 Prozent in diesem Bereich. Durchschnittlich sind es bei ihnen 48 Kilometer bis zum Abnehmer. Das Bäckerhandwerk bezieht zu zwei Dritteln das Mehl von kleineren Mühlen und zu einem Drittel von den größeren (über Tonnen Jahresvermahlung) 42. Die Ernährungsindustrie bezieht 6,5 Prozent des Mehles der kleineren Mühlen und gut 32 Prozent des Mehles der größeren Mühlen. Wiederverkäufer bekommen 14,2 Prozent des Mehles der kleineren Mühlen und 11,8 Prozent des Mehles der größeren Mühlen. Beim LEH sind die Zahlen 3,7 Prozent und 1,75 Prozent. Die kleineren Mühlen beziehen ihr Getreide zu 60 Prozent von Landwirten/Erzeugergemeinschaften (EZG) und zu 30 Prozent vom regionalen Agrarhandel. Überregionaler und internationaler Handel tragen zu insgesamt 10 Prozent zum Gesamtbezug bei. Auch die größeren Mühlen versorgen sich überwiegend in der Region: Ihren Bezug tätigen sie zu rund 44 Prozent beim regionalen Agrarhandel, zu etwa 36 Prozent von Landwirten/EZGen und zu 20 Prozent von überregionalen/internationalen Anbietern. Bei den kleineren Mühlen besteht der Mehlabsatz zu 13,1 Prozent aus vorgefertigten Typen-Mehlmischungen, bei den größeren zu knapp 20 Prozent. Die kleineren Mühlen beliefern mit den Mischungen zu 22,7 Prozent die Ernährungsindustrie und zu 77,3 Prozent das Handwerk. Bei den größeren Mühlen ist das Verhältnis umgekehrt: 79,4 Prozent gehen an die Ernährungsindustrie, 20,6 Prozent an das Handwerk. Unter dem Titel Absatzströme analysiert das BMELV 43 wie folgt: In den Regionen Nord und Ost ist jeweils ein nahezu ausgewogenes Verhältnis zwischen dem Absatz von Mehl aus Brotgetreide innerhalb und außerhalb des eigenen Bundeslandes festzustellen. In den Quelle: Kunkel, Sabrina, Uwe Platz und Reinhard Wolter, Die Struktur der Mühlenwirtschaft in Deutschland. Wirtschaftsjahr 2009/10. Bonn: Bundesministerium für Ernährung, Landwirtschaft und Verbraucherschutz (Hrsg.). S. 38 (eigene Berechnungen). 41 Schmidt, Christian, Oliver Halk und Werner Detmering, Betriebsvergleich der deutschen Mühlenwirtschaft 2007: Ergebnisbericht einer Unternehmenserhebung. Hannover: Marketinggesellschaft der niedersächsischen Land- und Ernährungswirtschaft e.v. 42 eigene Schätzung 43 Kunkel, Sabrina, Uwe Platz und Reinhard Wolter, Die Struktur der Mühlenwirtschaft in Deutschland. Wirtschaftsjahr 2009/10. Bonn: Bundesministerium für Ernährung, Landwirtschaft und Verbraucherschutz (Hrsg.). S. 16 ff. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 92

93 Regionen West und Süd liegt das Verhältnis mit etwa drei zu eins beim Absatz innerhalb des eigenen Bundeslandes. Dies lässt sich damit begründen, dass in Nordrhein-Westfalen aufgrund der hohen Bevölkerungszahl eine große Nachfrage nach Mehl besteht und daher entsprechend große Mengen im eigenen Bundesland abgesetzt werden können. Auch in der Region Süd, vor allem in Bayern, spielt der regionale Verkauf eine große Rolle. Bei der Betrachtung nach Größenklassen fällt auf, dass der Absatz außerhalb des eigenen Bundeslandes mit zunehmender Größe kontinuierlich ansteigt. Die kleinen Mühlen bis Tonnen setzten etwa 10,4 Prozent ihrer Vermahlungsmenge außerhalb des eigenen Bundeslandes ab. Große Mühlen ab Tonnen etwa 43,1 Prozent. In der Region Nord weisen auch schon kleine Mühlen eine hohe Absatzmenge außerhalb des eigenen Bundeslandes auf. In der Region West war der Absatz außerhalb des eigenen Bundeslandes bei Mühlen mit einer Gesamtvermahlung über Tonnen kleiner als bei Mühlen zwischen Tonnen bis unter Tonnen Jahresvermahlung. Im Süden beträgt der Anteil am Absatz außerhalb des eigenen Bundeslandes in der Größenklasse zwischen Tonnen bis unter Tonnen Gesamtvermahlung 7,6 Prozent. Bei einer Gesamtvermahlung über Tonnen beträgt der Absatz in andere Bundesländer 41,3 Prozent und ist damit höher als der Mittelwert aller Mühlen in Deutschland (35,2 Prozent). Die Region Ost hatte auch schon in der kleinsten Größenklasse fast 20 Prozent des Absatzes außerhalb des eigenen Bundeslandes. In den folgenden Größenklassen steigt dieser Anteil an. Theoretisch gibt es aufgrund der relativ kleinräumigen Bezugs- und Absatzstruktur vor allem kleinerer Mühlen bei entsprechender Ausgestaltung ein beachtliches Potenzial im Getreide/Mehl/Backwaren-Bereich für ein bundesweites Regionalsiegel Absatzpotenziale in ausgewählten Bereichen des Ernährungshandwerks Für den Bereich des Ernährungshandwerks werden nachfolgend exemplarisch die Fleischereien und Bäckereien vor dem Hintergrund ihres Absatzpotenzials für Produkte mit regionalem Hintergrund analysiert Fleischereien Definition: Das Fleischereigewerbe (WZ 10.13) wird nach Systematik der Wirtschaftszweige des Statistischen Bundesamtes von 2008 dem Wirtschaftszweig 10.1 Schlachten und Fleischverarbeitung zugeordnet. Daten: Unternehmen mit circa Mitarbeitern erzielen 2009 einen Umsatz von 15,74 Milliarden Euro. Status: Die Branche hat im Jahr 2009 nur geringe Umsatzverluste verzeichnet. Perspektiven: Steigendes Qualitätsbewusstsein sowie der Trend zu gesunden Produkten eröffnen der Branche neue Chancen. (Quelle: Deutscher Fleischer-Verband (DFV); Statistisches Bundesamt) 44 Die Mehrzahl der Fleischerfachbetriebe schlachtet heute nicht mehr selbst, sondern kauft vom Schlachthof oder von Zerlegebetrieben zu. Laut Verbandsstatistik (Deutscher Fleischer- Verband 2008) beträgt der Einkauf von Lebendvieh 5,7 bis 9,2 Prozent der Umsatzerlöse eines Fleischerfachgeschäftes, der Einkauf von Teilstücken dagegen 19,1 bis 30,5 Prozent (...). Als 44 Quelle: Gothaer: Der KMU-Branchen-Wegweiser Fleischverarbeitung Stand: FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 93

94 regional vermarktet könnte man die Hausschlachtungen, bei Rindern circa ein Prozent aller Schlachtungen, bezeichnen ( ). 45 Der Anteil selbstschlachtender Fleischereien ist rückläufig. Eine Ursache sind unter anderem die hygienerechtlichen Auflagen. Eine Untersuchung 46 hat gezeigt, dass immer mehr neue lebensmittelrechtliche Auflagen dem Nahrungsmittelhandwerk zum Teil sehr hohe Kosten verursachen. Kleine Betriebe können diese Kosten nur auf eine kleine Produktionsmenge umlegen, was die Produktpreise nach oben schnellen lässt. Das wiederum schränkt die Nachfrage ein und die Möglichkeit, durch Qualitätserzeugung und regionale Vermarktung Arbeit und Einkommen in den ländlichen Räumen zu halten. Anmerkung: Gleiches gilt für die landwirtschaftlichen Direktvermarkter, die sich mit der Fleischvermarktung befassen. Da der die Groß- und Kleinstrukturen vereinheitlichende Regulierungsdruck von der EU-Ebene anhalten dürfte, ist von einem weiteren Rückgang der Zahl kleinerer Fleischereien auszugehen. Ob sich diese Entwicklung als nachteilig für die Vermarktung regionaler Produkte und das Potenzial eines Regionalsiegels auswirkt, ist fraglich: Denn die bisher verbreitete Einschätzung, wonach die Selbstschlachtung Voraussetzung für die Vermarktung regionaler Produkte sei, ist in dieser Stringenz nicht mehr aufrechtzuerhalten. So sind es gerade die großen Schlachtunternehmen, die den Abnehmern ihrer Hälften und Teilstücke einen Herkunftsnachweis - gewonnen aus den während der Prozessdokumentation angefallenen Daten - als Zusatzleistung anbieten könnten oder es schon tun: inzwischen, wie zum Beispiel beim f-trace-system 47, auch mit internetbasierter Erzeugeridentifizierung. Wenn auch diese Art Herkunftsnachweis derzeit vor allem für regionale Handelsmarken genutzt wird, ist es auch für das Fleischerhandwerk eine denkbare Option. Laut Auskunft 48 des Deutschen Fleischer-Verbandes rechnet man für das Jahr 2011 mit fleischerhandwerklichen Betrieben in Deutschland. Etwa 30 Prozent dieser Betriebe schlachten in eigener Schlachtstätte oder schlachten selbst in Gemeinschaftsschlachtstätten oder lokalen Schlachthöfen. Eine genaue Anzahl werde statistisch nicht erfasst. Von ganz wenigen Ausnahmen abgesehen (selbstständige Franchisenehmer) sei die Herstellung von Wurstwaren und sonstigen Fleischerzeugnissen in den Betrieben obligatorisch. Sie sei das Wesensmerkmal des Fleischerhandwerks. Ein Teil der Betriebe verarbeite und vermarkte ausschließlich Fleisch aus eigener Schlachtung. Der weitaus größte Teil der Betriebe (circa 80 Prozent) kaufe regelmäßig oder in saisonalen Spitzenzeiten (z. B. Grillsaison) Teilstücke zu. Der Fleischzukauf könne sich auch auf bestimmte Fleischqualitäten konzentrieren (bestimmte Fleischrassen, Qualitätsfleischprogramme). Etwa 80 Prozent der Schlachtbetriebe kauften zur Ergänzung ihrer Sortimente Wurstwaren und sonstige Fleischerzeugnisse zu. Dies gelte zum Beispiel für herkunftsgeschützte Produkte wie Parmaschinken oder regionale Spezialitäten wie Schwarzwälder Schinken. 45 Kögl, Hans und Jana Tietze, Regionale Erzeugung, Verarbeitung und Vermarktung von Lebensmitteln, Forschungsbericht. Uni Rostock. S Fink-Keßler, Andrea et al., Mit Kanonen auf Spatzen geschossen - Rechtliche Hemmnisse einer handwerklichen Fleischverarbeitung und -vermarktung von Landwirten und Metzgern. Teil 1. In: arbeitsergebnisse Heft 55. Zeitschrift der AG Land- und Regionalentwicklung. Kassel: Universitätsverlag Hühne, Klaus, Deutscher Fleischer-Verband e.v., Befragung am FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 94

95 Nur wenige hundert Betriebe kauften ausschließlich zu. Diese seien in der Regel selbstständige Franchisenehmer von handwerklichen Filialbetrieben. Die Selbstschlachtung wird vom Deutschen Fleischer-Verband zwar als zuträglich aber nicht als unabdingbar für die Anerkennung von Fleisch- und Wurstwaren als Regionalprodukte gesehen. Sowohl der Zukauf von Fleisch als auch der von Fleischerzeugnissen aus der Region sei möglich und meist üblich. Entscheidend sei die regionale Bezugsquelle. Auch die Herstellung von nachweisbar regionalen Produkten (von der Zucht bis zum Verbraucher) werde, selbst wenn der Rohstoff (Hälften und/oder Teilstücke) ausschließlich zugekauft würde, für praktikabel angesehen. Entscheidend sei auch hier die nachweisbar regionale Bezugsquelle. Voraussetzung für die Vermarktung von Fleischerzeugnissen als Regionalprodukte ist jedoch das Vorhandensein regionaler Fleischerzeuger, womit die räumliche Definition von Region entscheidenden Einfluss auf die Zahl der potenziellen Zeichennutzer bekommt. Theoretisches Potenzial: alle selbstschlachtenden und zukaufenden Fleischereien Bäckereien Während die Zahl der Filialen gleich blieb (30.000) hat sich die Zahl der Bäckereien im Jahr 2010 um 2,66 Prozent zum Vorjahr auf verringert 49. In ihrer Selbstdarstellung erwähnt die Branche zwar regionale Rohstoffherkünfte in Form des Weizen-/Mehlbezugs von landwirtschaftlichen Erzeugergemeinschaften bei vielen Bäckereien, scheint dem Megatrend Regionalität aber keine größere Bedeutung zuzumessen. 50 Die Konzentration im Lebensmitteleinzelhandel (LEH) fordert dem Bäckerhandwerk eine fortwährende Neuorientierung in seinen Vertriebsstrukturen ab. So findet sich heute in vielen Supermärkten eine Verkaufsfiliale eines Handwerksbäckers. LEH-eigene Pre-Bake-Stationen und die Discountbäckereien haben zu einer weiteren Verschärfung des Wettbewerbes geführt. Aufgrund der niedrigen Bezugspreise tiefgekühlter Teiglinge, des schmalen Sortiments, der einfachen Ausstattung und des Selbstbedienungskonzeptes können beide Vertriebsschienen Backwaren zu Discountpreisen anbieten. 51 Vor dem Hintergrund des Wettbewerbs besteht die permanente Notwendigkeit, durch Angebotsprofilierung wenn schon nicht die Kosten, dann doch die Preisführerschaft zu erlangen. Da der Rohstoffbezug in Getreidebauregionen im Wesentlichen aus regionalen Herkünften erfolgt und bei entsprechender Dokumentation bis zum Getreideerzeuger nachzuweisen wäre, sind theoretisch alle dortigen Bäckereien potenzielle Nutzer eines bundesweiten Regionalsiegels. Theoretisches Potenzial: alle Bäckereien in Regionen mit Mühlen und Getreidebau. 49 Quelle: Zentralverband des Deutschen Bäckerhandwerk, Das deutsche Bäckerhandwerk: Daten und Fakten Berlin. 50 vgl. 51 vgl. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 95

96 9.2.4 Absatzpotenziale beim Verbraucher Was die Konsumenten als eigentliche Zielgruppe für regionale Produkte betrifft, hat es in jüngster Zeit aufwendige Befragungen gegeben, die die regionale Herkunft als für die Verbraucher zunehmend wichtiger werdendes Kriterium bestimmen und dem Thema eine längerfristige Aktualität zusprechen. Auch wenn der Preis bei Lebensmitteln nach wie vor das entscheidende Kaufkriterium ist, gewinnen andere Aspekte an Bedeutung. In Bezug auf die Kriterien, nach denen Verbraucher Lebensmittel auswählen, zeigt eine Studie des SGS Institut Fresenius 52 : Die Ansprüche sind hoch. Lebensmittel sollen möglichst frisch (86 Prozent) und qualitativ hochwertig (60 Prozent), gleichzeitig aber günstig (57 Prozent) sein. Darüber hinaus belegt die Studie jetzt ein weiteres wichtiges Kaufkriterium: Regionalität. 47 Prozent achten beim Einkauf auf Produkte aus der Region. Bio- oder Ökoprodukte haben mit 23 Prozent deutlich weniger Priorität. Der Gesundheitsaspekt ist dennoch wichtig: 43 Prozent der Verbraucher möchten gentechnikfreie Lebensmittel, 40 Prozent achten auf Lebensmittel, die wenig Fett enthalten. 20 Jahre nach der deutschen Einheit gibt es weiterhin Unterschiede im Einkaufsverhalten zwischen den alten und neuen Bundesländern. Im Osten sind Lebensmittel aus der eigenen Region überdurchschnittlich attraktiv. 59 Prozent der Ostdeutschen achten beim Lebensmittelkauf darauf, dass die Produkte aus der unmittelbaren Umgebung kommen. Nur für 44 Prozent der Westdeutschen spielt Regionalität dagegen eine Rolle. Verbraucher in den neuen Bundesländern sind außerdem preisbewusster als ihre Nachbarn aus dem Westen: 68 Prozent geben an, vor allem auf den Preis zu achten, während es im Westen 54 Prozent sind. Die DLG-Regionalstudie bezeichnet Regionalität als Megatrend für Handel und Verbraucher, das erhebliches Wertschöpfungspotenzial für Händler und Industrie enthält. Bei den Verbrauchern sind es die gehobenen Milieus, die sich für regionale Produkte interessieren und bereit sind, dafür mehr bezahlen. Die Studie betont, dass Regionalität für die Konsumenten ausschließlich ein Thema der Herkunft frischer Produkte ist und keines der Ethik. Das sieht die OTTOGroup anders: Ihre Verbraucherstudie 54 gliedert Regionalität ein in den Gesamtkomplex ethischen Konsum, der sich ausdifferenziert: Ethischer Konsum wird differenzierter gesehen. So werden mittlerweile menschenwürdige Arbeitsbedingungen (92 Prozent), soziale Verantwortung (85 Prozent), umweltfreundliche Herstellung (89 Prozent), fairer Handel (87 Prozent), Recycelbarkeit (83 Prozent) und Regionalität (77 Prozent) stärker mit Konsumethik in Verbindung gebracht als biologische Erzeugung (73 Prozent). Die Ausdifferenzierung des Ethikmarktes ist Beleg dafür, dass das Thema nicht nur auf Produkte beschränkt ist, sondern zunehmend in andere Bereiche vordringt und an Alltagsrelevanz gewinnt. Das Potenzial in der Verbraucherschaft für ein bundesweites Regionalsiegel hängt offensichtlich entscheidend auch von dessen inhaltlicher Ausgestaltung ab. Ein Siegel, das die Bedürfnisse der Mehrheit der regional affinen Verbraucher weitestgehend berücksichtigen würde, träfe auf ein großes, hier nicht bezifferbares Potenzial in der Konsumentenschaft. 52 Quelle: Institut Fresenius, SGS Institut Fresenius Verbraucherstudie 2010: Lebensmittelqualität und Verbrauchervertrauen. DLG, Neue DLG-Studie: Regionalität aus Verbrauchersicht. Quelle: Otto GmbH & Co KG (Hrsg.), Verbrauchervertrauen. 3. Studie zum ethischen Konsum. Auf dem Weg zu einer neuen Wertekultur. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 96

97 9.3 Expertenbefragung: Analyse des Potenzials eines bundesweiten Regionalsiegels Nachdem erst im fortgeschrittenen Verlauf des Vorhabens Alternativszenarien für Zeichensysteme und deren Aufgabenbestimmung festgelegt wurden, konnte auch erst auf dieser Basis die geplante Expertenbefragung durchgeführt werden. Die Expertenbefragungen wurden in schriftlicher Form vom Leiter des Instituts für Sicherheit und Qualität beim Fleisch (Max-Rubner-Institut, Bundesforschungsinstitut für Ernährung und Lebensmittel) sowie vom Deutschen Fleischer Verband erhoben. Darüber hinaus wurden Expertenbefragungen auf Basis eines Gesprächsleitfadens bei den jeweiligen Geschäftsführern der BVE Bundesvereinigung der Deutschen Ernährungsindustrie e.v., dem VdF Verband der Fleischwirtschaft e.v., der BVEO Bundesvereinigung der Erzeugerorganisationen Obst und Gemüse e.v. und dem VDM Verband Deutscher Mühlen e.v. im Zeitraum bis zum durchgeführt (siehe Anhang 12.14, Gesprächsleitfaden Expertenbefragung). Die geplante Befragung des Deutscher Brauer-Bundes konnte mangels eines Gesprächspartners nicht durchgeführt werden. Auf die Eingangsfrage Stellen Sie sich doch einmal vor, die Kriterien dafür, was als Produkt aus regionaler Erzeugung gekennzeichnet werden kann, würden bundeseinheitlich festgelegt wurde ein heterogenes Bild deutlich. Die BVE begrüßt - wohlgemerkt aus Verbrauchersicht - diesen Ansatz, während VDF und BVEO diesen Ansatz ablehnen, BVEO mit der Begründung, gerade ein eigenes bundesweites Logo mit den dazugehörigen Nutzungsbedingungen eingeführt zu haben. Der VDM kann sich mit der Aussage weiß nicht nicht festlegen. Zusammenfassung Eine bundeseinheitliche Festlegung von Kriterien wird bei den unterschiedlichen Produktgruppen auf sehr unterschiedliche Befindlichkeiten stoßen. Die Frage Unabhängig von Ihrer grundsätzlichen Auffassung zu einem bundesweiten Regionalsiegel, gesetzt den Fall, ein solches Siegel würde entwickelt, wer sollte Ihres Erachtens Träger eines solchen Zeichens sein? wurde in drei Fällen mit Einrichtung der Privatwirtschaft und in zwei Fällen mit egal beantwortet, wobei diese Nennungen mit einer eher ablehnenden Gesamtgrundhaltung zu einem bundesweiten Regionalsiegel einhergingen. Nur die Wissenschaft aus dem Bundesforschungsinstitut befürwortete, dass der Staat oder eine staatliche Einrichtung diese Rolle übernehmen sollte. Zusammenfassung Die Wirtschaft sieht die Trägerschaft eines solchen Zeichens - wenn überhaupt - eher bei sich selbst angesiedelt. Auf die Frage Sollte die Kennzeichnung mit einem übergeordneten Regionalsiegel verpflichtend, freiwillig oder fakultativ vorbehalten sein (=Zeichennutzung freiwillig, wer es nutzt, ist aber an seine Vorgaben gebunden)? antworteten drei Experten mit freiwillig, zwei FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 97

98 mit fakultativ vorbehalten und einem Experten war es egal, da er eine bundeseinheitliche Regelung ohnehin ablehnt. Zusammenfassung Keiner der Befragten befürwortet eine verpflichtende Kennzeichnung mit einem übergeordneten Regionalsiegel. Jedes Unternehmen sollte selbst ausloten, ob die Kennzeichnung für den jeweiligen Produktbereich einen Nutzen stiftet. Die Auffassung zur Definition des Regionsbegriffes stellt sich ebenfalls sehr heterogen dar. Es werden - je nach Produkt - mehrheitlich naturräumliche Grenzen vor administrativen Grenzen als sinnvoll angesehen. Keiner der Experten sieht virtuell gegriffene Umkreise beziehungsweise räumlich begrenzte Vertriebsgebiete als sinnvolle Kriterien an, wie sie zum Beispiel der Handel verwendet (u. a. Edeka, tegut ). Zusammenfassung Die Festlegung des Regionsbegriffes wird bei den unterschiedlichen Produktgruppen und in unterschiedlichen Regionen unterschiedliche Regelungen erfordern. Die Frage, ob ein Regionalsiegel nur für Monoprodukte, also zum Beispiel Kartoffeln, Eier, Obst oder nur für zusammengesetzte Produkte, zum Beispiel Wurst, Konserven, Konfitüren, Fertiggerichte oder beides vergeben werden sollte, wurde ebenfalls heterogen beantwortet: Drei Verbandsvertreter antworteten nur für Monoprodukte, drei Vertreter für Monoprodukte und zusammengesetzte Produkte. Zusammenfassung Monoprodukte werden grundsätzlich als geeignet eingestuft. Es wird jedoch eine nachvollziehbare und belastbare Regelung für zusammengesetzte Produkte erfolgen müssen. Die Frage Sollten bei zusammengesetzten Produkten, die mit einem Regionalsiegel gekennzeichnet werden, die Rohstoffe und Zutaten aus derselben Region stammen, in der der verarbeitende Betrieb liegt? musste nur von den drei dieser Regelung zustimmenden Experten beantwortet werden. Ein Verband antwortet Ja, aber nur wenn regional verfügbar, ein anderer Experte antwortete mit nein. Der dritte Experte lehnte eine pauschale Festlegung ab, da die Verkehrsauffassung seitens des Konsumenten und des Herstellers bereits auf Produktebene unterschiedlich ausgelegt werde. Es erfolgte in diesem Zusammenhang der Hinweis, dass die verpflichtende Bezeichnung des Ursprungslandes und die namentliche und örtliche Nennung des Erstabpackers/Erstverarbeiters (statt der Floskel: abgepackt für ) geeignete regionale Verbraucherinformationen darstellen könnten, wenn dieses bereits verpflichtend geregelt werden würde. Hier solle das BMELV seine Handlungsspielräume nutzen. Ebenso sei der Ort der Be- und Verarbeitung von Lebensmitteln zu berücksichtigen. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 98

99 Die darauf folgende Frage Wenn Sie der Auffassung sind, die Ausgangsstoffe eines zusammengesetzten Produktes müssten zu einem bestimmten Anteil aus der gleichen Region wie das Endprodukt stammen, wie hoch sollte Ihres Erachtens dieser Anteil mindestens sein? wurde insofern folgerichtig und einheitlich mit dem Votum: hängt vom Produkt ab bewertet. Zusammenfassung Im Zuge der Umsetzung eines bundeseinheitlichen Regionalsiegels bedarf es dringend einvernehmlicher und produktspezifischer Regelungen bezüglich Rohstoffen, Zutaten sowie den Ortsangaben der abpackenden, be- und verarbeitenden Unternehmen. Eine große Einheitlichkeit bestand in der Meinungsbildung, das Regionalsiegel nicht mit weiteren Anforderungen an die Erzeugung/Herstellung, etwa zur Qualität oder zum Herstellungsprozess, verbunden werden sollten, die über die gesetzlichen Bestimmungen hinausgehen. Einheitlich abgelehnt wurden etwa umweltgerechte Erzeugung (Hinweis der Experten: es existiert ein Nachhaltigkeitssiegel), soziale Belange, ohne Einsatz von Gentechnik (Hinweis: es existiert ein Label Ohne Gentechnik ) und/oder Klimaschutz als zusätzliche Standards für ein Regionalsiegel. Der Experte der Wissenschaft befürwortete einen zusätzlichen Standard im Bereich Tierschutz, wobei die anderen Experten aus dem Fleischbereich darauf hinwiesen, dass auch im Bereich Tierschutzaspekte ein eigenes Tierschutzlabel als singuläre Kennzeichnungsmaßnahme im Markt vorhanden beziehungsweise in der Entwicklung sei. Für die meisten der genannten zusätzlichen Anforderungen gibt es also laut den geführten Expertengesprächen etablierte Kennzeichnungen im Markt - weitere Verengungen des Regionalbegriffs seien nicht zielführend, zu komplex, dem Verbraucher nicht vermittelbar und nicht produktübergreifend zum Regionalitätsbegriff kompatibel. Zusammenfassung Zusätzliche Standards über den regionalen Aspekt hinaus werden von den befragten Experten einheitlich abgelehnt. Ob ein bundesweites Regionalsiegel die Vermarktungschancen für Produkte aus regionaler Erzeugung beeinflussen würde, wird unterschiedlich eingeschätzt. Der Experte aus der Wissenschaft antwortete, dass sich die Vermarktungschancen erhöhen würden. Ein weiterer Experte betonte, dass Mindestkriterien als unterer Standard die Vermarktungschancen sogar hemmen könnten, weil die Glaubwürdigkeit insgesamt unter einem Mindeststandard leiden würde. Vier Experten meinen, dass die Beeinflussung der Vermarktungschancen ausschließlich von der Ausgestaltung des Regionalsiegels, dessen Kriterien und den jeweiligen Rahmenbedingungen abhängt. Im Gespräch nannten die Experten unter anderem den Sachverhalt, dass Herkunftswissen grundsätzlich die Verbraucherakzeptanz erhöhen würde und dass Kommunikationsanstrengungen und die materielle Förderung als solche die Vermarktungschancen erhöhen könnten, wenn alles richtig gemacht werde. Geäußert wurde in diesem Zusammenhang auch der Sachverhalt, dass ausgelobte Regionalität - wenn auch im Trend - nur in Ausnahmefällen einen maßgeblichen Beitrag zum Umsatz- und/oder Gewinnwachstum erbringen würde. Die wirtschaftliche Beurteilung sogenannter regionaler FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 99

100 Initiativen wird als dauerhaft kritisch eingeschätzt, wenn diese nicht auch dauerhaft durch öffentliche Mittel gefördert werden würden. Zusammenfassung Im Zuge der Umsetzung eines bundeseinheitlichen Regionalsiegels bedarf es einer sorgfältig durchdachten inhaltlichen, gestalterischen und fördertechnischen Ausgestaltung, die ohne (zusätzliche) Fördermittel als wirtschaftlich kritisch angesehen wird Beurteilung der Szenarien In der letzten Frage des Expertengespräches wurden die zwei nachfolgenden Modelle Anerkennung und Regionalfenster vorgestellt: Auf die Frage: Wenn Sie sich zwischen den Varianten entscheiden müssten, welche würden Sie wählen?, antworteten die befragten Institutionen wie folgt: eine Dachmarke mit vorgegebenen Regionalkriterien (keine Zustimmung); das Regionalfenster mit Auslobung der jeweils eigenen Regionalkriterien (zwei Zustimmungen); keine von beiden (zwei Zustimmungen); für eine Entscheidung bedürfte es weiterer Informationen (keine Zustimmung); der Unterschied bleibt unklar (keine Zustimmung). Zusammenfassung Eine Dachmarke findet zum jetzigen Zeitpunkt bei keinem der Experten eine Zustimmung - eher das Regionalfenster als Form der Kontrollbestätigung für die Erfüllung jeweils eigener Regionalkriterien. Zusammenfassend wünschen sich die befragten Experten der genannten Verbände - falls es überhaupt zu einem bundesweiten Regionalzeichen kommen sollte - eine hohe Flexibilität bei der Ausgestaltung und Rücksichtnahme auf produktspezifische Belange. Bevorzugt werden unternehmens- und privatwirtschaftliche Entscheidungsprozesse vor staatlichen Regelungen. Keinesfalls sollte ein bundesweites Regionalzeichen mit weiteren Kriterien außerhalb des regionalen Kontextes in Verbindung gebracht oder gar überladen werden. 9.4 Weitere Perspektiven Eine Ausweitung der Verwendungsbereiche für ein bundesweites Regionalsiegel auf die Bereiche Non Food und Tourismus wurde aufgrund der schon oben aufgeführten Komplexität der Kriterienfindung und der Kürze der Zeit nicht weiter vertieft. Einzige der Bereich der Gastronomie wurde aufgrund der wirtschaftlichen Bedeutung für die Regionalinitiativen vertiefend betrachtet. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 100

101 Gastronomie Die Ausweitung der Vergabe eines bundesweiten Regionalsiegels auf den Gastronomiesektor sollte nicht losgelöst von der allgemeinen Diskussion betrachtet werden. Für viele kleine Regionalinitiativen ist der Absatzweg über die regionale Gastronomie ein wichtiges Standbein, zum Beispiel die Regionalinitiativen Altmühltaler Lamm oder Ostalblamm, die das Lammfleisch über die regionale Gastronomie erfolgreich vermarkten. Gleichwohl liegt bei der Vermarktung im Gastronomiebereich die Erfahrung vor, dass sich Köche und Gastronomen mit einem Kontroll- oder Anerkennungsverfahren schwer tun. Erfahrungen mit Kontrollverfahren liegen in der Gastronomie bereits durch die im Jahr 2004 eingeführte Biozertifizierung vor. Danach unterliegen alle Betriebe der Gemeinschaftsverpflegung und Gastronomie einem Kontrollverfahren, wenn sie Bioprodukte einsetzen und diese auf der Speisenkarte ausloben. Betriebe, die sich dem Kontrollverfahren stellen, haben die Auswahl, für ein komplettes Menü eine Biozertifizierung zu beantragen, einzelne Komponenten zertifizieren zu lassen oder einen Austausch kompletter Produktgruppen (beispielsweise Rindfleisch ausschließlich aus ökologischer Tierhaltung zu beziehen) vorzunehmen. Die Kontrolle obliegt den Ökokontrollstellen. Nach einer Studie aus dem Jahr 2009 haben Betriebe der Außer-Haus-Verpflegung ein Biozertifikat (vgl. ÖGS 2005). Eine gesonderte Darstellung, wie viele Restaurants biozertifiziert sind, liegt nicht vor. Allerdings dürfte der Anteil derer, die kontinuierlich oder zeitweise Bioprodukte verwenden, weit höher liegen. Gemessen an der Anzahl von deutlich über Betrieben des Gaststättengewerbes wird deutlich, dass nur ein geringer Teil der Gastronomen bereit ist, ein Kontrollverfahren zu durchlaufen. Die geringe Akzeptanz der Biozertifizierung, die auch innerhalb der Gemeinschaftsverpflegung zu beobachten ist, hat folgende Gründe: hoher administrativer Aufwand Skepsis gegenüber dem Nutzen eines Biosiegels für den Gast anfallende Kosten für die Zertifizierung und jährliche Kontrolle Einschränkung in der Auswahl von Lebensmitteln Insbesondere der letzte Punkt ist in der gehobenen Gastronomie zu beobachten. Nach Angaben von gastgewerbe-magazin online sind Bioprodukte in der gehobenen Gastronomie etabliert (vgl. gastgewerbe-magazin 2011). Allerdings wird selten für Bio auf der Speisekarte geworben. Der Gastronom möchte in der Auswahl seiner Lebensmittel nicht eingeschränkt werden. So würde die Biozertifizierung für die Verwendung von Biorindfleisch bedeuten, dass kein konventionelles Rindfleisch eingesetzt werden dürfte. Auch wenn dies in der Praxis nicht zwangsläufig der Fall ist, fühlt sich der Gastronom, der seinen Einkauf nach der besten auf dem Markt verfügbaren Qualität ausrichtet, beeinträchtigt. Dies ist sicher auch ein Grund dafür, warum innovative Konzepte wie das Bioland- Gastronomiekonzept schwierig auf dem Markt zu platzieren sind. Die allgemeinen Vorschriften zur Biozertifizierung und die zusätzlichen Verbandsvorschriften, um als Bioland-Gastro-Partner für seinen Betrieb zu werben, beinhalten einen Bioanteil, der wertmäßig mindestens 70 Prozent betragen muss. In Ausnahmefällen kann mit einem geringeren Bioanteil begonnen werden. Im Bereich Betriebsrestaurant liegt der Bioanteil bei mindestens 20 Prozent. Ein Teil der Bioprodukte muss zudem Verbandsware sein. Der Einsatz regionaler Produkte in der Gastronomie erfreut sich bei den Gästen steigender Beliebtheit und kommt ungewöhnlich gut an (vgl. gastgewerbe-magazin 2011). Bei der FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 101

102 Einführung eines Dachzeichens und eines angeschlossenen Kontrollverfahrens kann aufgrund der Erfahrungen bei der Biozertifizierung mit ähnlichen Widerständen gerechnet werden. Zusammenfassung Voraussetzung für eine mögliche Akzeptanz ist gegeben, wenn keine Einschränkung in der Auswahl der Produkte besteht, ein Zeichen keine Vorschriften hinsichtlich des prozentualen Anteils regionaler Produkte enthält, mit dem Erwerb keine Kosten verbunden sind. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 102

103 10 Zusammenfassung Ziel des Gutachtens ist es, Kriterien für ein bundesweit geltendes Regionalzeichen zu entwickeln, damit der Begriff Regionalität für den Verbraucher transparent und wahrhaftig definiert wird. Dazu sollte unter Beachtung bereits bestehender Siegel und Marken die Abgrenzung der Region, die Produktionstiefe und der Anteil an Rohstoffen aus der Region definiert und die optionale Einbindung von Zusatzkriterien erörtert werden. Des Weiteren sollten Realisierungsmodalitäten ausgearbeitet und eine Potenzialanalyse durchgeführt werden. Für die Analyse wurden deutschlandweit zwölf Länderzeichen, 14 regionale Handelsmarken sowie sechs Regionalauslobungen des Handels und von 185 Regionalinitiativen erfasst. Nur bei den Länderzeichen Bayerns, Baden-Württembergs und Hessens liegen vergleichbare Standards bezüglich Regionsabgrenzung, Produktionstiefe und Kontrollsystem vor. Eine Definition des Begriffs Region ist zwischen der nationalen und der lokalen Ebene angesiedelt, wobei Grenzziehungen landschaftsräumlich, administrativ oder nach Entfernung erfolgen. Das Verständnis von Region ist sowohl bei Regionalinitiativen als auch bei Verbrauchern sehr heterogen. Die Einbindung aller Produktionsstufen in kleinräumigen Regionen erscheint zumeist nicht praktikabel, da nicht alle Produkte verfügbar sind. Ein vollständiger regionaler Rohstoffbezug kann oftmals nur bei Monoprodukten gewährleistet werden. Bei zusammengesetzten Produkten müssen Mindestanteile definiert werden, wobei Bezug auf die Hauptzutat oder einen prozentualen Anteil an der Gesamtmasse des Produktes genommen werden kann. Die Einbindung von Zusatzkriterien wie z. B. Tierwohl oder Nachhaltigkeit macht es erforderlich, dass hierfür zuerst einheitliche Regelungen und/oder gesetzliche Vorgaben erarbeitet werden. Zusatzkriterien sollten nur fakultativ sein und der Differenzierung von Initiativen dienen. Bei der Realisierung einer freiwilligen Regionalkennzeichnung geben nationale und gemeinschaftsrechtliche Schutzsysteme den rechtlichen Rahmen vor. Die Überprüfung der Kriterieneinhaltung sollte mindestens über ein dreistufiges Kontrollund Zertifizierungssystem erfolgen. Inhalt eines Kriterienkataloges sind demnach: Regionendefinition kleiner als Deutschland und größer als eine Kommune, Rohstoffanteil aus der Region größer als 50 Prozent, keine verpflichtende Berücksichtigung aller Vorstufen in der Landwirtschaft, Verarbeitung in der Region und ein dreistufiges Kontroll- und Zertifizierungssystem. Die Forderungen der Akteursgruppen an die Kriterienentwicklung für ein bundesweites Regionalsiegel reichen von einer staatlichen Regelung über ein privatrechtliches, freiwilliges System bis zur Beibehaltung des Status quo. Es wurden, abgeleitet aus bestehenden Ansätzen und Vorstellungen der betroffenen Akteure, vier Szenarien entwickelt: 1. Szenario Anpassung/Koordination umschreibt ein gemeinschaftliches Vorgehen von Bund und Ländern mit dem Ziel, bestehende Regelwerke der Länder für alle Bundesländer einzuführen bzw. anzupassen. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 103

104 2. Szenario Anerkennung umschreibt eine Dachmarkenstrategie, hinterlegt mit einem Akkreditierungsmodell und definierten Mindestkriterien. Es dient zur zusätzlichen Anerkennung bereits bestehender Regionalinitiativen. 3. Szenario Regionalsiegel umschreibt eine Siegelstrategie mit einem mehrstufigen Kontrollsystem. Dabei kann das Siegel eigenständig und losgelöst von bestehenden Regionalzeichen eingesetzt werden. Die Vergabe kann durch ein Stufenmodell, z. B. Höhe des prozentualen Rohstoffbezuges, differenziert werden. 4. Szenario Regionalfenster umschreibt eine Strategie der Herkunftsdeklaration, gekoppelt mit Mindestkriterien sowie einem mehrstufigen Kontrollsystem, z. B. mit einem analytischen Herkunftsnachweis. Die Deklaration erfolgt über ein eigenständiges Informationsfeld, die darin getroffenen Aussagen werden neutral überprüft. Eine Diskussion mit den Akteursgruppen ergab folgendes Bild: 1. Das Szenario Anpassung/Koordination wurde von Teilen des Handels und dem Land Baden-Württemberg bevorzugt. 2. Das Szenario Anerkennung wurde vor allem vom BRB im Sinne einer alleinigen Anerkennung der Regionalinitiativen bevorzugt. 3. Das Szenario Regionalsiegel wurde von der Mehrheit der Akteure schon in einem frühen Stadium, z. T. kategorisch, abgelehnt und daher auch nicht weiter verfolgt. 4. Das Szenario Regionalfenster wurde u. a. von Teilen des Handels, der Hersteller, der Verbände und der Wissenschaft als ein interessanter Ansatz gesehen, der weiter verfolgt werden sollte. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 104

105 11 Literatur Alvensleben, Reimar von, Verbraucherpräferenzen für regionale Produkte: Konsumtheoretische Grundlagen. Wissenschaftliche Arbeitstagung Regionale Vermarktungssysteme in der Land-, Ernährungs- und Forstwirtschaft - Chancen, Probleme und Bewertung des Dachverbandes wissenschaftlicher Gesellschaften der Agrar--, Forst-, Ernährungs-, Veterinär- und Umweltforschung e.v. (25./ ). Bonn. Verfügbar unter: Alvensleben, Reimar von, Die Bedeutung von Herkunftsangaben im regionalen Marketing. Symposium Vielfalt auf dem Markt veranstaltet vom Informationszentrum Genetische Ressourcen (IGR) der ZADI und dem Landesschafzuchtverband Niedersachsen e.v. am 5./ in Sulingen. Verfügbar unter: Balling, R., EU-Schutz für Lebensmittel und Agrarerzeugnisse - die aktuelle Entwicklung in Bayern. Vortrag-Charts. Banik, Ina und J. Simons, Regionalvermarktung und Bio-Produkte: Spannungsverhältnis oder sinnvolle Ergänzung? 9. Wissenschaftstagung Ökologischer Landbau, Universität Hohenheim. Verfügbar unter: Bastian, Andrea, Der Heimat-Begriff: Eine begriffsgeschichtliche Untersuchung in verschiedenen Funktionsbereichen der deutschen Sprache. Reihe Germanistische Linguistik 159. Tübingen. Bayerische Landesanstalt für Landwirtschaft (LfL), Projektbericht Bayern. München. Becker, Tilman, Bedeutung und Nutzung geschützter Herkunftszeichen: Gutachten im Auftrag des Deutschen Bundestages. Berlin: Büro für Technologieabschätzung im Deutschen Bundestag (TAB). Verfügbar unter: erkunftszeichen.pdf. Benner, Eckhard und Christopph Kliebisch, Regio-Marketing-Strategien im Lebensmitteleinzelhandel. Hrsg. Universität Hohenheim (420). ISSN Verfügbar unter: Besch, Michael. und Helmut Hausladen, Regionales Marketing im Agribusiness Erfolgspotentiale und Problemfelder dargestellt an lokalen Kooperationsprojekten des regionalen Agrarmarketings. In: Innovative Konzepte für das Marketing von Agrarprodukten und Nahrungsmitteln. Schriftenreihe Band 13. Frankfurt a.m.: Landwirtschaftliche Rentenbank. S Verfügbar unter: _Band13_.pdf. Blotevogel, Hans Heinrich, Auf dem Weg zu einer Theorie der Regionalität : Die Region als Forschungsobjekt der Geographie. In: Brunn, G. (Hrsg.): Region und Regionsbildung in Europa. Konzeptionen der Forschung und empirische Befunde. Schriftenreihe des Instituts für europäische Regionalforschungen, Bd. 1. Baden-Baden, S Blotevogel, Hans Heinrich, Günter Heinritz und Herbert Popp, Regionalbewußtsein : Zum Stand der Diskussion um einen Stein des Anstoßes. In: Geographische Zeitschrift 77, S FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 105

106 BMELV, Regionale Bio-Siegel (abgerufen am ). Verfügbar unter: BMELV, o.j. Hintergrundinformationen zur Ohne-Gentechnik - Kennzeichnung (abgerufen am ). Verfügbar unter: OhneGentechnikKennzeichnungHG_Informationen.html. Börnecke, Stephan, Wie fair ist die faire Milch? Online Artikel der Frankfurter Rundschau vom (abgerufen am ). Verfügbar unter: Brethauer, Christian, o. J. Der Schutz geographischer Herkunftsangaben (abgerufen am ). Verfügbar unter: Bundesvereinigung der Deutschen Ernährungsindustrie e. V., Consumers Choice Charts. Buxel, Holger, Akzeptanz und Nutzung von Güte- und Qualitätssiegeln auf Lebensmitteln: Ergebnisse einer empirischen Untersuchung. Studienbericht. Münster. Verfügbar unter: Demmeler, Martin, Ökologische und ökonomische Effizienzpotenziale einer regionalen Lebensmittelbereitstellung: Analyse ausgewählter Szenarien. Dissertation. München: Technische Universität München. Verfügbar unter: destatis, Betriebe mit Anbau von Gartenbauerzeugnissen nach Betriebsart. SJT destatis, Betriebe mit Zuchtsauenhaltung. SJT destatis, Landwirtschaftliche Betriebe mit Viehhaltung. SJT destatis, Landwirtschaftliche Betriebe nach betriebswirtschaftlicher Ausrichtung. SJT destatis, Milchverarbeitung der Molkereiunternehmen 1997 bis SJT destatis, Zahl der Molkereiunternehmen 2000 bis SJT destatis, Betriebe mit Masthühnerhaltung. SJT destatis, Betriebe mit Mastschweinehaltung nach Bestandsgrößenklassen. SJT destatis, Betriebe mit Milchkuhhaltung nach Bestandsgrößenklassen. SJT destatis, Betriebe mit Schafhaltung. SJT destatis, Betriebe mit Verkaufsanbau von Baumobst. SJT destatis, Betriebe mit Weinbau nach Größenklassen der Rebfläche. SJT destatis, Güterverzeichnis für Produktionsstatistiken (GP 2009). destatis, Vom Erzeuger zum Verbraucher - Fleischversorgung in Deutschland, Studie. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 106

107 destatis, Wirtschaftszweige A - LAND- UND FORSTWIRTSCHAFT, FISCHEREI, Liste.xls. destatis, Produktion ausgewählter Erzeugnisse. SJT destatis, Vertragsanbau wichtiger Gemüsearten. SJT destatis, Ackerland nach Hauptgruppen des Anbaus. SJT destatis, Anbau, Ertrag und Ernte von Freilandgemüse. SJT destatis, Anlandungen der Hochsee- und Küstenfischerei 01 bis 09. SJT destatis, Anlieferung von Schlachttieren 1991 bis SJT destatis, Anzahl der Mühlen und Vermahlung. SJT destatis, Die Struktur der Mühlenwirtschaft, SBB , Studie. destatis, Einkaufsstätten privater Haushalte. SJT destatis, Erzeugung von Eiern 1991 bis SJT destatis, Erzeugung von Gemüse 02/03 bis 09/10. SJT destatis, Erzeugung von Kuhmilch 1991 bis SJT destatis, Getreideverbrauch für Nahrung, Industrie und Futter 01/02 bis 08/09. SJT destatis, Herstellung von Fischerzeugnissen 2003 bis SJT destatis, Inlands-, Auslandsumsatz und Exportquote Ernährungsgewerbe. SJT destatis, Klassifizierungssystem der EU für landwirtschaftliche Betriebe. SJT destatis, Kuhbestände unter Milchleistungskontrolle. SJT destatis, Ldw. Erzeugung in Getreideeinheiten 02/03 bis 08/09. SJT destatis, Legehennenhaltung nach Haltungsformen. SJT destatis, Schlachtungen und Fleischanfall nach Tierarten 1991 bis SJT destatis, Verbrauch ausgewählter Lebensmittel je Kopf 01/02 bis 08/09. SJT destatis, Verbrauch von Nahrungsmitteln je Kopf 00/01 bis 08/09. SJT destatis, Verbrauch von Tiefkühlkost 2002 bis SJT destatis, Verkaufsstätten im Lebensmitteleinzelhandel 1996 bis SJT destatis, Versorgung mit Eiern 1991 bis SJT destatis, Versorgung mit Kartoffeln. SJT destatis, Versorgung mit Ölen und Fetten. destatis, Versorgung mit Ölsaaten u. pflanzl. Ölen und Fetten 02 bis 09. SJT FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 107

108 destatis, Zahl der Betriebe des Produzierenden Ernährungsgewerbes 05 bis 09. SJT destatis, Zahl der Haltungen/Betriebe mit Tieren. SJT destatis, Landwirtschaft auf einen Blick, Studie, Statistisches Bundesamt, Wiesbaden Deutsche Vernetzungsstelle Ländliche Räume, Lokale Aktionsgruppen in Niedersachsen, Regionale Vermarktungsinitiativen in Niedersachsen. Expertenbefragung. Deutscher Brauer-Bund e.v., Betriebene Braustätten nach Bundesländern. Verfügbar unter:ätten%20nach%20bundesländern% pdf Dialego AG (Hrsg.), Regionale Produkte. Aachen Dialego AG, Regionale Produkte - Eine Befragung der Dialego AG. Charts. Die Wissenschaftlichen Beiräte des BMELV, Gemeinsame Stellungnahme Politikstrategie FoodLabelling. Dierenbescherming, (abgerufen am ). Verfügbar unter: DLG, DLG-Lebensmitteltage 2011: Regionalität ist ein langfristiger Trend. Verfügbar unter: DLG, Neue DLG-Studie: Regionalität aus Verbrauchersicht (abgerufen am ). Verfügbar unter: DLG, Regionalität aus Verbrauchersicht. Studie, Frankfurt a.m. Ecco GmbH, Zum Stand der Forschung, Verbraucherzentrale Bundesverband - Seminar V bis in Hannover. Vortrag-Charts. Fahrner, Andreas, Potentialanalyse für die b2b-vermarktung regionaler Lebensmittel im Wechselland. Diplomarbeit. Wien: Universität Wien. Verfügbar unter Fair & regional. Bio Berlin-Brandenburg, Fair-Regional-Charta Berlin-Brandenburg. Stand: (abgerufen am ).Verfügbar unter: Fairtrade Labelling Organizations International (2011). Homepage der Fairtrade Labelling Organizations International (abgerufen am ). Verfügbar unter: Familie Redlich, Regionalsiegel in Deutschland, Dossier für das Jahr Im Auftrag des BMELV. Fink-Keßler, Andrea et al., Mit Kanonen auf Spatzen geschossen - Rechtliche Hemmnisse einer handwerklichen Fleischverarbeitung und -vermarktung von Landwirten und Metzgern. Teil 1. In: arbeitsergebnisse Heft 55. Zeitschrift der AG Land- und Regionalentwicklung. Kassel: Universitätsverlag. gastgewerbe-magazin, Trend setzt sich durch - Gastronomie setzt auf Regionalität (abgerufen am ). Verfügbar unter FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 108

109 Gerschau, Monika, Nina Jack, Christine Neubert, Dr. Michael Berger und Monika Luger, Ansatzpunkte für eine regionale Nahrungsmittelversorgung. Verfügbar unter: Göppel, Josef, Die Farben der Zukunft - Wie regionales Wirtschaften erfolgreich wird. In: Deutscher Verband für Landespflege - DVL (Hg.): Grundlagen der Regionalvermarktung. DVK-Schriftenreihe: Landschaft als Lebensraum 5. S. 4-15). Verfügbar unter: Grube, Geographische Herkunftsangaben. In: U. Krell und K. Warzecha (Hrsg.), Praxishandbuch Lebensmittelkennzeichnung. 38. Ergänzungslieferung Hamburg: Behr s Verlag. ISBN Gurrath, Peter, Fleischversorgung in Deutschland Ausgabe Wiesbaden: Statistisches Bundesamt. Verfügbar unter: oeffentlichungen/landforstwirtschaft/viehbestandtierischeerzeugung/fleischversorgung ,property=file.pdf Halk, Oliver und Werner Detmering, Stellenwert der regionalen Herkunft von Lebensmitteln auf Märkten aus Verbrauchersicht - Kurzfassung der Ergebnisse einer stichprobenartigen Erhebung auf Märkten in Hannover und Oldenburg im Vergleich. Hannover. Härlen, Ingo, Johannes Simons und Carl Vierboom, Die Informationsflut bewältigen: über den Umgang mit Informationen zu Lebensmitteln aus psychologischer Sicht. Heidelberg: Dr. Rainer Wild Stiftung. ISBN Hasan, Yousra, Einkaufsverhalten und Kundengruppen bei Direktvermarktern in Deutschland: Ergebnisse einer empirischen Analyse. Göttingen: Georg-August-Universität Göttingen. Verfügbar unter lten...pdf. Haß, Peter, Weinbezeichnungs- und Warenzeichnungsrecht. In: GRUR. Gewerblicher Rechtsschutz und Urheberrecht. München: Verlag C.H. Beck. Hausladen, Iris, Nicole Porzig und Melanie Reichert. Nachhaltige Handels-und Logistikstrukturen für die Bereitstellung regionaler Produkte: Situation und Perspektiven, HHL- Arbeitspapier Nr. 93; ISSN (Online-Version). Verfügbar unter Henseleit, Meike, Sabini Kubitzki, Daniel Schütz und Ramona Teuber, Verbraucherpräferenzen für regionale Lebensmittel: Eine repräsentative Untersuchung der Einflussfaktoren. Gießen: Justus-Liebig-Universität Gießen. Verfügbar unter: Hock, Sonja, Engagement für die Region: Initiativen der Regionalbewegung in der Region Nürnberg: Ziele, Strategien und Kooperationsmöglichkeiten, Erlangen: Fränkische Geogr. Ges. ISBN Hollstein, A., Mengenströme und Wertschöpfung im deutschen Getreidesektor. Verfügbar unter: Horx, Matthias, Vertrauen und Authentizität. Interview in: SnaxxMagazin_3_2005_Zukunft, S. 20 ff. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 109

110 Hühne, Klaus, Deutscher Fleischer-Verband e.v., Befragung am zum Thema Selbstschlachtung, Befragung durch MG-Niedersachsen e.v. IMK Institut für angewandte Marketing und Kommunikationsforschung GmbH and MDR- Werbung GmbH, West-Ost-Markenstudie Verfügbar unter: Institut Fresenius, SGS Institut Fresenius Verbraucherstudie 2010: Lebensmittelqualität und Verbrauchervertrauen. Zusammenfassung (abgerufen am ). Taunusstein. Verfügbar unter: Institut Fresenius, SGS Institut Fresenius Verbraucherstudie Lebensmittelqualität und Verbrauchermacht. Zusammenfassung. Taunusstein/Hamburg. Verfügbar unter: Janssen, Meike und Ulrich Hamm, Standards und Kennzeichen für Öko-Lebensmittel aus Verbrauchersicht: Empfehlungen für agrar-politische Entscheidungsträger. In: Bundesministerium für Ernährung, Landwirtschaft und Verbraucherschutz (Hrsg.). Berichte über Landwirtschaft Band 88 (1). Bonn. ISSN S Verfügbar unter: df;jsessionid=40a0036a601e eee9b4f3452db.2_cid163? blob=publicationfile. Knaak, Roland, Der Schutz geographischer Herkunftsangaben im neuen Markengesetz. In: GRUR. Gewerblicher Rechtsschutz und Urheberrecht. München: Verlag C.H. Beck. Kögl, Hans und Jana Tietze, Regionale Erzeugung, Verarbeitung und Vermarktung von Lebensmitteln, Forschungsbericht. Uni Rostock. ISBN Verfügbar unter: Kopp, Sören, Geografische Qualitätszeichen für Lebensmittel - Staatliche Absatzförderung und Warenverkehrsfreiheit. Bayreuth: Verlag P.C.O. ISBN Kuhnert, Heike, Gesine Behrens und Volker Beusmann, Bericht zum Projekt Strukturdaten Hamburger Öko-Markt. Verfügbar unter: Kuhnert, Heike, Gesine Behrens und Volker Beusmann, Kurzfassung der Studie Strukturdaten Hamburger Öko-Markt. ISBN: Verfügbar unter: Kullmann, Armin und Claudia Leucht, Synergie oder Profilverlust? Potentiale und Probleme einer gemeinsamen Regionalvermarktung ökologischer und konventioneller Produkte. Verfügbar unter: Kullmann, Armin, Regionalvermarktung - Mit professionell organisierten Projekten neue Marktpotenziale erschließen. In: ÖKOLOGIE&LANDBAU, 3/2004, Bad Dürkheim: Stiftung Ökologie & Landbau. S Verfügbar unter: Artikel0704ak.pdf. Kullmann, Armin, Regionalvermarktung von Öko-Produkten: Erfolgsfaktoren, Stand und Potentiale. In: Kullmann, Armin (Hrsg.): Ökologischer Landbau und Nachhaltige Regionalentwicklung. Tagungsband zur Tagung des Instituts für Ländliche Strukturforschung vom Frankfurt am Main: Institut für Ländliche Strukturforschung. S Kullmann, Armin, Regionalvermarktung und Regionalentwicklung in Modellregionen - Synergien und Handlungsbedarf. In: Antoni-Komar, I., R. Pfriem, T. Raabe und A. Spiller FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 110

111 (Hrsg.): Ernährung, Kultur, Lebensqualität - Wege regionaler Nachhaltigkeit. Marburg: Metropolis. Kullmann, Armin, 2008, Erfolgsfaktoren für regionales Nachhaltigkeitsmarketing - Regionale Lebensmittel und Gesundheit, Vortrag an der Hochschule Neubrandenburg. Kunkel, Sabrina, Uwe Platz und Reinhard Wolter, Die Struktur der Mühlenwirtschaft in Deutschland. Wirtschaftsjahr 2009/10. Bonn: Bundesministerium für Ernährung, Landwirtschaft und Verbraucherschutz (Hrsg.). ISSN Verfügbar unter:, LZ-Studie: Potenzial für viele Sortimente ( ). Verfügbar unter: Potenzial-fuer-viele-Sortimente_65490.html?id=65490&a=0., Regionalität: Qualitätsversprechen zählen ( ). Verfügbar unter: Qualitaetsversprechen-zaehlen_64978.html?id=64978&a=2., Landgard setzt auf deutsche Paprika ( ). Verfügbar unter: Paprika_75812.html?a=2., Westfleisch stellt Regionalität heraus ( ). Verfügbar unter:, Keine Berührungsängste: Interview mit Vion Chef Dr. Uwe Tillmann ( ). Verfügbar unter:, Trend zu Markenprodukten ( ). Verfügbar unter: Markenprodukten_78342.html?id=78342&a=2., Upgrading für Bio ( ). Verfügbar unter: Handel_1157_7001.html., Vitaminpatroitismus ( ). Verfügbar unter: Vitaminpatriotismus_80609.html?id=80609&a=2., Bio und Local Food wären ein Dream-Team ( ). Verfügbar unter: Local-Food- waeren-ein-dream-team_84927.html?a=2., Hemme-Milch beliefert Edeka ( ). Verfügbar unter: Edeka_84535.html?a=2., Nach der Bio- rollt nun die Regio-Welle ( ). Verfügbar unter: Leitow, Detmar, Produktherkunft und Preis als Einflussfaktoren auf die Kaufentscheidung: Eine experimentelle und einstellungstheoretisch basierte Untersuchung FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 111

112 des Konsumentenverhaltens bei regionalen Lebensmitteln. Dissertation. Berlin: Humboldt- Universität. Verfügbar unter: 18/PDF/Leitow.pdf. Leser, Hartmut (Hrsg.), Diercke Wörterbuch Allgemeine Geographie. München, Braunschweig. ISBN Marketinggesellschaft der niedersächsischen Land- und Ernährungswirtschaft e.v., Direktvermarkterbefragung Charts. Marketinggesellschaft der niedersächsischen Land- und Ernährungswirtschaft e.v., Regionale Vermarktungsinitiativen in Niedersachsen. Ergebnisse einer Expertenbefragung. MVS Milchvermarktungsgesellschaft mbh, Die faire Milch (abgerufen am ). Verfügbar unter: Naturland, Fair Zertifizierung (abgerufen am ). Verfügbar unter: Nestlé Deutschland AG (Hrsg.), So is(s)t Deutschland. Ein Spiegel der Gesellschaft. Stuttgart: Matthaes. ISBN Nestlé Deutschland AG, Nestlé Studie 2009, Ernährung in Deutschland Kurzfassung. Niedermaier, Jakob, 2011). Stellungnahme MVS GmbH zum Urteil Wettbewerbszentrale / Die faire Milch (abgerufen am ). Verfügbar unter: 411.pdf. ÖGS - Ökologischer Großküchen Service Rainer Roehl, Anja Erhart & Dr. Carola Strassner GbR (Hrsg.), Mit einfachen Schritten zum Bio-Zertifikat: Ein Leitfaden für Großküchen und Gastronomie. Frankfurt am Main. Verfügbar unter: Zertifizierung.pdf. Öko-Test, Der große Schwindel. In: Öko-Test 9/2011, S. 14 ff. Otto GmbH & Co KG (Hrsg.), Verbrauchervertrauen. 3. Studie zum ethischen Konsum. Auf dem Weg zu einer neuen Wertekultur. Hamburg: Ottogroup. Verfügbar unter: Verbauchervertrauen.pdf. Pohle, R Anforderungen an regionale Lieferanten im Lebensmittelhandel. Vortrag gehalten am in Hannover. Pohle, R Anforderungen des LEH an Lieferanten, Textsammlung zur Vorbereitung des Regionalworkshops. Profeta, Adriano, Die Bedeutung von geschützten Herkunftsangaben in der Produktmarkierung für Lebensmittel und Schlussfolgerungen für das Marketing: Eine Discrete- Choice-Analyse von Kennzeichnungsmöglichkeiten und deren Wahrnehmung aus Verbrauchersicht für die Produktkategorien Bier und Rindfleisch. Dissertation an der Technischen Universität München-Weihenstephan. Rathke, Kurt-Dietrich, In: Walter Zipfel und Kurt-Dietrich Rathke. Lebensmittelrecht, Rn. 120, 144. Ergänzungslieferung München: Verlag C.H. Beck. ISBN FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 112

113 Reinhardt, Guido, Sven Gärtner, Julia Münch und Sebastian Häfele, Ökologische Optimierung regional erzeugter Lebensmittel: Energie- und Klimabilanzen. Heidelberg: Ifeu - Institut für Energie- und Umweltforschung Heidelberg GmbH. Verfügbar unter: Rippin, Markus, Öko-Absatzpotenziale in NRW bis Studie. Münster: Westfälisch Lippischer Landschaftsverband e.v. (Hrsg.). Verfügbar unter: Rutenberg, Jan, tegut lokal. Ergebnis Fokusgruppen Fulda, Gotha & Wiesbaden. Sauter, Arnold und Rolf Meyer, Potenziale zum Ausbau der regionalen Nahrungsmittelversorgung: Endbericht zum TA-Projekt Entwicklungstendenzen bei Nahrungsmittelangebot und -nachfrage und ihre Folgen. TAB - Arbeitsbericht Nr. 88. Berlin: Büro für Technikfolgen-Abschätzung beim Deutschen Bundestag. Verfügbar unter: Schaer, Burkhard, Regionales Gemeinschaftsmarketing für Öko-Lebensmittel, dargestellt am Beispiel der Konzeption des Zeichens Öko-Qualität, garantiert aus Bayern. Dissertation an der TU München-Weihenstephan, Veröffentlichung in Vorbereitung. Schlich, Michaela und Elmar Schlich, Consumer response to the Product Carbon Footprint, Universität Koblenz-Landau und Justus Liebig Universität Gießen. Verfügbar unter: pdf. Schmidt, Christian, Oliver Halk und Werner Detmering, Betriebsvergleich der deutschen Mühlenwirtschaft 2007: Ergebnisbericht einer Unternehmenserhebung. Hannover: Marketinggesellschaft der niedersächsischen Land- und Ernährungswirtschaft e.v. Siemes, Johannes und Katja Kröll, Sortimente und Warengruppen im deutschen Lebensmitteleinzelhandel. Köln: KMPG Deutsche Treuhand-Gesellschaft. Verfügbar unter: _-_eine_bewertung_aus_verbrauchersicht.pdf. Sindel, Heiner, Erzeugung und Vermarktung von landwirtschaftlichen Qualitätsprodukten, Vortrag am 14. und in der Kalkscheune Berlin. SKOPOS Institut für Markt- und Kommunikationsforschung GmbH & Co. KG, SKOPOS- Studie zu Lebensmittelsiegeln: Regionale Herkunft ist wichtiger als Bio (abgerufen am ). Verfügbar unter: Spiller, Achim und Birgit Schulze (Hrsg.), Zukunftsperspektiven der Fleischwirtschaft: Verbraucher, Märkte, Geschäftsbeziehungen. Göttingen: Universitätsverlag Göttingen. ISBN Verfügbar unter handle/goescholar/3201/fleischwirtschaft.pdf?sequence=1. Spiller, Achim und Nina Stockebrand, Bio-Vermarktung im Handel: Regional und authentisch! Vortrag am im Rahmen der Bio-Sonderschau in Düsseldorf. Statista, Umsatz mit Food im LEH nach Warengruppen 2009, Studie, Charts. Statista, Bioprodukte und Gründe für deren Einkauf, Studie, Charts. Statista, Einkaufsstätten bei Bioprodukten seit Studie, Charts. FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 113

114 Steinheuer, Christina, Megatrend Regionalität. In: Lebensmittel Praxis. 3/2011. S Stiftung Warentest, Essen von hier - Regionale Lebensmittel. In: test, 4/2011. Berlin: Stiftung Warentest. ISSN S Stockebrand, Nina und Achim Spiller, Verknüpfung regionaler Beschaffungskonzepte mit innovativen regionalen Marketingansätzen. Abschlussbericht BÖL und Umwelt der Technischen Universität München zur Erlangung des akademischen Grades eines Doktors der Agrarwissenschaften (Dr. agr.) genehmigten Dissertation. Verfügbar unter: beschaffungskonzept_kehk.pdf. Stoyke, Cord, Regionale Produkte - Imageträger der Region? Workshop Regionale Vermarktung - Entwicklungsperspektiven in der niedersächsischen Küstenregion Wilhelmshaven, Streinz, Rudolf, Lebensmittelrechts-Handbuch. 32. Auflage. München: Verlag C.H. Beck. ISBN Thiedig, Frank, Nachhaltigkeit im LEH, Chancen in der Zusammenarbeit mit der Ernährungswirtschaft, Edeka Minden, Vortrag. Verbaucherzentrale des Saarlandes e.v., Kennen Sie regionale Lebensmittel? (abgerufen am ) Verfügbar unter: Verbraucherzentrale, Die Ausweise, bitte! Lebensmittel aus aller Welt. Kennzeichnung lückenhaft und missverständlich. Hamburg: Verbraucherzentrale. Verfügbar unter: Verbraucherzentrale, Positionspapier zur verbrauchergerechten Kennzeichnung von regionalen Lebensmitteln (Stand ). Verfügbar unter: download/ _positionspapier%20vzen%20regionalkennzeichnung.pdf. Wagenhofer, Gertraud, Globalisierung versus Regionalisierung: Lebensmittel zwischen Regionalisierung und Globalisierung. Innsbruck: Leopold-Franzens-Universität Innsbruck. Werlen, Benno, Sozialgeographie alltäglicher Regionalisierungen. Band 2: Globalisierung, Region und Regionalisierung. Stuttgart. Erdkundliches Wissen, Band119. Westfleisch o. J. Aktion Tierwohl (abgerufen am ). Verfügbar unter: Wikipedia, Artikel zum Begriff Nachhaltigkeit (abgerufen am ). Verfügbar unter: Wolter, Reinhard, Die Unternehmensstruktur der Molkereiwirtschaft in Deutschland. Bonn: Bundesministerium für Ernährung, Landwirtschaft und Verbraucherschutz (Hrsg.). ISSN Verfügbar unter: Zentralverband des Deutschen Bäckerhandwerk, Das deutsche Bäckerhandwerk: Daten und Fakten Berlin. Verfügbar unter: pdf. ZMP, Nahrungsmittel aus der Region - Regionale Spezialitäten. Zentrale Markt- und Preisberichtstelle für Erzeugnisse der Land-, Forst- und Ernährungswirtschaft (ZMP) in FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 114

115 Zusammenarbeit mit der Centrale Marketing-Gesellschaft der deutschen Agrarwirtschaft mbh. CMA. Bonn. ZMP, Trendstudie Food. Gesellschaftlicher Wandel und seine Wirkung auf den Food- Bereich. Zentrale Markt- und Preisberichtsstelle für Erzeugnisse der Land-, Forst- und Ernährungswirtschaft (ZMP). Bonn. Zühlsdorf, Anke, Transparenzerhebung der regionalen Landesprogramme - Ergebnisbericht - 2. Fassung Juni Verbraucherzentralen im Rahmen der Gemeinschaftsaktion Nachhaltige Ernährung : Verbraucherzentralen Hessen (Federführung), Niedersachsen, Nordrhein-Westfalen,Saarland und Schleswig-Holstein (Hrsg.). Verfügbar unter: FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 115

116 12 Anhang 12.1 Übersichtstabelle Regionalinitiativen 12.2 Protokoll BMELV vom Protokoll Beiratssitzung vom Gesprächsnotiz BRB vom Positionspapier BRB vom Schreiben BRB vom Gesprächsnotiz BVL vom Gesprächsnotiz BVL vom Positionspapier BVL vom Protokoll AMK vom Positionspapier VZ BÖLW vom Matrix Potenzialanalyse Gesprächsleitfaden Expertenbefragung FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 116

117 12.1 Übersichtstabelle Regionalinitiativen FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH

118 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 1 Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell BB Spreewald Landschaftsraum (Landkreise, Gemeindenn) Zerzifikate DLG, QS, IFS, EUREPGAP, DEHOGA- Klassifizierungen, pro agro, Kontrollring des integrierten Anbaus von Obst und Gemüse im Land Brandenburg e.v, kontrolliert ökologische Produktion, integrierter Pflanzenbaus (Fördergemeinschaft Integrierter Pflanzenbau e.v.), Betriebliche Nachweiskarte Tierfutter und Aufzucht zu mind. 50% ; Anbauflächen dürfen in Ausnahmefällen in angrenzende Gemarkung reichen; Verarbeitete Produkte: Hauptrohstoffe zu mind. 50%, überregionaler Zukauf ergänzender Zutaten bei mangelndem regionalem Angebot (jährl. Überprüfung) neutrale Kontrolle durch zugelassene Prüfstelle (für g.g.a-produkte) und externe Mitglieder des Fachbeirates der regionalen Dachmarke, Markeninhaber darf Zertifizierung kontrollieren; Zertifizierung: Eigenanmeldung, Probennahme, Erstprüfung; Markennutzung für jeweils 1 Jahr BB Biosphärenreservat Schorfheide- Chorin Landschaftsraum Mindestanforderungen sind durch überprüfbare Kriterien definiert; Erzeuger: Umweltschonende Herstellung der Produkte, kurze Transportwege; Einzelhändler/Regionalläden bieten ein besonders breites Angebot an regionalen Produkten und Spezialiäten Rohstoffe "überwiegend aus dem Biosphärenreservat und der umliegenden Region" Naturschutz BE, BB VON HIER Bundes-länder BB BE fair&regional Bio Berlin Brandenburg Bundes-länder Ökologischer Landbau Erzeuger: QS, Pestizide im Pflanzenbau bedarf Empfehlung/Genehmigung d. Amtes für Verbraucherschutz, Düngung auf kontrollierter Basis, Produkte erreichen eine Qualitätszahl von mindestens 4,5 Punkten auf der DLG 5-Punkte-Skala; Verarbeiter: hohe (handwerkliche) Qualität gesichert Tiere: Vorprodukte/Futtermittel soweit als möglich aus der Region; Pflanzen: Unverarbeitet: 100%, Verarbeitet: Rohstoffe soweit wie technisch möglich, jedoch mindestens zu 70 % Gewichtsanteil, Verarbeitung in Region, außer mit stichhaltiger Begründung im Sinne der Nachhaltigkeit Meldeformular über Vertragsfläche, Aufzeichnungen über Waren- /Rohstoffeingang und -ausgang, die mind. 1x jährl. kontrolliert werden durch anerkannte Institute, ggf. Probennahme z. T. Bio; Tierwohl; Gentechnikfrei Monoprodukte zu 100%, Zusammengesetzte Produkte: % der Hauptzutat; Tiere: ab Alter v. 6 Wo in der Region (Geflügel ab 1 Wo.) Evaluation durch internes Gremium Bio; Naturschutz Besonderer Beitrag zu nachhaltiger Entwicklung der Region, zum Erhalt/zur Schaffung von Arbeitsplätzen; soziale Anliegen Nachhaltige Wirtschafts- und Handelsbeziehungen, Soziales Engagement (Berlin-) Brandenburg 4 BW Kaiserlich genießen Landschaftsraum Erzeuger: extensive Landwirtschaft, keine Klärschlämme, QbA-Kriterien (Weinbau) und Düngung und Pflanzenschutz nach QZ BW (Landwirtschaft) gentechnikfrei; Naturschutz

119 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 2 Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell BW Heimat- nichts schmeckt näher Landschaftsraum + Landkreise Erzeuger: Betriebsanerkennung als Betrieb, angemessene Qualifikation und technische Ausstattung, Mithilfe eine regionale Erzeuger-Verbraucher- Partnerschaft aufzubauen und Entwicklung des gemeinsamen Qualitätssystems zu fördern; hohe Genussqualität der Produkte durch optimale Erzeugungsund Verarbeitungsmethoden, regionaltypische Angebote, Nachhaltigkeitskriterien, kein Klärschlamm/Müllkompost interne und unabhängige Kontrollen; systematische Aufzeichnungen analog Kriterien QZ BW, Meldeformular, unangekündigte Kontrollen durch Beauftragte der Trägerorganisation, Kontrollen jährlich gentechnikfrei; PLENUM- Naturschutz-ziele aktive Stärkung der regionalen Wirtschaft, Vorprodukte und Verarbeitung "weitest möglich" durch Partner, Nutzung vorhandener Handelsstrukturen BW Gutes vom See Landschaftsraum + km umweltschonende oder ökologische Erzeugung; Richtlinien des Qualitätszeichen Baden-Württemberg (QZ) oder wirtschaften kontrolliert ökologisch (Bio- Zertifikat), Extensivflächenanteil von mind. 10 % Unabhängige Herkunftsüberprüfung artgerechte Tierhaltung, MEKA und LPR PLENUM Erzeugungs- = Vermarktungsregion; branchenübergreifende Kooperation von zur Entwicklung und Stärkung regionaler Wirtschaftskreisläufe BW PLENUM Schwäbische Alb Landschaftsraum + Landkreise Erzeuger: 10% Extensivfläche, unabhängiges Zertifizierungssystem (QZ BW, QS oder auch Beauftragung einer externen Zertifizierungsstelle ohne Programmzugehörigkeit) gentechnikfrei; Naturschutz: PLENUM-Ziele BW Regiokiste Landkreise + Gemeinden Hauptaugenmerk im Handlungsfeld Naturschutz BW Regionalwert AG Landschaftsraum Ökozertifizierung (oder Umstellung begonnen) u. Verbandszugehörigkeit, Erhaltung einer vielfältigen Kulturlandschaft, aktiver Aufbau der Fruchtbarkeit des Bodens und der Nutztiere, Erhaltung und Erhöhung der Biodiversität ökologisches Saatgut, Produktionsmittel Saatgut, Zuchtmaterial, Energie und Dünger aus regionaler Herkunft Bio Vernetzung unter Partnern; Ausbildungsplätze, Integration sozial schwächerer Menschen, mehr Facharbeitskräfte als Saisonarbeiter, gerechte Entlohnung

120 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 3 Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell BW PLENUM westlicher Bodensee Landschaftsraum BW Württemberger Lamm Bundesland Erzeuger: heimisches Futter, das aus Gras, Heu und Getreide besteht; Rasse: Merino-Landschafe; Verarbeiter: Württemberger Lämmer werden in einem Alter von 4 bis 6 Monaten geschlachtet BW echt Alb echt gut Landschaftsraum Die Herstellung/Verarbeitung erfolgt unter definierten Qualitäts-, Herstellungs- und Sozialkriterien; Teilnahmekriterien mind: 90% der Bestandteile/Zutaten (Max: 10% dürfen von außerhalb bezogen werden); Großteil der Wertschöpfung in der Region Kontrolle einmal jährlich durch ein in der Branche führendes/ obligatorisches Prüfinstitut gentechnikfrei; Naturschutz sozial-ökologische Werte (Beschäftigungsstruktur, Ausbildung, Integration von schwächeren Menschen, Entlohnung, Qualität der Arbeitsplätze) BW Naukorn Gemeinden Chemischer Pflanzenschutz, nur, wenn biologische/ mechanische Verfahren oder das Resistenzvermögen der Sorte nicht ausreichen, starke Ertragseinbußen zu vermeiden.; Verarbeiter: Es wird Natursauerteig verwendet und mit langen Teigführungen gearbeitet Verarbeitung in der Region Qualitätszeichen Baden-Württemberg umweltschonende r Anbau BW Linzgaukorn Gemeinden QZ Baden-Württemberg, Bioland Verarbeitung in der Region Kontrollen regelmäßig von unabhängigen Kontrollstellen durchgeführt; Zertifizierung: Qualitätszeichen Baden-Württemberg; Bioland, Demeter BW Onser Saft Gemeinden Erzeuger: nur ausgereiftes, ungespritztes Obst aus unserem Einzugsgebiet, d. h. strenge ökologische Richtlinien und entsprechende Kontrolle; ausschließlich Streuobstwiesen; Düngung mit Mineralischem Dünger untersagt; Verarbeiter: garantierte Abnahme; bezahlt aktuellen Tagespreis für Mostobst zzgl. Bonus von 3,50 je dz Erzeuger, Verarbeiter und Vermarktung in der Region neutrale externe Kontrollen; unangemeldete Kontrollen durch den Verein jederzeit möglich; zertifiziert nach: EG-ÖkoVO Bio; Naturschutz

121 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 4 Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell BW Steinkauz Gemeinden Erzeuger: BIO-Zertifizierung; Verarbeiter ist verpflichtet dem Erzeuger den doppelten Marktpreis, maximal jedoch 17,90 pro Doppelzentner zu zahlen neutrale externe Kontrollen und unangemeldete Kontrollen durch den Verein jederzeit möglich Bio; Naturschutz BW Schnee-wittchen Landkreise Erzeuger: Obst ausschließlich aus der Region; keine Mineralische Düngung; Vermarkter: regional Rückstandskontrollen von Saft- und Blattproben durch ein unabhängiges Labor; kontrolliert werden 20% der Bestände und 100% der Saftmenge jährlich Naturschutz BW Naturpark Südschwarzwald Landschaftsraum BW echt Schwarzwald Landschaftsraum Weidehaltung, zumindest während der Vegetationsperiode; strengen Regeln und Kontrollen, um die hohen Qualitätsstandards zu sichern; Verkauf durch die Bauern selbst als Direktvermarkter, oder regionale Metzgereibetriebe Tierwohl BW Ostalblamm Landschaftsraum Erzeuger: traditionelle Hüteschafhaltung zur Pflege wertvoller Wacholderheiden; Vermarkter: Die regionale Spezialität wird in ausgesuchten Gasthäusern und Restaurants zubereitet und serviert Erzeuger, Verarbeiter und Vermarkter in der Region Tierwohl; gentechnikfrei BW Boef de Hohenlohe unterschiedliche Grenzen Mutterkuhhaltungsaufzucht, Weidegang während Vegetationsperiode, Verzicht auf Anbindhaltung, Auslauf, ohne Tiermehl, Verbot von Medikamenten/ Leistungsförderern/kommerziellen Tiertransporten hofeigenes/regionales Futter Bio BW Schwäbisch Hällisches Schweinefleisch BESH Landkreise Verbot von Medikamenten/Wachstumsförderer/ Tiermehl u.a.; Stroheinstreu, Gruppenhaltung und Tageslicht Schlachtung in Schwäbisch Hall neutrale Kontrolle durch das Lebensmittelinstitut Lacon Offenburg (gesamte Erzeugung von der Zucht bis zur Schlachtung) Tierwohl

122 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 5 Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell BW BW Förderverein Göppinger Apfelsaft Junges Weiderind Landkreise Landschaftsraum Erzeuger: nur ungespritztes Obst von Obsthochstämmen aus Göppinger Streuobstwiesen, Max. zwei Tonnen pro Jahr Untersuchung auf Pestizidrückstände in Blattproben und Saft, Ermittlung Qualitätsmerkmale Erzeuger: Kühe werden nicht gemolken; von Mai bis Oktober Weidehaltung; Futtergrundlage überwiegend Grünfutter; Weniger als 4 Stunden Transportzeit zwischen Erzeugerbetrieb EG-Ökoverordnung Bio; Tierwohl BW So schmeckt Sigmaringen Landkreise BW Landzunge Landkreis Vermarkter: Mind. 3 Gerichte mit regionalen Zutaten auf der Karte; LandZunge-Plus: Diese Gasthöfe verwenden nur Rindfleisch aus der Region, sie kaufen überwiegend regional. BW Albkorn Landschaftsraum detaillierte Erzeugerrichtlinien; Verarbeiter: keinerlei Backmischungen oder vorgefertigte Tiefkühl-Teiglinge aus Industrieproduktion. Nur heimisches Qualitätsmehl von Albkorn Erzueuger, Verarbeiter und Vermarkter in der Region gentechnikfrei; Naturschutz: Randstreifen u.a. BW Schwäbisches Donautal Landschaftsraum BW Apfelsaft von Reutlinger Streuobst-wiesen Landkreis Baumbestand muss überwiegend hochstämmige Bäume; jedes neue Grundstück wird vorher durch Kontrollinstitut LACON geprüft; nachhaltige Bewirtschaftung der Grundstücke Erzeugung und Verarbeitung in der Region jährlich eine Besichtigung der Streuobstwiesen, Dokumentation nachhaltiger Pflege; zertifiziert nach EG-ÖkoVO Bio

123 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 6 Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell BW Apfelsaftinitiative Landkreis Böblingen Landkreis deutlich höherer Preis für Ernte als sonst üblich (7,50 Euro Aufpreis auf den jeweils aktuellen Tagespreis, pro 100 kg angelieferter Äpfel). Pflege und Erhaltung von Streuobstflächen, Nachpflanzen junger Bäume Erzeugung, Verarbeitung und Vermarktung in der Region BW Naturpark Apfelsaft Obere Donau Landschaftsraum keine Pflanzenschutzmittel/mineralischer Dünger, regelmäßige Pflegeschnitte; Verarbeiter: naturbelassener Direktsaft Apfelsaft ohne Konzentrat, Zuckerzusatz oder Konservierungsstoffe Regelmäßige Kontrollen durch ein Labor BW FÖG Förderverein regionaler Streuobstbau Bergstraße/Oden wald/kraichgau e.v. Landkreise Erzeuger erhalten höhere Preise zertifiziert nach EG-ÖkoVO Bio BW FÖS Förderverein regionaler Streuobstbau Hohenlohe Franken e.v. Landkreis Erzeuger: nur ungespritztes Obst von Hochstämmen; je nach Verkaufsergebnis einen Aufpreis von 4-12 DM pro dz BW Streuobstinitative Stadt- und Landkreis Karlsruhe Landkreis + Stadt voll ausgereifte, ungespritzte Früchte von alt bewährten, aromatischen Hochstammsorten der Region; Düngung nur bedarfsorientiert; überdurchschnittlicher Preis; ohne Zuckerzusatz; kein Konzentrat BW NABU Nellingen Ostfildern Apfelsaft Landkreise Äpfel von Streuobstwiesen die vom NABU bewirtschaftet werden; BW Förderverein Nürtinger Apfelsaft e.v. Landkreis Erzeuger: ökologischer Landbau; abgängige Obstbäume durch Hochstamm-Neupflanzungen ersetzen; Baumpflege gewährleisten; Verarbeiter: Aufpreis auf den Tagespreis regelmäßige Kontrollen (wie Begehungen/ Rückstandsanalyse) durch den Förderverein

124 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 7 Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell BW "ebbes guads" Landkreis Erzeuger: verpflichtet sich nur vollreifes und unverdorbenes Obst aus dem Zollernalbkreis abzuliefern und die Obstbäume zu pflegen Kontrolle: stichprobenweise durch den Kreisobstbauverband BW Förderverein Offenburger Streuobst Apfelsaft e.v. Landkreis Erzeuger: Obst von Hochstamm-Obstbäumen, Vorschriften zu Bewirtschaftung/Düngung/Pflege; frisches, am Baum ausgereiftem Streuobst; Verarbeitung in lokalen Mostkeltereien stichprobenartige Kontrollen durch Grundstücksbegehungen, Frucht-, Blatt- und Saftproben durchgeführt von FOSA-Beauftragten BW Freundeskreis Eberstädter Streuobst-wiesen e.v. Landkreis Erzeuger: Bioland, Obstankaufspreis weit über dem Marktpreis, dadurch Anreize zur nachhaltigen Bewirtschaftung, vollreife Früchte später Apfelsorten BW Förderverein Geislinger Apfelsaft e.v. Landkreise BW Marktgemeinsch Landschaftsraum aft Kraichgaukorn keine Pflanzenschutzmittel/Wachstumsregulatoren; Vorgaben zu Beikrautregulierung/Düngung; ausschließlich hochwertige E-Sorten; Ökostreifen; Kennzeichnung der Anbauflächen zur Transparenz für den Verbraucher Kontrollen auf allen Stufen durch einen öffentlich bestellten Sachverständigen BW Erzeugergemeins chaft Hohenloher Höfe Landkreis Erzeuger: Angebaut werden alte Dinkel- und Weizensorten ohne jegliche Spritzmittel; größerer Abstand zwischen den einzelnen Pflanzen regionale Kreisläufe und Kooperation. Ziel: umweltverträgliche und nachhaltigen Landwirtschaft Baden- Württem-berg 39 BY UNSER LAND Landkreise + Städte Erzeuger und Verarbeiter: konventionelle Ldw. Nach Unser Land Richtlinien oder ökologische Ldw. nach Biosiegel Rinder: Bezug Kälber soweit verfügbar von Partnern; Ferkelzukauf aus der Region bzw. von anerkannten Zulieferern, lückenloser Herkunftsnachweis je nach Teilbereich intern bzw. extern (TGD), Kontrollen gemäß Programm "offene Stalltür", jeweils eigenes System je Produktgruppe z.t. Bio; Tierwohl; gentechnikfrei regionale, dezentrale Strukturen, regionale Wirtschaftskreisläufe sowie Vernetzung; gerechte Preise

125 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 8 BY Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Genussregion Oberfranken Regierungsbezirk Erzeuger: Vertrieb nicht im Hard Discount, Trennung/Kennzeichnung (nicht-)regionaler Ware, Umweltverträgliche Viehhaltung, Einsatz GQS (od. gleichwertiges System), Ldw. Betrieb im Sinne des ALG und Hofstelle, dazu Hofladen/Verkaufseinrichtung/Marktbeschickung, Produktion zu 100% im eigenen Betrieb, Legehennenhaltung aus Oberfranken: rein pflanzliches Futter, Futterzukauf nur bei QS-zertifizierten Produktspezifisch zw. 50% und 100% Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell Überprüfung durch Bereisungskommission; Logoverwendung ab Verleihung für max. 2 Jahre z.t. Bio; gentechnikfrei Vernetzung ; Inhabergeführt und/oder Arbeits- und Ausbildungsplätzen BY Regional-siegel Berchtes-gadener Land Landkreis Erzeuger: Getrennte Lagerung regionaler und nichtregionaler Produkte, Tierschutzrichtlinie, Haltung auf Stroh im Laufstall erwünscht, Fütterung überwiegend mit Muttermilch, Medikamente nur zu Therapiezwecken, Transporte max. 2h; Richtlinien zu Düngung, Verarbeitung + Deklaration Geburt, Aufzucht, Schlachtung in der Region, Erzeugung Grundfutter in der Region (mind. 75%); wesentliche Rohstoffe aus der Region, 75% d. Zutaten aus (Umkreis 100km Zertifizierung: Vergabe für 1 Jahr (Urkunde) für einzelne Produkte; Einhaltung der Kriterien, v.a. aber Erfüllung des Vereinszwecks Zusatz-siegel-Bio; Tierwohl; gentechnikfrei; Naturschutz Vernetzung aller Akeure; Lehrstellen werden als Qualitätsmerkmal angerechnet BY Die Regionaltheke - von fränkischen Bauern Regierungsbezir ke + Landschaftsräu me getrennte Lagerung regionaler und nicht-regionaler Produkte unverarbeitete Monoprodukte zu 100% 5-stufig: Produktdatenblatt der Initiative; EU-Zulassung; jährliche GLK- Kontrolle; Externes Zertifizierungsinstitut - Jährlich gentechnikfrei Inhabergeführt und/oder Bereitstellung von Arbeitsund Ausbildungsplätzen BY Region Bamberg - weil s mich überzeugt Landschaftsräume getrennte Lagerung und Kennzeichnung regionaler und nicht-regionaler Produkte, Einhaltung guter fachlicher Praxis; Richtlinien Deutsche Honigverordnung, keine Antibiotika 80% d. Grund- und Rohstoffe (nach Verfügbarkeit; gesamte Mastdauer in der Region, Geburt soweit möglich/schlachtung in der Region, Futtermittel soweit möglich intern od. extern; Zertifizierung: automatische Verlängerung immer für 1 Jahr Bio: Kombination der Siegel möglich; gentechnikfrei BY VON HIER km-radius Rind: artgerechte Mutterkuhhaltung, Weidegang, Futterkontrolle; Schwein: artgerechte Haltung auf Stroh, Auslauf, Getreidefutter; Geflügel: artgerechte Haltung, Schweine-/Geflügel futter überwiegend Auslauf, Getreidefutter aus eigenem Anbau Bio; Tierwohl; gentechnikfrei Ausbildungsplätze BY Juradistl Lamm Landkreise Grundfuttermittel zu best %satz aus der Region, Rest bis 100km BY Tagwerk - Unsere Bio Nachbarn diffus Erzeuger: Mitgliedschaft in anerkanntem ökologischem Anbauverband, in erster Linie Bioland Bio; Naturschutz: Biodiversität Förderung regionaler Wirtschaftskreisläufe

126 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 9 Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell BY Nimm s RegRo nal Landkreis Anbau oder Erzeugung, Verarbeitung oder Veredelung, Wertschöpfung oder Veredelung in der Region Wertschöpfung in der Region BY Region aktiv Chiemgau Inn Salzach Planungsregion BY Freisinger Land Lankdreis BY Erzeuger: Kriterien zur Qualität, Transparenz, Regionalität, Umwelt-/Naturschutz; Nahrungsmittelsicherheit, Qualitätsorientierung, artgerechte Tierhaltung; Gastronomie: Bestimmter Anteil von regionalen Speisen und Getränken Anbau regional; Verarbeiter: Verarbeitung so weit wie möglich regional Tiere in der Region geboren und aufgezogen, Futter in der Region erzeugt Selbstauskunft, Erstkontrolle durch Audit vor Ort, Prüfung von Produktmustern >> Freigabe; Lfd. Überwachung nach Prüfplan Heimat auf m Teller Landkreis unabhängige Kontrolle gentechnikfrei: Naturschutz z.t. Bio; Naturschutz regionale Wertschöpfung, Vernetzung BY hesselberger km-radius Ankauf Obst aus Region, andernfalls deklariert (so regional wie möglich); Reine Streuobstbestände mit Mostsorten ohne chemischen Pflanzenschutz, Keine Tafelobstplantagen in der Ankaufregion vorhanden; Verarbeiter: reine Direktsäfte ohne Zusätze Selbsterklärung zum Chemieverzicht, eigener hoher Qualitätsanspruch statt Biozertifikat, Qualitätssicherung durch Kommunikation und persönliche Bindungen Naturschutz Initiierung regionaler Wirtschaftskreisläufe; Nachhaltigkeit und Fairness BY Regional-buffet Landkreise Erzeuger: regionale Erzeugnisse mit nachvollziehbarer hoher Qualität neutrale Kommission überprüft Qualität harmonische Zusammenarbeit, Ausbau der Gruppe, Netzwerk mit Partnern BY Pro Nah e.v. Lankdreis Förderung regionaler Kreisläufe und regionaler Kooperationen BY BY Altmühltaler Lamm Landkreise Qualitätssicherungsprogramm Altmühltaler Lamm Chiemgauer Naturfleisch regional und fair Richtlinien (Biokreis) ständige Überwachung der Qualitätsstandards durch QAL Name des Herstellers auf der Packung, externe Kontrollen Tierwohl; Naturschutz Bio BY Unser-Inn-Land Landschaftsraum Landschaftsraum

127 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 10 BY Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Ökomodell Achental Landkreis + Partner Alpenkonvention Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell Naturschutz,natur verträgliche Inwertsetzung der Natur für den Tourismus Sicherung der kleinstrukturierten Landwirtschaft BY Wittelsbacher Land Landkreis Erzeuger: QM-System in frei zu wählender Form erwünscht. stichprobenartig intern/durch Beauftragte; Zertifizierung: 1x jährlich, Bewertungsschema, ggf. mit externen Sachverständigen; Vergabekriterien gentechnikfrei; (Punkte) Naturschutz soziale Gesichtspunkte BY Bio-Ring-Allgäu e.v. Landkreise Ökologischer Landbau Bio; Tierwohl; Gentechnikfrei Netzwerke zwischen Produzenten und Verbrauchern; stabile Arbeitsplätze BY Regionalentwickl ung Obere Vils- Ehenbach div. Grenzen BY BY Rödelseer Markt - Lebensmittel und mehr Regierungsbezirke Lust auf unsere Natur - Landschaftsraum Hesselberg Lamm beim Einkauf werden Lebensmittel aus FRANKEN bevorzugt Naturschutz durch Beweidung BY Frankenhöhe Lamm Erzeuger: Schäfer besitzen naturschutzrelevante Weideflächen im Projektgebiet Naturpark Frankenhöhe ; Schäfer betreiben Hüteschafhaltung Futtermittel soweit wie möglich aus der Region; Zukauf von Schlachtlämmern nur von Frankenhöhe-Lamm-Betrieben Tierwohl; Gentechnikfrei; Naturschutz BY Bayerwald Jung- Rind Landschaftsraum Erzeuger: Mutterkuhhaltung ; keine Wachstumsförderer; im Sommer Weidehaltung; Haltung auf Einstreu im Winter; Verarbeiter: kurze Anfahrtswege zum Schlachthof; tierschonende streßfreie Schlachtung und hoher Hygienestandard ausschließlich einheimische Futtermittel Mitgliedschaft beim Programm "Offene Stalltür" ist Pflicht. Unangemeldete Kontrollen sind jederzeit möglich und zu gestatten Tierwohl; Naturschutz

128 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 11 Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell BY Schlaraffenburge r Apfelsaft Landkreise Bioland -Richtlinien; Für ihren Beitrag zum Naturschutz erhalten die Landwirte einen höheren Preis für ihr Mostobst Einhaltung der Kriterien vom Landesbund für Vogelschutz und einer unabhängigen Bio-Kontrollstelle geprüft Bio; Naturschutz Kontakt mit der Arbeitsloseninitiative "Global sozial" bzw. "Regional sozial" BY Ökokiste Verarbeiter 100% ökologisch produzierte Waren; kurze Transportwege, Verzicht auf Flugware, Mehrwegverpackungen und jahreszeitliche Angebote; best. Service-Leistungen, Auszeichnungen für bausgeprägt regionales/bioland/demeterangebot Kriterien, zusätzlich zu den Richtlinien der EG-Öko-Verordnung, durch staatlich anerkannte Prüfstellen jährlich geprüft Bio soziales Engagement BY BY Kalchreuther Artenreiches Kirschgarten Land - Lebenswerte Landschaftsraum Kirschen stammen von Hochstammbäumen oder hohen Halbstammbäumen Bio, gentechnikfrei; Naturschutz BY Abensberger Qualitätssprargel Stadt Sortierrichtlinien, Bodenuntersuchung jährlich, Vorschriften zu Lagerung und Meldung, kontrollierten und integrierten Anbau Qualitätsordnung unangemeldet von unabhängigen Kontrolleuren (z.b. LKP o. ä.) überprüft BY Aus der Rhön für die Rhön Landschaftsraum über Bundes-länder BY, TH, HE Zertifizierung mit Silberdisteln, da hier die Kontrolle gewährleistet ist Tierwohl; Naturschutz: Erhaltung bedrohter Arten Gastronomie mit regionalen Produkten BY REGINA Gemeinden BY Schrobenhausener Spargel Landschaftsraum Qualitätsnormen der EU und des Handelsklassengesetzes, ansonsten festgelegte Kriterien; Vorschriften zu Lagerung Vergabe der Lizenz zur Nutzung des Zeichens durch Zeichenträger; unabhängige Kontrollen BY Specht Delikatessen Bundesland GQ Bayern; Erzeuger: kontrollierter Vertragsanbau; Freilandgurke aus kontrolliertem, vertraglich gesichertem, bayerischen Anbau; Verarbeiter: max. 24h zwischen Ernte und Verarbeitung 90% der Rohstoffe Geprüfte Qualität Bayern

129 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 12 Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell BY Legegemeinschaf t - Die Biohennen EG-Öko-Verordnung; Qualitätsmanagement und Herkunftssicherheit wie auch Partnerschaften auf Basis fester Lieferverträge und fairer Preise In der Gastronomie/Verarbeitung: mind. 80 % der ldw. Bio-Rohstoffe im Umkreis von 200 km um die Produktionsstätte.; Vermarkter: 60 % jährlich Kontrolle durch staatlich Bio; Tierwohl; anerkannte Öko-Kontrollinstitute; Naturschutz: Nach erfolgreicher Zertifizierung durch Erhaltung den Biokreis bedrohter Arten sozialverträgliche Beschäftigungsverhältnisse, Stellen v.a. an Bewerber aus dem Umland BY Echt Bayern. Vom Ammersee Erzeuger: Richtlinien von Bioland; Verarbeiter: Verarbeitung von pflückfrischem Obst aus eigenem Anbau sowie von Bioland-Partnern aus der Umgebung mind. 80% Zutaten aus Bayern Bio; Naturschutz BY PEMA Randunschärfen zertifiziert nach EG-Öko-Verordnung und IFS Bio; gentechnikfrei BY BY 100% Bayerischer Meerrettich espargo - fränkische wege vom spargel zum wein Randunschärfen traditionelle Verarbeitung in alteingesessenen Betrieben erfolgt nach speziellen Rezepturen 100% g.g.a. BY Dillinger Land Landkreis BY Aus der Region - Bayerischer Untermain Landschaftsraum Landschaftsraum Landschaftsraum BY BY BY Spezialitäten zwischen Donau- Altmühl-Ilm EuRegio Salzburg- Berchtesgadener Land-Traunstein Rosenheimer Bauernherbst Lankdreise + Stadt Landkreise + Städte Landschaftsraum + Landkreis BY Schloß-brauerei Reuth Stadt, Teilregierungsbe zirk Zertifikat der ABCERT AG in Esslingen (zertifiziert nach EG-Öko-Verornung); g.g.a.

130 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 13 Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell BY So schmecken die Berge Landschaftsraum realistischer und praktikabler Anteil regional erzeugter Lebensmittel im Gesamtangebot/best. Mindestanzahl auf der Speisekarte, eigene Zubereitung, möglichst hoher Anteil an ökologischen Lebensmitteln Naturschutz: schonender Umgang mit Ressourcen und Energie BY Delikatessen aus dem oberen Werntal Landschaftsraum BY Münchner Bier Stadt Reinheitsgebot g.g.a. BY Geopark Ries - Kulinarisch Vermarkter: Partner des Geopark Ries kulinarisch obligatorisch Produkte i.d.r. von Produzenten aus der Region Tierwohl; gentechnikfrei regionale Kooperation BY BY Die Regionalbewegun Regierungsbezir g - Mittelfranken k Schnells Kürbiskernproduk Regierungsbezir te ke mindestens jährliche Kontrolle; Bioland zertifiziert Bio BY BY Chamer Schmankerl Original Service Regional (aus der Metropolregion Nürnberg) Landkreis Metropolregion Primat der kurzen Wege; Gentechnikfreiheit; Qualitätsstandards müssen eingehalten werden Rohstoffherkunft: 80% - soweit verfügbar; Herstellung zum überwiegenden Teil Einhaltung QS kontrolliert durch die Partner der Regionalkampagne gentechnikfrei keine Dumpingpreise BY Einkaufen auf dem Bauernhof Handelsbetriebe und Betriebe mit gewerblicher Tierhaltung sind ausgeschlossen; Produkte aus eigener Erzeugung/mit Angabe des Erzeugernamens bei Zukauf; max. 20% des Sortiments außerlandwirtschaftlich Lebensmittelhygiene: Betriebseigene Maßnahmen und Kontrollen gentechnikfrei; Naturschutz

131 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 14 Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell BY Allgäuer Alpgenuss - Hier schmeckt's guat Landschaftsraum gesamter Warenbezug muss offengelegt werden Netzwerk aus Erzeugern, Verarbeitern, Lieferanten und Dienstleistern BY BY ORO - Fruchtsaft aus Rohrdorf dida - Stadt Verarbeitung und Vermarktung des einheimischen Streuobstes zu Säften Hochwertige Lebensmittel aus der Region Stadt Vermarkter: Direktvermarkter Aus der Region für die Region Erzeugung und Vermarktung in der Region BY Fränkische Obstbauern e.v. Regierungsbezirke Erzeuger: Verpflichtung Obst von hoher Qualität zu produzieren; Verkauf in Hofläden oder auf dem Wochenmarkt BY Frankentomate Regierungsbezie rke Anbau von Tomaten in der Region; im Gewächshaus gentechnikfrei BY Regensburger Land - Nimm's regional Stadt/Land-kreis Vermarktung regionaler Produkte in Regionaltheken BY, TH, HE Qualität des Biospärenreserva ts Die Rhön Landschaftsraum über Bundes-länder BY, TH, HE BY, TH, HE Biosiegel Rhön Landschaftsraum über Bundes-länder BY, TH, HE EG-Öko-Verordnung 100% (Ausnahmen produktbezogen) einmal jährlich; ergänzt durch Stichproben des Dachmarkenmanagements; zertifiziert nach EG-ÖkoVO Bio Bayern 63

132 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 15 Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell HB Bremer Erzeuger- Verbraucher- Genossenschaft e.g Bio; gentechnikfrei HB Weserklasse Stadt, Landkreise Nachhaltigkeitsprinzipien, weitere (plausible, glaubwürdige, überprüfbare) Kriterien jeweils mit Partnern entwickelt; Verarbeitung: fachgerechte Verarbeitung in der Region Monoprodukte: Haupt- und Vorprodukte aus Region, Ausnahmen bei Nicht-Verfügbarkeit; Verarbeitete Produkte: Hauptrohstoff zum überwiegenden Teil aus Region Betriebskontrolle, Stichprobenartige Flächenkontrolle (intern), später zusätzlich neutrales Institut z.t. Bio; gentechnikfrei regionale Vermarktung möglichst unter Nutzung vorhandener Partner und Handelsstrukturen; soz. Nachhaltigkeit Bremen 2 HE HE HE LandMarkt Gutes aus Waldhessen Randunschärfen z.t. Bio Rhöner Weideochsen Landschaftsraum über Bundesländer BY, TH, HE Anbau umweltschonend, ohne chemischen Pflanzenschutz, mit eingeschränkter Mineraldüngung ; kein Mais/Importfuttermittel. Im Winter Fütterung mit Heu und Getreideschrot; Vermarktung: Kennzeichnung unter Angabe der Lieferanten Geburt Kälber in der Rhön, regionales Futter Tierwohl; Naturschutz Aufbau und Sicherung einer regionalen Kreislaufwirtschaft Erweiterung der Vernetzung, Stärkung der ländliche Strukturen; Erhalt der nebenerwerblichen Landwirtschaft HE Aus der Rhön für die Rhön Landschaftsraum über Bundesländer BY, TH, HE Verarbeitung von regional erzeugten Lebensmitteln in Gerichten Erzeugung, Verarbeitung in der Region Zertifizierung mit Silberdisteln Tierwohl; Naturschutz: Erhaltung bedrohter Arten Enge Zusammenarbeit mit Slow-Food und Rhönklub und ARGE Rhön HE Rhöner Apfelinitiative Landschaftsraum über Bundesl-änder BY, TH, HE Erzeugung, Verarbeitung in der Region HE Rhöner Durchblick Landschaftsraum über Bundes-länder BY, TH, HE Regionalvermarktung hochwertiger Produkte aus heimischer Erzeugung in eigenen Hofläden und Regionalladen

133 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 16 Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell HE Meissner Lamm Landschaftsraum Hüteschäfer; kein Zufüttern von Getreide; Lämmer haben 6-8 Monate Zeit heranzuwachsen Erzeuger und Verarbeiter in der Region HE Branden-steiner Bio-Apfelsaft Randunschärfen EG-Öko-Verordnung Erzeugung, Verarbeitung und Vermarktung in der Region zertifiziert nach EG-Öko-Verordnung Bio HE Lamm- Spezialitäten vom Landschaftsraum Taunus Erzeugung, Verarbeitung und Vermarktung in der Region zertifiziert nach EG-Ökoverordnung Bio HE Gutes vom Welterbe Mittelrhein Landschaftsraum Vermarktung im Regionalregal Hessen 10 HH "Aus der Region für die Region" noch in Entwicklung HH nordisch frisch Randunschärfen Gastronomie: Wareneinsatz zu mind. 60% aus regionalem Anbau Hamburg 2 MV Das Beste von Rügen Naturraum Erzeuger: Bestimmte aufgelistete Produkte sind antragsfähig; Frische, Herstellernachweis, artgerechte und überwachte Tierhaltung, gesundheitliche Unbedenklichkeit der Inhaltsstoffe, Vermeidung von langen Transportwegen Herkunftszeichen in 2 Stufen: "Original Rügen Produkt": Erzeugung des wertbestimmenden Anteils; "Rügen Produkt": Rohstoffe nicht von Rügen da nicht/nicht in ausreichender Menge vauf Rügen erzeugt Antragstellung; Antragsprüfung durch Zertifizierungskommission; ggf. Vergabe des Herkunftszeichens für 3 Jahre, dann erneute Antragstellung und Prüfung Tierwohl Hauptveredelungsstufe auf Rügen, geistig schöpferische Tätigkeit/Entwicklung von einer Rügener Person/einem Rügener Unternehmen

134 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 17 Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell MV Biosphärenreserv at Schaalsee - Für Leib und Seele Landschaftsraum Auslage von Informationen,Mindestkriterien bzgl. Ordnung, fachliche Praxis, Naturschutz; Erzeuger: Punktesystem: Mind. Zertifizierung nach QS-system/EU- Öko-Verordnung o.ä.; Verarbeiter: Herstellung von mind. drei regionalen Produkten; Vermarkter: mind. 5 regionale Einzelprodukten; Gastronomie: mind. 2 mit der Regionalmarke augezeichnete Speisen Flächen ganz oder mit wesentlichen Anteilen in der Region, Produktionsschritte/wesentliche Vorprodukte aus der Region/aus ökol. Landbau z.t. Bio; Tierwohl; gentechnikfrei; Naturschutz regelmäßige Kooperationoder regelmäßiges unentgeltliches Engagement in der Region MV Gutswerk Aufbau lokaler/regionaler Wertschöpfungsketten und Wirtschaftskreisläufe incl. energetischer Gesamtversorgung (Landwirt als Energiewirt) MV Hanseland - AMV Bundesland z.t. Bio Vernetzung MV natürlich! Mecklenburgische Seenplatte Landschaftsraum Vernetzung mit Hochschule und Zentrum für Lebensmitteltechnologie Mecklenburg Vorpommern 5 NI Hi-Land Landkreis Erzeuger konventioneller Produkte: Ressourcenschutz, Kulturlandschaftserhalt, Umwelt-/Naturschutz u.a. oder mind. EU-Bio-Verordnung zertifiziert; Vermarkter: kein Gleichzeitiges Angebot ökologischer und konventioneller Hi-Land-Produkte; fair gehandelte Produkte nicht als Konkurrenz sondern Ergänzung zu Regionalprodukten Zur Sortimentsbereicherung ggf. Zulassung von Produkten aus Nachbarregionen Selbstverpflichtung und Stichprobenkontrollen von Hi-Land z.t. Bio; Tierwohl; gentechnikfrei; Naturschutz: Artenvielfalt, Streuobstwiesen u.a. Maßnahmen Unterstützung fairen Handels durch El-Puente- Laden

135 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 18 Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell NI BR Flusslandschaft Elbe Landschaftsraum Kenntliche Ausweisung der Herkunft der regionalen Produkte sowie seiner Bestandteile; Handel: mindestens Erzeuger: Mind. 10% der Produkte in 10% der Verkaufsprodukte aus der BR-Region bezogen der BR verarbeitet/direkt vermarktet oder selbst hergestellt; Gastronomie: mindestens zwei und/oder verbraucht; mind. 20% der in der BR-Region erzeugte Lebensmittel im zusätzlichen Futtermittel aus der Speisenangebot, mindestens täglich ein Region; Verarbeiter. Mind. 30% der "Biosphärengericht" hauptrohstoffe aus der BR jährliche Kontrollen - Überprüfungen jährlich: terminierte Vor-Ort- Überprüfung durch BR und Vergaberat; Zertifizierung gilt für ein Jahr z.t. Bio; Tierwohl; gentechnikfrei; Naturschutz Vergabe mind. zweier externer Leistungen an Unternehmen/Einrichtungen in der BR; Arbeitsplätze, soziale Kriterien, Kooperation NI mehr als moor Landkreis NI LandMarkt NI Heimat Braucht Bundesland NI Regionale Esskultur Landschaftsraum/Land-kreis NI Norder Fleisch - Die Gläserne Kette Landesteil Sicherheit in allen Bereichen, Rückverfolgbarkeit bis zum Erzeuger; Verarbeiter: Herstellung von Fleisch- und Wurstwaren nach alter handwerklicher Tradition Futter vorwiegend selbsterzeugt Tierwohl NI Naturwert Randunschärfen Verweis auf bestehende Richtlinien (nicht einsehbar). Kartoffeln: Vorgaben des Prüf- und Gütesiegels der Landwirtschaftskammer hauptsächlich hofeigenes Futter, Mineralfutter von Vertragspartnern regelmäßige Überprüfung durch unabhängige Partner wie z.b. Landwirtschaftskammer Niedersachsen NI NI Nienburger Spargel Landkreis Kräuterregion Wiesteniederung e. V. Gemeinden kontrollierte Anbau- und Pflegemaßnahmen sowie kein Einsatz von Bleichmitteln regionale Kreisläufe; standortgerechte Erwerbsmöglichkeiten, soziokulturelle/soziale Einrichtungen

136 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 19 Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell NI Ise-Land km- Radius/Lankdrei s Erzeuger: keine Pflanzenschutzmittel (Futter), heimische Futtermittel, Medikamente nur zu Therapiezwekcken, Naturschutzregelungen, Bestimmungen zu Haltung, Fütterung und Maximalviehbestand Zukauf nur von Partnerbetrieben oder NEULAND-/ökologischer Tierhaltung, Rinder: 2/3 der Lebenszeit nach Erzeugerrichtlinien gehalten, Fütterung ausschließlich mit heimischen Futtermitteln Führen und Abgabe einer Schlagkartei, Nachweise führen, Kontrolle durch Naturschutzverband Aktion Fischotterschutz Tierwohl; Naturschutz NI Bundesland NI Hannover-sche Bauernmärkte Randunschärfen NI NI Verein Bauernmarkt Hildesheim e.v. Hoorn's Hof Wehnsen Randunschärfen Randunschärfen NI Verein zur Erhaltung des "Harzer Roten Höhenviehs" e.v. Der Niedersachsenteller Landschaftsraum Naturschutz: extensive Weidehaltung, Förderung seltener Rassen NI Schäfereigesellsc haft Südharz Landschaftsraum AbCert Bio; Tierwohl; Naturschutz: extensive Wanderhütehaltun g NI Zweckverband Naturpark Solling- Landschaftsraum Vogler Erzeuger: extensive Beweidung, Verzicht auf Mineraldünger/Pflanzenschutzmittel, Weidegang Naturschutz: extensive Weidehaltung, Förderung seltener Rassen

137 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 20 NI NI Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Verein zur Erhaltung des Bunten Bentheimer Schweines e.v. Diepholzer Moorschnucke Landschaftsraum Erzeuger: Mitgliedschaft in anerkannten Organisationen für artgerechte Tierhaltung bzw. ökologischen Landbau Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell lückenlose Dokumentation und Kennzeichnung der Tiere, unregelmäßige Kontrollen (Neuland etc.); g.u. z.t. Bio; Naturschutz z.t. Bio; Tierwohl; Naturschutz Aufbau eines Vermarktungsprogrammes NI, ST, TH Typisch Harz Landschaftsraum über Bundes-länder NI, ST, TH Erzeugung soweit möglich, teils aber nur die Verarbeitung, keine Vorstufen ggf. entscheidet eine Expertenkommission alle drei Jahre durch Kontrollgremium; Zertifizierung: Antrag mit Spezifikation direkt an Experten; Zulassung für drei Jahre, danach neuer Antrag Niedersachsen 21 NW Bergisch Pur Landschaftsraum Erzeugung: KULAP, Haltungsform/Besatzdichte und Futter definiert; Wildbret nicht aus Gatterhaltung, Obst: Fruchtqualität geregelt; Kartoffeln: Mindeststandard integrierter Pflanzenbau; ; Kennzeichung Pflicht unverarbeitete Monoprodukte: 100%, Schlachtung und Verarbeitung im Bergischen Land, Produktspezifische - orgaben: mind % eig. Futter, Milch für Käse zu 100%, Lebenszeit je nach Tier regelmäßige Kontrolle von unabhängigem Institut (je nach Produkt QS-System), Naturschutzmaßnahmen von den Biologischen Stationen überprüft Tierwohl; gentechnikfrei; Naturschutz NW Kartoffelprinzessi n Landesteil Erzeuger: Ackerboden: mindestens zweijährige Ruhepause; Vorgaben zu Pflanzgutbezug, Düngung, Pflanzenschutz Ernte, Lagerung Kontrollsiegel der Landwirtschaftskammer Nordrhein- Westfalen NW Senne Original Landschaftsraum Richtlinien können auf der Seite angefordert werden NW Kulturland Kreis Höxter Landkreis Getreide- und Rapsanbau nach Gramicea-Richtlinien, o.a.(z.b. Demeter oder Bioland); Schafhalter: Kriterien zu Haltung, Betreuung, Fütterung, Transport; Verarbeiter: Gastronomie: Mindestangebot und explizite Kennzeichnung Aufzucht, Verarbeitung, Produktion Tierwohl

138 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 21 Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell NW MühlenGarten Landkreis Obst/Gemüse/Getreide: Richtlinien für integrierten Pflanzenanbau, keine Herbizide/Klärsschlamm/Müllkompost, Fleisch/Eier/Milchprodukte: Q+S-Status oder EG- Ökoverordnung, Bestimmungen zu Haltung; Verarbeiter: 100% Direktsaft, Keine künstlichen Aromen/Farbstoffe in Milchprodukten Futtermittel von überwiegend eigenen Futterflächen bzw. mind. 60% aus der Region; Verarbeitung 100% betriebseigener Milch; Wild: Jagd in der Herkunftsregion; Begrenzung der Ferkelherkunft jährliche Rückstandskontrollen NW Lippe Qualität Landkreis QS/Bioland; Erzeuger: keine Klärschlämme, Tierbestandsdichte nach MURL-Blatt; Fleisch: QS- Standards, Obst: CS; Verarbeiter: kürzestmöglicihe Wege, keine Pflanzenfette/Konservierungsstoffe/Fungizide Geburt und Aufzucht, Bezug von Mitgliedsbetrieben, mind. 60% Futtermittel eigen/von Mitgliedsbetrieben; Fleisch: max. 10% Zukauf, Schlachtung ggf. in Nachbarkreisen; Pflanzensamen etc. soweit möglich; Hauptbestandteile aus der Region Nachweispflicht (System prüft sich selbst); gegenseitige Kontrollen der Betriebe als Fachleute/Konkurrenten; ggf. Betriebsprüfung durch den Verein oder den unabhängigen Vorstand, im Zweifelsfall durch unabhängige Kommission z.t. Bio; Tierwohl; gentechnikfrei Vernetzung kleiner und mittlerer Betriebe NW BIOlokal Randunschärfen Erzeuger: EU-Öko-Verordnung (oder auch Demeter/Bioland/Naturland) Bio NW Genuss aus dem Münsterland Landkreise, Stadt, km- Radius Erzeuger: QS/EUREGAP/ Bio-Richtlinien, Ansässigkeit im Kern- und Pufferbereich (10 km um die Kernregion); Gastronomie: Ansässigkeit im Kernbereich, mind. 1 münsterländische Spezialität im Angebot; Nachweispflicht nicht selbst erzeugten Waren Wachstum/Aufzucht und Verarbeitung; Hauptbestandteile verarbeiteter Produkte zu 100% (Ausnahmen nach Absprache möglich) Schriftliche Vereinbarung z.t. Bio Gastronomen beziehen Ware aus der Region/von Partnerbetrieben Nordrhein-Westfalen 8 RP Regionalmarke- Eifel Landschaftsraum Erzeuger: Getreide: Zertifizierung nach IFS (o.ä.); Ferkel: QS-Prüfsystem, Richtlinien zu Fütterung und Haltung; Rind: extensive Haltung, Medikamente nur zu Therapiezwecken; Eier: QS; Frischmilch: Kälber: Strohhaltung; Verarbeiter: Bäcker: Lage in Region, ggf. Biozertifizierung detaillierte Vorgaben zu Futterherkunft (zw. 50 und 100%), Bezug Jungtiere, Aufzuchtperiode in Region, Schlachtung in Region; Wild in Region gejagt, Backwaren: 100%, Frischmilch: je Quartal: sensorische und analytische Prüfung durch unabhängiges Prüfinstitut, QM Milch; Zertifizierung: Wildmarke wird von der Produzenen-Prüfgemeinschaft z.t. Bio; Tierwohl; vergeben gentechnikfrei

139 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 22 Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell RP SooNahe Landschaftsraum DLG-Qualitätskriterien: Mindestpunktanzahlen je Produktgruppe; Wild: Standards zur Haltung, Bestandsdichte, Fütterung etc.; DLG-Qualitätsprüfung mindestens Silber oder Prüfung durch den Markenvorstand, Eier: keine Käfighaltung, Mindestplatz, Enten+Gänse in Freilandhaltung Futter zu mindestens 51% aus eigener Erzeugung; Wild: mind. 12 Monate in Gebietskulisse; Geflügel ab 4 Wochen in Gebietskulisse; Gemüse: 100%; Verarbeitungsprodukte: 90% d. Rohwaren aus der Region 1. Eigenkontrolle + Dokumentation; 2. Systemkontrolle nach FUL/PAULa oder von Kommission (unter Führung des Markenvorstands), 3. Kontrolle der Kontrolle durch neutrale Prüfinstitute z.t. Bio; Tierwohl; gentechnikfrei; Naturschutz RP Heimat schmeckt Landkreis RP Regionalinitiative Mosel Landkreise Erzeuger: Vorgaben zu Prämierungsergebnissen, Qualifizierung, Servicequalität, Vereinsmitgliedschaft/Teilnahmen, Produktsortiment regionale Vernetzung und Kooperation RP Kräuterwind - Genussreich Westerwald Landkreise Vermarkter: Vermarktet werden Produkte, die sich durch den Dreiklang Regionalität, Qualität, Attrak-tivität auszeichnen RP Rindfleisch aus Rheinland-Pfalz Bundesland Einhaltung der im Detail geltenden Programm- /Modulkriterien; Qualitätsvorgaben; vertragliche Einbindung; Betreuungsvertrag mit Hoftierarzt; umfassende Nachverfolgbarkeit Geburt in Deutschland, Haltung mind. 6 Monate in RP/Saarland, überwiegend Hofeigenes Futter, Schlachtung/Zerlegung in RP od. angrenzendem Landkreis regelmäßige und unangemeldete Kontrollen; dreistufiges Kontrollsystem ("Eigenkontrolle", "neutrale Kontrolle" und "Kontrolle der Kontrolle") RP Pfälzer Grumbeere Randunschärfen Erzeuger: Anbau in der Region; Vermarkter: Verkauf durch Vertragspartner von Handel und Genossenschaften; Versand in das ganze Bundesgebiet und das Ausland Bodenuntersuchungen, Rückstandsanalysen; Kontrolle durch Landwirtschaftlichen Beratungs- und Kontrollrings Rheinland-Pfalz e.v./agrar-control GmbH ; Qualität durch Kontrolleure der Landwirtschafts-kammer RP Rheinland- Pfälzische Milch- & Käsestraße Bundesland z.t. Bio

140 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 23 Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell RP Wild aus Rheinland-Pfalz Bundesland RP streuobst.rlp Bundesland Wildbret ausschließlich aus dem eigenen Revier; Vermarkter: Jäger oder Forstamt Erhaltung v. Lebensräumen bedrohter Arten Rheinland-Pfalz 10 SH SH SH SH Feinheimisch- Genuss aus Schleswig- Holstein Bundesland Verarbeitung nach Regeln der Kochkunst Prozessqualitätprüfung intern geprüft; Aufnahme in Interessensgemeinschaft bei Verfolgung der Grundsätze und Gewinnung von drei Fürsprechern (Paten) aus dem Kreis der Mitglieder Käsestraße Schleswig- Holstein e.v. Bundesland z.t. Bio Qualitätsrindfleis ch Schleswig- Holstein Stiftungsland Geniesserland Bundesland Bundesland Fleisch stammt ausschließlich von Rinderrassen aus der Region; Aufzucht und Verarbeitung in von der LC Landwirtschafts-Consulting zertifizierten Betrieben die Tiere sollen ganzjährig, möglichst ohne zusätzliches Futter draußen weiden und ihre Kälber dort allein zur Welt bringen Zertifizierung durch LC Landwirtschafts-Consulting Netzwerkbildung; gegenseitige Unterstützung bei Suche nach besten Produkten aus der Region, Nachwuchsarbeit SH Holsteiner Katenschinken Bundesland Pökeln, Räuchern in Buchenholzrauch bei max. 25 C Verarbeitung in der Region Schleswig-Holstein 5 SL Bliesgauregal/ Bliesgaukiste Landschaftsraum z.t. Bio SL Vom Saarlandwirt Bundesland Landwirtschaftskammer überwacht Einhaltung der Richtlinien und vergibt Betriebszertifikat

141 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 24 Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell SL Vom SAARLANDwirt dreistufiges Kontrollsystem; neutrale Kontrollen nach DIN-Norm durch akkreditierte Institute SL Saargaukiste Naturraum/Gem einden Hochwertigkeit bei Erzeugung von Bränden und Konfitüren SL Lokalwarenmarkt St. Wendeler Land Landkreis SL Saarländlich - endlich wird s ländlich Bundesland naturnaher Anbau und Zucht heimischer Sorten und Rassen Saarland 6 SN Qualität-direkt vom Hof Bundesland SN Oberlausitz genießen Lankdreise + Stadt regionales Netzwerk; Ziel ist die regionale Wertschöpfung SN Dachmarke Bestes aus der Dübener Heide Landkreise umweltschonende Bewirtschaftung, Beiträge zur Pflege und Erhaltung einer vielfältigen Kulturlandschaft Rohstoffe "weitgehend" regional, Ausnahmen wenn Produkt hilfreiche Ergänzung darstellt/rohstoffe regional nicht verfügbar sind und Rezeptur + Verarbeiter aus Region Wertschöpfung in Region, Arbeitsplätze SN Erzeugerzusamm enschluss Muldental Einhaltung von Qualitätsmerkmalen; Absatz an Endverbraucher über eigene Hofläden, andere Direktvermarkter, LEH sowie Märkte, Messen und regionale Veranstaltungen unabhängige Qualitätsprüfungen, die über die gesetzlich geforderten Kontrollen hinausgehen SN Erzeugerzusamm enschluss Koberland w.v. Landschaftsraum, Landkreis Erzeuger: artgerechte Tierhaltung; Verarbeiter: Schlachtung auf Mitgliedsbetrieb und Verarbeitung von Fleischerei Heyer Tierwohl

142 Übersicht wirtschaftlich relevanter Regionalinitiativen in Deutschland 2011 Seite 25 Land Marke Regionsgrenze Erzeuger-, Verarbeiter- und Vermarkter-standards Produktionstiefe (Erzeuger, Verarbeiter) Kontrollsystem, Zertifizierung Zusatz-kriterien duales Modell SN SN Agrarp-rodukte Direktvermarktun g Oberes Landschaftsraum, Vogtland GmbH Landkreis Kartoffeln aus Sachsen Bundesland Verarbeiter: Schlachtung und Verarbeitung in der hofeigenen Fleischerei; Verkauf in eigenen Geschäften sowie über Märkte und Handel Pflanzgut; Vorgaben des Programms Umweltgerechte Landwirtschaft ; Vorgaben zu Ernte und Lagerung; Futter: 100% betriebseigen, Verarbeitung in Region Führen einer Schlagkartei Sachsen 7 ST Regionalmarke Mittelelbe Landschaftsraum Geburt in Gebietskulisse, Mästung mit betriebseigenem Futter; Rohmilch zu 100%; Pflanzen: Anbau und Verarbeitung in Region z.t. Bio, Tierwohl; gentechnikfrei Sachsen-Anhalt 1 TH TH Regionalmarke Thüringer Wald (noch im Aufbau) Reinstädter Landmarkt - Regional ist erste Wahl Randunschärfen Randunschärfen Thüringen 2 Deutschland 185

143 12.2 Protokoll BMELV vom FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH

144 Präsentation des Zwischenberichts Kriterien für ein bundesweites Regionalsiegel am :00 bis 17:00 im BMELV, Bonn Gesprächsnotiz Am Treffen haben teilgenommen: Dr. Hermann Schlöder (BMELV) Martina Schäfer (BMELV) Karola Röttges (MGH) A. Wirz (FiBL Deutschland e.v. ) Protokoll: Monja Kuske Kerstin Hartmann (BMELV) Peter Klingmann (MGH) Dr. R. Hermanowski (FiBL Deutschland e.v.) Dr. Rainer Gießübel (BMELV) Wilfried Schäfer (MGH) M. Kuske (FiBL Deutschland e.v.) 1 Präsentation des Zwischenberichts Die Ausarbeitung der Arbeitsschwerpunkte Analyse bzw. Entwicklung der Szenarien verläuft parallel. Ziel: bestmöglicher Kompromiss zwischen Verbrauchererwartung, und Praktikabilität. Es wurden drei Szenarien erarbeitet, - Anerkennung, Siegel, Regionalfenster - die im Anschluss an die Präsentation diskutiert werden. 2 Diskussion der Präsentation 2.1 Allgemeines Die Präsentation beinhaltet eine umfassende Darstellung auch der schwierigen Themen und Interessenskonflikte. Wie bereits im Gespräch am wurde betont, dass die Verwirklichung einer gesetzlichen Regelung ausgeschlossen ist. 2.2 Diskussion der Szenarien und Bewertungskriterien Die drei vorgestellten Szenarien wurden für vollständig erachtet. Weitere notwendige Kriterien zur Bewertung fallen nicht unmittelbar auf, wobei die Tabelle mancher Erklärungen bedarf um Missverständnissen vorzubeugen. Das Kriterium Aussicht auf Umsetzung durch die Wirtschaft müsste differenziert werden Umsetzung durch Discounter, LEH, etc. Das Szenario Siegel erscheint das am einfachsten Kommunizierbare zu sein. Eine Umsetzung durch die Wirtschaft erscheint jedoch nicht realistisch. Es wird dementsprechend nicht weiter verfolgt. Vor- und Nachteile des Anerkennungsszenarios: das Konzept eines Dachs kann, in Abhängigkeit der Kriterien, manche Akteure ausschließen. die Kommunizierbarkeit ist nicht unproblematisch; Missverständnisse entstehen leicht. Missbrauch des Dachzeichens diskreditiert die anderen Teilnehmer die Entscheidung für wen das zu konzipierende Dach ist, ist eine politische. Regionalsiegel: Vorstellung Zwischenbericht BMELV FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 1

145 Vor- und Nachteile des Regionalfensters: die Risiken und Problematiken dieses Konzepts sollten noch stärker als in der Präsentation ausgeleuchtet werden was darf es beinhalten, wer erstellt das Regelwerk und kommuniziert es? ein Deklarationsfenster bietet eine Art methodischen Rahmen, der viel Flexibilität erlaubt Frage: Wie frei wählbar sollen Regionalbezüge sein - Kriterienwahl, Schwellen, Nachprüfbarkeit das Konzept Regionalfenster liegt am nächsten an der Idee der Nahrungsmittelinfoverordnung. Fenster attraktiv, denn es ist ein Verbraucherwunsch, eine Geschichte zum Produkt zu haben 2.3 Ergebnis: Das Szenario Regionalfenster erscheint als eine attraktive Lösung und soll weiterentwickelt werden. Szenario Anerkennung soll ebenso optional weiter ausgearbeitet werden. 3 Weiteres Vorgehen Abgabe bzw. Präsentation des Konzeptes am Regionalsiegel: Vorstellung Zwischenbericht BMELV FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 2

146 12.3 Protokoll Beiratssitzung vom FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH

147 Am Treffen haben teilgenommen: Protokoll zur Beiratssitzung am Heiner Sindel Ilonka Sindel Nicole Weik Prof. Dr. Ulrich Hamm Andreas Swoboda Dr. Frank Thiedig Dr. Alexander Gerber Bruno Krieglstein Dr. Hermann Schlöder Wilfried Schäfer Peter Klingmann Karola Röttges Monja Kuske Axel Wirz Dr. Robert Hermanowski Bundesverband der Regionalbewegung e.v. Bundesverband der Regionalbewegung e.v. Bundesverband der Regionalbewegung e.v. Uni Kassel tegut Edeka Minden BÖLW Ministerium für ländlichen Raum und Verbraucherschutz Baden- Württemberg BMELV Marketinggesellschaft GUTES AUS HESSEN mbh Marketinggesellschaft GUTES AUS HESSEN mbh Marketinggesellschaft GUTES AUS HESSEN mbh FiBL Deutschland e.v. FiBL Projekte GmbH FiBL Deutschland e.v./ FiBL Projekte GmbH Protokoll: Karola Röttges, Moderation: Dr. Robert Hermanowski 1. Begrüßung und Vorstellungsrunde (Herr Schlöder ist entschuldigt, er kommt erst im Laufe der Diskussion verspätet zu dem Treffen) 2. Bericht zum Stand der Dinge Zu Beginn der Beiratssitzung wurde die Frage gestellt, was das Ziel des Treffens ist und wohin die Ergebnisse fließen. Beantwortet wurde die Frage mit der Aussage, dass die Ergebnisse der Diskussion in den Sachbericht mit eingehen Anschließend erfolgt die Vorstellung der wichtigsten Inhalte, der im BMELV vorgetragenen Präsentation o Aufgabenstellung o o o o o o Erste Arbeitsschritte Erfassung der Wünsche der verschiedenen Akteure Hierbei wurde angemerkt, dass die AMK nicht wie angegeben am 18. sondern am stattfand Der BRB findet seine Position nicht korrekt dargestellt. Weder die Verarbeitung noch die Vermarktung müssen in den Augen des BRB zu 100% in der Region stattfinden, da dies bei v.a. verarbeiteten Produkten nicht praktikabel ist. Auch will er keine staatliche Regelung des Regionalbegriffs, sondern ein privatwirtschaftliches Zertifizierungssystem. Der BRB fordert jedoch auf EU- Ebene fakultative Qualitätsangaben für den Begriff Region und regional, sodass missbräuchliche Verwendung der Begrifflichkeiten geahndet werden kann. Auf die Frage, was genau unter dem Dualen Modell zu verstehen ist, antwortete der BRB, dass im Dualen Modell wirtschaftliche und ideelle Gruppen eng zusammenarbeiten. Des Weiteren merkt der BRB an, dass die Regionalinitiativen sehr heterogen sind und unterschiedliche Arbeitsweisen haben. Eine weitere Bemerkung bei der Darstellung der Wünsche der Akteure: ein neutrales Kontrollsystem bei den Wünschen der Länder ist zu kurz gesprochen. Hierbei fehlt die Partizipation Kriterienmodelle der verschiedenen Akteure Begriffserläuterungen (Siegel, Dachmarke und Deklaration) An dieser Stelle wurde nachgefragt, ob das System der Dachmarke nicht mit dem TÜV vergleichbar sei, dass also jeder, der die Kriterien erfüllt, das Zeichen tragen darf. Als Antwort auf die Frage wird auf das Siegel verwiesen, da das Siegel ähnlich funktioniere wie das TÜV-Siegel Angemerkt wurde auch die Transparenz des Regionalfensters: Transparenz sei bei diesem System nur gegeben, wenn nicht jeder reinschreiben darf, was er will. Hier wird auf die zu einem späteren Zeitpunkt stattfindende Diskussion verwiesen; die provokante Darstellung dient auch der Anregung der Diskussion Weil es Unklarheiten bezüglich der Benennungen gibt, wird noch einmal erläutert, dass Anerkennung und Dachmarke das gleich Szenario beschreiben Kriterien für das Szenario Anerkennung Kriterien für das Szenario Regionalfenster 2. Arbeitstreffen Regionalsiegel FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 1

148 3. Diskussion Nachdem die Präsentation beendet ist, wird die Diskussion der dargestellten Ergebnisse eröffnet. Dr. R. Hermanowski übernimmt die Rolle des Diskussionsleiters: Anders als Vorgesehen wird aufgrund des engen Zeitrahmens mit allgemeinem Einverständnis auf die Blitzlichtrunde verzichtet Stattdessen wird direkt mit der Diskussion gestartet Aufgrund der bereits dargestellten Unstimmigkeiten mit den präsentierten Wünschen der Akteure und der tatsächlichen Position der Akteure, einigen sich die Teilnehmer darauf, diesen Inhalt der Folie so nicht mehr nach außen zu kommunizieren Der BRB wird gebeten, nach der Sitzung mit den Arbeitsgruppen in Kontakt zu treten und die Position noch einmal darzustellen (Swoboda): die Wünsche des Handels seien in dieser Darstellung sehr allgemein gehalten und somit akzeptabel (Hamm) stellt die Frage, ob das Ziel eine Moderation zwischen den verschiedenen Stakeholdern sei oder ob letztendlich mehr Transparenz für den Verbraucher das Ziel sei; daher sei die Diskussion wichtig für die Akteure, um den Verbraucherwunsch erfüllen zu können (H. Sindel): der Prozess, einer einheitlichen Regionalkennzeichnung laufe schon sehr lange, die verschiedenen Akteure haben unterschiedliche Positionen und sogar die Länder seien sehr heterogen in der Ausgestaltung ihrer Länderzeichen; das Wort Dachmarke sollte vermieden und eher als Regionalvermarktungssiegel bezeichnet werden; dabei könne nur ein Weg vorgeschlagen werden, doch bei der Umsetzung seien Partner wichtig. Dafür sei der momentan veranschlagte Zeitrahmen jedoch eigentlich zu gering (Hamm): die bestehenden Regionalinitiativen haben den Wunsch der Verbraucher nach mehr Transparenz sowie nach einheitlichen Kriterien nicht befriedigen können; Wichtig sei es die Frage zu klären, was das Ziel sei wo wollen wir hin? ; dabei müsse man es für den Verbraucher so einfach wie möglich machen (Gerber): es gebe unterschiedliche Herangehensweisen bezüglich der Definition von Regionalität; dabei wird die Frage bezüglich wissenschaftlicher Erkenntnisse gestellt. o Hierbei wird auf frühere Treffen und dargestellte Ergebnisse verwiesen (H. Sindel): es gebe zwei Möglichkeiten, entweder könne man die Frage jetzt ausdiskutieren oder bei der Umsetzung; dabei sein ein Ansatz auch, den Zeitraum der Diskussion zu verlängern An dieser Stelle stellt der Moderator die Frage, ob noch ein weiteres Szenario bzw. Modell fehle, oder ob die hier dargestellten alle Möglichkeiten abdecken (Swoboda): Die Frage, was genau unter dem Begriff Regionalität zu verstehen sei, sei sehr wichtig, jedoch könne man keine einheitliche Definition finden; zumal auch eine Unterscheidung nach Produktgruppe denkbar sei, insgesamt führe dieses Thema zu einer endlosen Diskussion; der Begriff Regionalität müsse gefüllt werden (I. Sindel): die Unternehmen fehlen bei der Darstellung der Akteure; was verstehen die Hersteller bzw. das Handwerk unter Regionalität? (Thiedig): der Begriff müsse definiert werden; ein freiwilliges Siegel würde keiner verwenden wollen Moderator: Zusammenfassung: es sei nicht notwendig tiefer zu gehen, doch die Meinung von Handwerk und Hersteller fehle in dieser Darstellung (Krieglstein): mache es Sinn, Regionalbewegungen zu befragen, die nicht Mitglieder des BRB seien (Wirz): ein Teil wurde bereits gefragt Wiederum stellt der Moderator die Frage, ob noch etwas fehle, woraufhin sich keiner der Teilnehmer meldet Moderator: Da das Szenario Siegel wenig Aussicht auf Akzeptanz habe, werde es nicht weiter verfolgt; dies sei auch der Auftrag aus dem BMELV; es stelle sich die Frage, ob die bisherige Vorgehensweise gut sei, oder ob ein Szenario fehle. (Krieglstein): Beispiel Qualitätssiegel Österreich: sehr weit gefasst, von Tschechien bis kleine Region in Österreich; statt Siegel sei es besser ein Qualitäts- und Herkunftszeichen zu verwenden, bei dem der Verbraucher selbst entscheiden kann, welche Region er bevorzuge (Thiedig): Statt ein neues Zeichen mit neuen Kriterien zu entwickeln, sei es doch besser, bereits bestehende Zeichen zum Beispiel der Länder zu nutzen und darauf aufzubauen (Gerber): Länderzeichen seien zu kompliziert und erfüllten nicht den Wunsch der Verbraucher; man müsse eine Lösung suchen, die verschiedenen Aspekte unter einen Hut zu bringen (Thiedig): unter Umständen seien die Chancen und Möglichkeiten der Länderzeichen gar nicht allgemein bekannt Moderator: Fehle Szenario? (Frage wird allgemein verneint) Dann sollten nun die einzelnen Modelle diskutiert werden; dargestellt seien drei Modelle, wovon zwei die Extrema darstellen und das dritte in der Mitte liege (Hamm): vorher müsse das Ziel klar sein. Das Ziel sei der Verbraucherwunsch, dass das was außen auf der Verpackung stehe auch tatsächlich in dem Produkt drin sei. (Schlöder): das Ziel sei es ein Zeichen zu entwickeln, das Transparenz für die Produkte garantiere, die regional seien; Erst anschließend müsse die Definition geführt werden, was genau Regionalität bedeute; wichtig sei die Sicherstellung, dass alle Aussagen, die getroffen werden auch wahr seien 2. Arbeitstreffen Regionalsiegel FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 2

149 (Hamm): ein Bundesland sei nicht regional (Thiedig): eine Region könne auch ein Bundesland sein; man sollte bestehende Systeme nutzen Moderator: das Ziel sei die Transparenz für den Verbraucher und nicht den Begriff Regionalität zu definieren (Krieglstein): es müsse Grenzen geben, wann ein Produkt regional ist und wann nicht (I. Sindel): eine gemeinsame Zielsetzung sei schwierig zu finden, sei aber auch gar nicht notwendig; nicht nur die Transparenz, auch die Stärkung der regionalen Wirtschaft mit den kleinen und mittelständischen Unternehmen sei wichtig Moderator: nicht Dachmarke sondern Anerkennung, weil bestehende Regionalinitiativen anerkannt werden (Schlöder): man müsse einen Rahmen schaffen, mit klaren Kriterien, wo man möglichst alle Akteure mitnehme und der Transparenz für den Verbraucher sicherstelle; dabei sei der letzte Schritt die Benennung, vorher müssten die Inhalte geklärt werden; jedes Szenario wecke bestimmt Erwartungen, daher müssten vorher die Kriterien festgelegt werden Moderator: Zusammenfassung: drei Szenarien: Anerkennung, Herkunftsdeklaration und Vernetzung bestehender Systeme; Frage: Finden sich alle wieder? (kein Widerspruch) (Krieglstein): worin bestehe Mehrnutzen eines weiteren Regionalzeichens für bestehende funktionierende Systeme? Moderator: weiteres Vorgehen: Diskussion der drei Szenarien hinsichtlich der Vor- und Nachteile anschließend Klärung der Frage, ob jemand mitmache (Thiedig): wichtig seien immer Nachvollziehbarkeit und Machbarkeit Moderator: also Transparenz und Umsetzbarkeit (Schlöder): den gesetzlichen Weg gebe es nicht; das BMELV erstelle lediglich den Rahmen für jemanden, der ihn dann nutze (Krieglstein): anhand des Beispiels Bio-Siegel könne man sehen, welches Ziel vorher festgelegt wurde und wie dieses umgesetzt wurde Moderator: Zeitlicher Rahmen: drei Szenarien 10 Minuten für jedes 4. Diskussion der drei Szenarien 4.1. Szenario 1 Koordination (bereits bestehende Systeme nutzen) (Gerber): Problem: Regionalinitiativen seien raus; bei Anerkennung hingegen könnten sich auch die Länderzeichen wiederfinden (I. Sindel): keine Regionalinitiativen nutzen ein Länderzeichen (Krieglstein): Widerspruch: in Baden-Württemberg gebe es Beispiele (Schäfer): Landmarkt nutzt Länderzeichen von Hessen; zu Gerber: Länderzeichen könne von Regionalinitiativen übernommen werden (I. Sindel): Korrektur der Aussage: nicht keine, sondern sehr wenige Regionalvermarktungsinitiativen nutzen ein Länderzeichen. Die Länderzeichen sind nicht ausreichend für Regionalvermarktungsinitiativen. Oftmals werden die Länderzeichen zwar als Basis genutzt, jedoch satteln die Initiativen anschließend ihre Kriterien für Regionalität zusätzlich auf. (Hamm): Koordination der Länder sei unmöglich (Thiedig): Widerspruch: einige Länder seien bereits zusammengeschlossen (H. Sindel): ein Zeichen für jeden mache keinen Sinn (Krieglstein): das führe zu einer Marktabschottung Moderator: Zusammenfassung: Weiteres Zeichen nicht nötig (Schlöder): Festlegung von Mindestkriterien mit einem + Moderator: die Arbeitsgruppe werde sich bezüglich Szenario 1 mit Thiedig + Krieglstein absprechen 4.2 Szenario 2 Anerkennung Klingmann fasst noch einmal zusammen, was genau Anerkennung bedeutet (siehe Folie) (Hamm): Modell 1 und 2 scheiden aus, da aus Verbrauchersicht Region auch kleinräumig sein könne; des Weiteren solle man auf keinen Fall Zusatzkriterien in das Regionalzeichen einfließen lassen, da dadurch zu viele Töpfe geöffnet würden; die Einbindung der Wertschöpfungskette müsse diskutiert werden (Weik): es stelle sich die Frage, wie das System ablaufen solle, wer vergebe das Zeichen und wer bekomme es? (Wirz): Hersteller, Handwerk etc. sind in der Darstellung rausgelassen, diese kämen auf die Stufe der Regionalinitiativen, müssten jedoch nicht Partner dieser sein Moderator: könne auch der Handel die Dachmarke verwenden? (Weik): wie seien da die genauen Vorstellungen? (H. Sindel): das Risiko, direkt an den Handel zu gehen, sei sehr hoch Moderator: Anerkennung ist hoch komplex; Beispiel: AGÖL; Frage: wer wird akkreditiert? 2. Arbeitstreffen Regionalsiegel FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 3

150 (H. Sindel): ein reines Produktlabel sei riskant; ein Schutzmechanismus sei wichtig; eine zentrale Kontrollstelle sei schwierig, besser sei es da, mit den Ländern zusammen zu arbeiten und auf die Regionen runterzubrechen; die ideelle Schiene sei wichtig (Swoboda): der Kontrollaufwand sei immer gleich groß, egal welches Szenario man betrachte; ein kleiner Hersteller müsse genauso geprüft werden wie ein großer; das Szenario Anerkennung sei unsympathisch, da die Kosten zu groß seien (Weik):Es existieren bereits Regionalvermarktungsinitiativen mit guten Kriterien- und Kontrollsystemen, die auch externe Kontrollen beinhalten.? Könne man diese nicht nutzen?; Kontrollstelle kontrolliere Regionalinitiative und die Regionalinitiative kontrolliere die Hersteller, dies sei in der Abbildung falsch dargestellt. Ziel ist, möglichst geringen Aufwand für den Produzenten entstehen zu lassen und keine Doppelarbeit zu leisten, vielmehr ist es nötig, Synergieeffekte aus bestehenden Systemen zu nutzen. (Schlöder) Prozesskontrolle sei wichtig (Swoboda): die Akteure hätten unterschiedliche Erwartungen (Wirz): Rückfrage bei Weik, ob der Ansatz richtig erfasst wurden (Weik): es gebe bereits anerkannte Kontrollstellen, man muss keine neuen schaffen. Bisher übernehmen die Kontrolle bei Initiativen oftmals externe Zertifizierungsinstitute, die z. B. auch die Bio-Kontrollen durchführen. (Swoboda): die Kontrollstelle kontrolliere im Auftrag der Regionalinitiativen Moderator: BRB als Pate für dieses Szenario Abstimmung der Arbeitsgruppe mit BRB Szenario 1: Abstimmung mit Krieglstein 4.3. Szenario 3 Regionalfenster Klingmann stellt noch einmal das Regionalfenster vor (siehe Folie) (Krieglstein): Bsp. Apfelkuchen Wertgebender Bestandteil seien die Äpfel (Wirz): nicht wertgebender Bestandteil sondern Hauptzutat werde betrachtet (Hamm): Modell verlange mündigen Bürger Entscheidung liege letztendlich bei ihm (Schlöder): Frage ob der Verbraucher dadurch überfordert sei (Swoboda)Vereinfachung für Verbraucher mache es nicht besser; mehr und detailliertere Informationen seien sinnvoller; ein interessierter Verbraucher sei auch bereit zu lesen; eine transparente Deklaration sei sinnvoll und ein menschengemäße Kommunikation; jedoch sei die Darstellung schwierig, eventuell ließe sich die Deklaration in ein Zutatenverzeichnis integrieren; das Problem bei der Anerkennung sei, dass die Angaben eventuell im Widerspruch zu der Herkunftsdeklaration stehe (Thiedig): eine Möglichkeit sei auch die Informationen im Detail mithilfe des Handys o.ä. zu kommunizieren; Entwicklungen der Technik könnten genutzt/unterstützt werden Moderator: Zusammenfassung: mit dem Begriff Regionalfenster seien bestimmte Erwartungen verbunden; besser sei ein Wo-komm-ich-her-Fenster (Hamm): Verbraucher denken von sich aus nicht an Vorstufen (Futtermittel etc.) darauf angesprochen wollen sie jedoch auch die Vorstufen regional (H. Sindel): der Job der Regionalinitiativen sei es, die Herkunft der Zutaten zu klären und das transparent zu kommunizieren. (Hamm): Beispiel Milch: Verarbeitung oder wirkliche Herkunft entscheidend? (Swoboda): Herkunft Moderator: ist Modell klar? (kein Widerspruch) Weiteres Vorgehen: kurze Pause, anschließend soll jeder angeben,. Welches Modell er bevorzugt 5. Schlussrunde (Hamm): Fenster; Koordination überhaupt nicht (Krieglstein): Ein weiteres Regionalsiegel ist nicht erforderlich, da beispielsweise das Qualitätszeichen/Qualitätsprogramm BW (wie auch das by. GQ) alle drei Szenarien bedienen kann. (Thiedig): Definition von Regionalität sei schwierig; Modell 1 (Swoboda): Modell 3 (H. Sindel): Modell 2 (I. Sindel): Modell 2; 1. Schritt: Handwerk müsse eingebunden werden (Weik): Modell 2; es sei das einzige praktikable Modell, da hier keine Verbrauchertäuschung vorliege (Gerber): Fenster am zukunftsweisenden Achtung: Modell 2 entspricht Szenario 1 in der Präsentation!! (Szenario Anerkennung ) 6. weiteres Vorgehen (Schlöder): der Zeitplan stehe fest, das weitere Arbeiten werde mit Spannung erwartet; Diskussion auf grüner Woche; Erprobung, Design (Schlöder): DLG zeige Interesse an der Umsetzung des Zeichens (Krieglstein): Frage, ob ausgeschrieben werde 2. Arbeitstreffen Regionalsiegel FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 4

151 (Schlöder): ja 2. Arbeitstreffen Regionalsiegel FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 5

152 12.4 Gesprächsnotiz BRB vom FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH

153 Zusammenfassung: Treffen Bundesverband der Regionalbewegung, MGH, FiBL zum Thema Regionalsiegel am Do, Am Treffen haben teilgenommen: Ilonka Sindel Nicole Weik Heiner Sindel Peter Klingmann Monja Kuske Axel Wirz Bundesverband der Regionalbewegung Bundesverband der Regionalbewegung Bundesverband der Regionalbewegung Marketinggesellschaft GUTES AUS HESSEN mbh FiBL Deutschland e.v. FiBL Projekte GmbH 1. Vorstellungsrunde FiBL FiBL und MGH sind Bietergemeinschaft. Die MGH spricht für die Marketinggesellschaft Baden Württemberg, Marketinggesellschaft Niedersachsen sowie für Schleswig Holstein und Bayern. Projektpartner sind weiter Tegut, Feneberg, Edeka Südwest, Bio mit Gesicht, BÖLW, Bioland, Demeter, und Naturland. Die Bietergemeinschaft wird mit allen Stakeholdern im Themenfeld Regionalität sprechen, vom Einzelhandel, den Fachhandel, handwerkliche Verarbeitungsbetriebe bis zu den Regionalinitiativen. Über alle Kontakte und Gesprächsergebnisse wird das Ministerium zeitnah informiert. 2. Vorstellungen des Bundesverband der Regionalbewegung Die Ausschreibung war deutlich umfangreicher als in der Zeit machbar erscheint.. Man fragt sich für wen die Ausschreibung erfolgt ist. Wie ist diese zustande gekommen? Kleiner anfangen wäre sinnhaft gewesen. Ein gangbarer Weg ist gewünscht. Hauptanliegen: Durch ein Siegel sollen die Regionalvermarktungsinitiativen unterstützt und motiviert werden, und damit kleinere und mittlere Unternehmen ebenso, wodurch der ländliche Raum insgesamt gestärkt wird. Die zu schützenden/zu stärkenden Initiativen sind gerade auch deswegen schützenswert, weil sie eine ideelle Komponente haben (z.b. Zusatzkriterien sozialer Art, ohne Gentechnik, Nachhaltigkeit, etc.). Ein Siegel soll dazu dienen den Verbraucher vor Mogelpackungen zu schützen, das Siegel sollte nicht für den LEH und die Ernährungsindustrie sein. Bedenken: Werden, wenn der Handel ins Konzept einbezogen wird, die Interessen der Regionalinitiativen genügend berücksichtigt? Regionalität ist der Trumpf, so dass die Großen mal die Kleinen brauchen; Der Handel soll Produkte der Regionalinitiativen stützen, nicht die Eigenmarken des Handels. Damit ein Regionalsiegel erfolgreich wird, müsste es mit Fördermitteln unterstützt werden. Stichwort TÜV: Standards entwickeln, Initiativen zertifizieren, die dann wiederum die Produktzertifizierung leisten; sowohl externes als auch internes Kontrollsystem. Wichtig: Es soll kein Zeichen entstehen, das allen Tür und Tor öffnet und gegen das Hauptanliegen arbeitet. 3. Vorgehensweise FiBL/MGH Wie in der Ausschreibung Datenerhebung: Eigenrecherche und Experten. Schwerpunkt auf öffentlich zugänglichen Inhalten, da der Fokus auf der Verbrauchersicht liegt Entwicklung von 3-4 Szenarien Absprache der Szenarien mit BMELV und Beirat Anfang Dezember Weiterentwicklung der für das Ministerium gangbaren Vorschläge Befragungen der Stakeholder bezüglich dieser Szenarien Angefragt für den Beirat sind VZ Hessen (Herr König), BÖLW (Herr Gerber), Uni Kassel (Prof. Ulrich Hamm), Bundesverband der Regionalbewegung?, eventuell weitere Teilnehmer Treffen_Bundesverband_Regionalbewegung_ FiBL Deutschland e.v., Postfach , Frankfurt am Main, Seite 1

154 4. Vorschläge zur Einbeziehung des Bundesverbandes der Regionalbewegung Mitgliedschaft im Beirat. Befragung der Regionalinitiativen als Expertenmeinung zu den entwickelnden Szenarien, gegen eine finanzielle Aufwandsentschädigung Erprobung der bevorzugten Regionalkennzeichnung durch einen gemeinsamen Antrag für ein Modellvorhaben >> Der Bundesverband möchte nicht das Feigenblättchen spielen und seiner Linie treu bleiben. Eine Möglichkeit der Zusammenarbeit besteht aus Sicht des Bundesverband nur dann, wenn die weiterzuentwickelnden Szenarien auch im Sinne der Zielvorstellungen des Bundesverbandes sind. Fibl/MGH erhält zeitnah eine Rückmeldung, ob der Vorstand des Bundesverbandes der Regionalbewegung einer aktiven Mitarbeit bei dem Gutachten zustimmt >> Das ist auch im Sinne von FiBL/MGH. Geäußerte Meinungen, auch abweichende Meinungen, werden als Expertenmeinung im Gutachten aufgenommen und weitergegeben, um ein möglichst vollständiges Bild an die Entscheidungsträger in der Politik zu übermitteln. Feuchtwangen, den Ilonka Sindel Axel Wirz Treffen_Bundesverband_Regionalbewegung_ FiBL Deutschland e.v., Postfach , Frankfurt am Main, Seite 2

155 12.5 Positionspapier BRB vom FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH

156 Positionspapier Glaubwürdige Regionalvermarktung Regionale Wirtschaftskreisläufe als Basis eines Regionalsiegels Positionierung des Bundesverbandes der Regionalbewegung als Interessenvertretung der Regionalinitiativen in Deutschland zum Thema Regionalsiegel Präambel Im Spannungsfeld der Globalisierung gewinnt Regionalität zunehmend an Bedeutung und prägt die gesellschaftliche Diskussion in Deutschland. Die Chancen zur Entwicklung des ländlichen Raumes durch Wertschöpfung in der Landwirtschaft und im Handwerk gilt es zu nutzen, um kleine und mittelständische Unternehmen als Stabilitätsfaktoren unserer Gesellschaft zu gewichten. Bundesweit wurden in den vergangenen Jahren zahlreiche Regionalvermarktungsinitiativen gegründet, die sich in ihren Regionen für die Vermarktung regionaler Produkte einsetzen. Die Gründung der Regionalvermarktungsinitiativen geht meist einher mit dem Ziel, regionale Vermarktungsstrukturen zu erhalten und wiederzubeleben, die heimischen Erzeuger und Verarbeiter zu stärken und dem wachsenden Bedürfnis der Verbraucher nach Qualität und gesicherter regionaler Herkunft der Produkte mit einem glaubwürdigen Richtlinien- und Kontrollsystem zu entsprechen. Die Bekanntheit und die Erfolge der Regionalvermarktungsprojekte sind jedoch extrem unterschiedlich. Ausgangslage Auf gesetzlicher Ebene sind bisher keine Kriterien und Richtlinien vorhanden, durch welche genau definiert ist, in welchem Rahmen mit den Begriffen Region, regional oder regionales Produkt geworben werden darf. Die Folge davon ist ein, vor allem für den Verbraucher, undurchschaubarer Markt von ehrlichen, glaubwürdigen Regionalprodukten bis hin zu Mogelpackungen, die nur Regionalität suggerieren. Anders als bei Bio- Lebensmitteln, die durch die EG-Öko-Verordnung und das Öko-Kennzeichengesetz genau definiert sind, hat der Verbraucher keine Möglichkeit regionale Produkte, die nach bestimmten Kriterien produziert werden, optisch zu identifizieren. Auch gibt es kaum Möglichkeiten missbräuchliche Regionalwerbung zu ahnden. Der Bundesverband der Regionalbewegung hatte im Rahmen des vom Bundesministerium für Ernährung, Landwirtschaft und Verbraucherschutz (BMELV) geförderten Projektes Regionale Allianzen Gelegenheit, in Expertenrunden zunächst die Sinnhaftigkeit eines Regionalsiegels für Regionalvermarktungsinitiativen zu erörtern, um anschließend das Konzept eines solchen zu entwickeln. In diesen Expertenrunden (Dezember 2009, Februar 2010, Mai 2010) wurde unter Einbeziehung des BMELV, der Marketinggesellschaft Niedersachsen, der Verbraucherzentrale Bundesverband, vertreten durch die Verbraucherzentrale Hessen, Neuland e. V., Institut für ländliche Strukturforschung, B.A.U.M.- 1

157 Positionspapier Glaubwürdige Regionalvermarktung Consult und Regionalvermarktungsinitiativen sowie unter Berücksichtigung von EU- Projekten, z.b. Regio Market (Interreg III B-Projekt), ausgelotet, wie die Glaubwürdigkeit regionaler Produktvermarktung erhöht werden kann. Weiterhin wurden die Ergebnisse des bundesweiten Treffens der Regionalvermarktungsinitiativen (Juni 2011) einbezogen. Dabei wurde festgestellt, dass ein bundeseinheitliches produktspezifisches Kriterien- und Kontrollsystem für Regionalität (noch) nicht machbar und praktikabel erscheint. Zum einen kann Regionalität nicht wie z.b. beim Öko-Siegel nach definierten Anbaukriterien erfolgen, zum anderen sind die Vielfalt und Strukturen der Regionen sowie deren Produkte enorm. Ziel Der Bundesverband der Regionalbewegung empfiehlt ein Regionalsiegel für Regionalvermarktungsinitiativen (Privatwirtschaftliches Zertifizierungssystem). Das heißt, die Vergabe des Siegels erfolgt an die Initiativen vor Ort und ist als eine Art Regionalitäts-TÜV zu verstehen. Die Initiativen können anschließend wiederum ihre Produkte damit kennzeichnen. Kontroll- und Sanktionsmechanismen im Rahmen eines Zertifizierungssystems gilt es dafür auszuarbeiten. So können regionale Produkte an Glaubwürdigkeit gewinnen sowie die Verbraucher und auch die zahlreichen ehrlich arbeitenden Regionalvermarktungsinitiativen geschützt werden. Ein Regionalsiegel muss sich von den bestehenden Qualitäts- und Länderzeichen unterscheiden und soll in keinem Fall eine Konkurrenz zu diesen darstellen. Weiterhin sind Ziele dieser Positivkennzeichnung Verbrauchern den Konsum von in ihrer Regionalität geprüften, nachvollziehbaren und gesicherten Regionalprodukten zu erleichtern, die Regionalvermarktungsinitiativen im Handel wettbewerbsfähig und konkurrenzfähig zu machen, die empfohlenen Mindeststandards für Regionalität einzuführen, die Gründung weiterer Regionalvermarktungsinitiativen im Bundesgebiet zu fördern. Zusätzlich kann aufbauend darauf die Etablierung von fakultativen Qualitätsangaben für regionales Produkt auf EU-Ebene dazu dienen, missbräuchliche Verwendung dieser Begrifflichkeiten von Seiten der Unternehmen und des Handels ahnden zu können, d.h. die Werbeversprechen können somit überprüfbar und bestrafbar gemacht werden. 2

158 Positionspapier Glaubwürdige Regionalvermarktung Kriterien für ein glaubwürdiges Regionalvermarktungssystem 1. Eigene, schlüssige Definition der Region Die Regionalvermarktungsinitiative besitzt eine schlüssige und sinnvolle Definition ihrer eigenen Region in Form einer genau definierten Gebietskulisse 2. Transparente Qualitäts- und Herkunftskriterien (Produktspezifisch für Erzeuger und Verarbeiter) Nicht zusammengesetzte Produkte (Monoprodukte) stammen zu 100% aus der definierten Region* Bei zusammengesetzten und verarbeiteten Produkten stammen die Zutaten aus der definierten Region* Die Produkte werden in der Region verarbeitet und hergestellt. Möglichst viele Akteure der Wertschöpfungskette profitieren an der Wertschöpfung (=am zunehmenden Wert der einzelnen Waren vom Rohstoff bis hin zum Endprodukt).* Qualitätskriterien existieren für die einzelnen Produktgruppen (über den gesetzlichen Standards) Es werden überwiegend heimische Futtermittel eingesetzt Die Produkte werden ohne Gentechnik erzeugt und verarbeitet (nach EGGenT- DurchfG) 3. Regionale Vermarktung und Wertschöpfung Prinzip: Aus der Region für die Region Die Vermarktung der Produkte findet überwiegend in der definierten Region statt Durch die Regionalvermarktungsinitiative ist sichergestellt, dass so viel Wertschöpfung wie möglich in der Region stattfindet Der Sitz der produzierenden Unternehmen ist in der Region* Zahlung der Gewerbesteuer in der Region 4. Kontrolle der Kriterien Die Regionalvermarktungsinitiative muss ein transparentes Kriterien- und Kontrollsystem (KuK) besitzen Die Kontrolle aller Kriterien wird durch interne und externe Kontrollen gewährleistet * Ausnahmen sind zu vermeiden. Falls Kompromisse eingegangen werden müssen (Verfügbarkeit, geeignete Verarbeitungsbetriebe o.ä.), existiert eine transparente stichhaltige Begründung im Sinne der Nachhaltigkeit. 3

159 Positionspapier Glaubwürdige Regionalvermarktung 5. Nachhaltigkeit durch ökologische, ökonomische und soziale Kriterien Ökologische Kriterien: Kurze Transportwege vom Erzeuger über den Verarbeiter/Handwerk zum Verbraucher Klima- und umweltschonende Erzeugung und Verarbeitung Förderung der bäuerlichen Landwirtschaft und damit Erhaltung der Kulturlandschaft Die Produkte stammen entweder aus konventioneller Landwirtschaft mit zusätzlichen Richtlinien über den gesetzlichen Standards oder aus ökologischem Landbau ( Bio-Produkte ) Ökonomische Kriterien: Faire Erzeugerpreise Faire Preise für die Verarbeitung Faire Ladenpreise Förderung und Erhalt von regionalen Wirtschaftskreisläufen durch Einbeziehung kleiner und mittelständischer Unternehmen und damit Erhöhung der Wertschöpfung in der Region Soziale Kriterien: Erhalt und Schaffung von Arbeits- und Ausbildungsplätzen in der Region Förderung des bürgerschaftlichen Engagements Erhalt der Lebensgrundlagen für Menschen, Tiere und Pflanze Förderung des Gesundheitsgedankens durch qualitativ hochwertige Produkte 6. Wirtschaften im Dualen Modell Regionalvermarktungsinitiativen arbeiten im Dualen Modell Definition Duales Modell: Regionale Netzwerke von Erzeugern, Verarbeitern, Handwerkern, Händlern und Verbrauchern bilden strategische Allianzen und generieren regionale Wertschöpfung innerhalb regionaler Wirtschaftskreisläufe zum gegenseitigen Nutzen aller Beteiligten. Ideelle und wirtschaftliche Gruppierungen arbeiten in der Allianz eng zusammen, um die Öffentlichkeit für die Unterstützung einer nachhaltigen Regionalentwicklung zu gewinnen. Die ideellen Gruppierungen sind Ausdruck eines bürgerschaftlichen Engagements im Sinne des Zieles zur Erhaltung der Lebensgrundlagen in der jeweiligen Region. Bundesverband der Regionalbewegung e. V. 25. November

160 12.6 Schreiben BRB vom FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH

161 Bundesverband der Regionalbewegung e. V. Geschäftsstelle. Museumstraße Feuchtwangen FiBL und MGH Herrn Axel Wirz Herrn Peter Klingmann Postfach Frankfurt am Main Feuchtwangen, 16. Dezember 2011 BUNDESVERBAND DER REGIONALBEWEGUNG E. V. Geschäftsstelle: Museumstraße Feuchtwangen Tel Fax Angebot zur Zusammenarbeit mit dem Bundesverband der Regionalbewegung im Rahmen des Projektes Sehr geehrter Herr Wirz, sehr geehrter Herr Klingmann, wir nehmen Bezug auf das Projekt, zu dessen Durchführung Sie den Zuschlag vom Bundesministerium für Ernährung, Landwirtschaft und Verbraucherschutz erhalten haben. Im Rahmen eines ersten Treffens der Marketinggesellschaft Hessen (MGH), des Forschungsinstitutes Biologischer Landbau (FiBL) mit dem Bundesverband der Regionalbewegung (BRB) am 10. November 2011 in Feuchtwangen konnten wir zunächst die Position des BRB zu den Inhalten der Ausschreibung sowie die Zielsetzungen der Regionalbewegung darlegen. Weiterhin wurde der BRB über die Vorgehensweise im Projekt informiert. Anschließend wurden von Seiten der MGH und des FiBL Vorschläge zur Einbeziehung des BRB unterbreitet (siehe Protokoll vom ). Der BRB hat sich dazu bereit erklärt, im Beirat mitzuarbeiten sowie eine Befragung der Regionalinitiativen als Expertenmeinung zu den entwickelten Szenarien, gegen eine finanzielle Aufwandsentschädigung, durchzuführen. Im Rahmen der Beiratssitzung am 9. Dezember 2011 in Fulda wurden die mit dem BMELV ausgewählten Szenarien vorgestellt. Dabei konnte festgestellt werden, dass das Szenario 1 Anerkennung am ehesten den Vorstellungen einer Initiativenzertifizierung des BRB entspricht. Das Modell der Initiativenzertifizierung wurde vom BRB in Zusam- Bankverbindung: Sparkasse Ansbach BLZ Konto VR Bank Dinkelsbühl - BLZ Konto Steuernummer Seite 1/2

162 menarbeit mit den Regionalvermarktungsinitiativen in Deutschland entwickelt. Jedoch wurde klar, dass die Ausarbeitung (Schaubild) des FiBL und der MGH nicht schlüssig ist und einer intensiven Überarbeitung bedarf. Weiterhin wurde die aus Sicht des BRB für eine saubere Potenzialanalyse äußerst notwendige Initiativenbefragung zu den Szenarien gestrichen. Im Anschluss an die Beiratssitzung wurden dem BRB von Seiten des FiBL und der MGH folgende Anliegen herangetragen: Zum einen sollte die in der Präsentation dargestellte Positionierung des BRB inhaltlich modifiziert werden, zum anderen sollte das Szenario Anerkennung konkretisiert sowie Möglichkeiten der Entwicklung des Modellvorhabens ausgelotet werden. Erster Punkt kann mit Hilfe des am 25. November 2011 beschlossenen Positionspapiers des BRB zur Glaubwürdigen Regionalvermarktung korrigiert bzw. ergänzt werden. In Anbetracht der komplexen Aufgabenstellung des Gesamtprojektes, das vor dem Hintergrund der äußerst heterogenen Arbeitsweisen der Regionalvermarktungsinitiativen in Deutschland zum aktuellen Zeitpunkt aus Sicht des BRB keine validen Entscheidungsgrundlagen im Hause des BMELV präsentieren kann, möchten wir folgendes Angebot unterbreiten: Der BRB ist grundsätzlich gerne bereit zu kooperieren und mit seinem Wissen und seinen Erfahrungen zur Seite zu stehen und entsprechende Zuarbeit zu leisten. Jedoch achtet der BRB auch darauf, was zeitlich mit den vorhandenen Ressourcen realisierbar und auf seriöse, fundierte Art und Weise machbar ist. Unter Berücksichtigung der äußerst knappen Restlaufzeit des Projektes sowie der personellen Ressourcen des BRB, möchten wir das FiBL und die MGH als Bietergemeinschaft bitten, gegenüber dem BMELV ein angemessenes Budget für den BRB als Unterauftragnehmer zu akquirieren. Die Vorstellungen liegen hier bei rund ,- EUR. Darin enthalten wären sowohl die inhaltliche und optische Ausarbeitung des Szenarios 1 Anerkennung sowie die Formulierung zur Umsetzung des Szenarios 1 im Rahmen eines Modellvorhabens. Ausdrücklich möchten wir nochmals darauf hinweisen, dass diese Zuarbeit sehr aufwändig und intensiv recherchierte Ergebnisse des BRB beinhaltet und der finanzielle Rahmen dem Anforderungsprofil einer seriösen Arbeit entspricht. Wir würden uns sehr freuen, wenn wir in der restlichen Projektlaufzeit gemeinsam Anstrengungen unternehmen, die erfolgsversprechend und mit einer hohen Akzeptanz der Partner in den Regionen im anschließenden Modellvorhaben umgesetzt werden können. Mit freundlichen Grüßen Heiner Sindel 1. Vorsitzender Bankverbindung: Sparkasse Ansbach BLZ Konto VR Bank Dinkelsbühl - BLZ Konto Steuernummer Seite 2/2

163 12.7 Gesprächsnotiz BVL vom FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH

164 1. Arbeitstreffen Regionalsiegel BVL am :00 bis 14:30 im Ökohaus, Frankfurt a. M. Gesprächsnotiz Am Treffen haben teilgenommen: C. Mieles (BVL) K. Voß (EDEKA Zentrale, HH) J. Müller (REWE, BVL) P. Klingmann MGH R. Mäder (FiBL Deutschland e.v.) A. Wirz (FiBL Deutschland e.v.) S. Rauschen (Kaufland) D. Reimerdes (Coop e.g.) A. Swoboda (tegut ) F. Wörner (Bio mit Gesicht GmbH) M. Kuske (FiBL Deutschland e.v.) F. Thiedig (EDEKA Minden) A. Weydringer (EDEKA NB-S-T) W.Schäfer MGH R. Hermanowski (FiBL Deutschland e.v.) H. Hansen (FiBL Projekte GmbH) Moderation: Axel Wirz; Protokoll: Monja Kuske 1 Begrüßung, Vorstellungsrunde 1.1 Beweggründe des BVL Das Thema Regionalsiegel tauchte im Rahmen des letzten Treffens zum Thema Qualitätspolitik auf. Es herrscht handelsseitig ein erheblicher Diskussionsbedarf. Der BVL bietet an, die Erfahrungen und Vorstellungen des Handels einzubringen, um abzuklären, was in der Praxis aus Handelssicht als möglich erscheint. 1.2 Vorstellung MGH und FiBL Marketing Gesellschaft Gutes aus Hessen mbh und FiBL Deutschland (Forschungsinstitut für Biologischen Landbau). Die MGH spricht für die Marketinggesellschaft Baden Württemberg, Marketinggesellschaft Niedersachsen sowie für Schleswig Holstein und Bayern. Projektpartner sind weiter Tegut, Feneberg, Edeka Südwest, Bio mit Gesicht, BÖLW, Bioland, Demeter und Naturland. Die Bietergemeinschaft wird mit allen Stakeholdern im Themenfeld Regionalität sprechen, d.h. Einzelhandel, Fachhandel, handwerkliche Verarbeitungsbetriebe, Regionalinitiativen. Alle Facetten der bestehenden Auslobungen werden erhoben: Kriterien der Regionalität aus Sicht der Verbraucher (Studien), Initiativen, Länderzeichen und Handelsmarken,. Daraus werden bis 5. Dezember 3-4 Szenarien entwickelt, die die gesamte Bandbreite der verschiedenen Vorstellungen der Stakeholder widerspiegeln. Als Gutachter wird die Bietergemeinschaft Regionalsiegel: Arbeitstreffen BVL FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 1

165 Präferenzen angeben, woraus nach Rücksprache mit dem Ministerium 1-2 Szenarien weiterentwickelt werden. Sondergutachten der wissenschaftlichen Beiräte des BMELV (Politstrategie Foodlabelling, September 2011). Das Gutachten hat laut BMELV keine Bindung für den laufenden Auftrag, daher für den Auftragsnehmer volle Denkfreiheit. Weder Verordnung noch Gesetz sind aus Sicht des Ministeriums geplant, daher der Wunsch die Kennzeichnung auch für die Wirtschaft attraktiv zu gestalten, bzw. Empfehlungen der Wirtschaft einzuarbeiten. 2 Vorgehensweise Die Analyse der Daten und die Entwicklung der Szenarien verlaufen parallel (Stichwort Tunnelbau). Ziel: bestmöglicher Kompromiss zwischen Verbrauchererwartung und Praktikabilität. 2.1 Aktueller Stand Derzeit vorstellbare Szenarien: 0. Kein Handlungsbedarf (ergänzt, aus der Diskussion erfolgt) 1. Akkreditierung und ggf. Zertifizierung: Schaffung von Mindestkriterien, auf die sich die Unternehmen stützen können, 2. Zeichen/Siegel mit einheitlichen Kriterien: Träger erfüllt gewisse Kriterien Siegel für Regeleinhaltung 3. Herkunftsnachweis: z. B. über Zutatenverzeichnis. Vorne Werbung, hinten Informationen. 4. Ausschöpfung bereits bestehender Möglichkeiten (ergänzt, aus der Diskussion erfolgt) 2.2 Diskussion Zu 0.: Kein Handlungsbedarf (nichts tun) Zu 1.: Für einzelne Handelsvertreter denkbar aber kompliziert und es müsste auf die Kosten geachtet werden, Festsetzung einheitlicher Kriterien schwierig. Eine Kombination aus 1. und 3. wäre für einzelne Vertreter denkbar, Art Rahmen feststecken (Vergabekriterien). Zu 2.: Es besteht Einigkeit darüber, dass kein weiteres Zeichen/Siegel gewünscht ist. Normativer Ansatz ist nicht das Ziel. Zu 3.: Über dieses Szenario wurde ohne konkrete Festlegung ausgiebig gesprochen. Es liefert sowohl Ansätze für mehr Transparenz / Authentizität als auch Seriosität, erscheint für einzelne Handelsvertreter umsetzbar und flexibel. Widersprüche (durch Koppelung mit Qualität) werden vermieden. Ermöglicht dem Verbraucher, seinen Regionalitätsanspruch durch seine Kaufentscheidung frei zu leben. Zu 4.: Möglich, zudem könnte auch hier auf mehr Transparenz gesetzt werden. So könnten die vielen individuellen Systeme bestehen bleiben, würden sich jedoch um mehr Transparenz bemühen, so dass der mündige Verbraucher selbst entscheiden kann, ob er ihnen sein Vertrauen schenkt. Die nachfolgende Übersicht enthält Einzelaspekte aus der Gesamtdiskussion ( ): Vorbehalte Fürsprache Geringe Massenkompatibilität, mögliche Zielgruppe sind nicht alle Verbraucher, sondern Regionalsiegel: Arbeitstreffen BVL FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 2

166 Verbraucherüberforderung, Mehrpreisbereitschaft geringe diejenigen mit einer Affinität für regionale Produkte. Für diese sollen Produkte attraktiv gehalten werden Gefahr, die kleinen Lieferanten/Produzenten zu verlieren (Kosten). Selbstbelastung durch Offenheit? ( 20% aus Polen ) Worträume (z. B. Region, Heimat, von hier etc.) können nicht definiert werden, solche Regionalitätsaussagen müssen auch in Verbindung mit dem POS gesehen werden. Die Festlegung übergreifender Kriterien erscheint kaum geeignet, den vielen regionalen Initiativen und Projekten gerecht zu werden. Widersprüche zwischen werblichen Aussagen und Produktinformationen (vorne, hinten) möglich. Herkunft der Rohstoffe (z. B. Konfitüre) oder letzte Verarbeitung (z. B. Kaffeeröstung) ausschlaggebend? Dies kann nur produktspezifisch beantwortet werden. Einheitliche Vorgehensweise nicht möglich. Gibt es hier eine klare Verbrauchererwartung? Die Kennzeichnung ist freiwillig und notwendig für die Kommunikation; Spielregeln für Transparenz, Werte schaffen Unterscheidung Werbung Deklaration: keine Einmischung ins Marketing (es geht weder um ein Marketingprojekt noch um Verbraucherschutz) Deklarationsfeld: Fakten Facettenreichtum/Individualität von Philosophien bleibt erhalten; evtl. Leitlinien für Werbung? (ggf. durch Marktlogik geregelt) Einbezug von Qualitätskriterien kaum durchführbar 3 Weiteres Vorgehen Ein weiterer Termin wird vereinbart, um nach der Vorstellung der Szenarien beim BMELV das weitere Vorgehen zu besprechen. Zeitspanne: Zwischen und Frankfurt, den Axel Wirz Regionalsiegel: Arbeitstreffen BVL FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 3

167 12.8 Gesprächsnotiz BVL vom FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH

168 2. Arbeitstreffen Regionalsiegel BVL am :30 bis 17:00 Uhr im Intercity Hotel, Göttingen Gesprächsnotiz Am Treffen haben teilgenommen: C. Mieles (BVL) K. Voß (EDEKA Zentrale, HH) P. Klingmann MGH S.Warth (telefonisch zugeschaltet) (Kaufland ) D. Reimerdes (Coop e.g.) M. Kuske (FiBL Deutschland e.v.) Dr. F. Thiedig (EDEKA Minden) J. Müller ( BVL, REWE) A. Wirz (FiBL Deutschland e.v.) Moderation: Axel Wirz; Protokoll: Monja Kuske 1 Begrüßung 2 Präsentation Zwischenbericht Vorlage für die heutige Präsentation war das Handout der Beiratssitzung vom sowie die gewünschten Änderungen (Beschreibung eines Szenarios Status Quo und Erfassung der Position des Handwerks und der Lebensmittelerzeugung), soweit möglich in der Kürze der Zeit. Eine gesetzliche Regelung ist ausgeschlossen, ein eigenständiges Siegel nicht gewünscht. Das Ministerium hat die Bietergemeinschaft mit der weiteren Ausarbeitung der Szenarien Anerkennung und Deklaration/Regionalfenster beauftragt. 2.1 Szenarien 0. Status Quo : Bessere Koordination und Ausschöpfung der bestehenden Möglichkeiten 1 1. Anerkennung : Schaffung von Mindestkriterien, um bestehende Systeme zu akkreditieren 2. Siegel : Träger erfüllen einheitliche Kriterien, kann auch alleine stehen 3. Regionalfenster : Deklaration Aussagen über die Herkunft angelehnt an das Zutatenverzeichnis 1 Dieses Szenario wurde im BMELV nicht präsentiert, ist dem Ministerium seit der Beiratssitzung am aber bekannt Regionalsiegel: Arbeitstreffen BVL FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 1

169 2.2 Rückfragen/Ergänzungen bei den Charts Externe Kontrollen wurden beim 1. Arbeitstreffen (Vorstellung erster Ansätze) nicht besprochen, deren Notwendigkeit ergab sich seitdem in der Ausarbeitung der Szenarien. Auf Wunsch des BVL soll bei der Beschreibung der Position des Handels Seriösität durch Information zum Verbraucher ersetzt werden. Stabile Isotopenanalyse: Risiko, unhaltbare Versprechungen zu machen und damit für noch mehr Verwirrung zu sorgen >> FiBL und MGH stellen Möglichkeiten der Überprüfung dar. Bessere Formulierung wäre: Prozesskontrolle, ggf. mit Unterstützung von Wasserzeichen (stabile Isotopenanalyse). Umsetzung müsste im Rahmen eines Modellvorhabens geklärt werden. 2.3 Diskussion Kriterien Anerkennung Modell 1 treffen bereits zu. Allerdings derzeit ohne Dach/Anerkennung. Unklarheit herrscht unter den Handelsvertretern über die Definition Dachmarke, sprich was sich letzten Endes genau dahinter verbergen soll. Handelsseitig besteht die Frage, ob zu den bestehenden handelsseitigen Kontrollverfahren noch zusätzliche externe Kontrollen notwendig sind. Es besteht die Befürchtung, dass doch wieder ein weiteres Zeichen kommt und dass der Mehraufwand durch weitere Kontrollen bzw. die Bürokratisierung des Systems kleine Verarbeiter schädigen und damit Regionalität kaputt machen könnte. Hersteller seien zu wenig berücksichtigt, und auf deren Möglichkeiten, ein System umzusetzen, sei der Handel in erster Linie angewiesen. Daher wurde angeregt, grundsätzlich auch noch einmal auf politischer Ebene zu hinterfragen, ob das Szenario 0 Ausschöpfen bestehender Möglichkeiten (im Protokoll vom Szenario 4) nicht eine Alternative zu den anderen Szenarien mit erheblichen Kontroll- und Kostenaufwand wäre. Denkbar wäre auch eine Transparenzinitiative anzustoßen, zu der sich ganze Branchen bekennen könnten. Das sei möglicherweise das Mittel der Wahl, effektiv und effizient mögliche Transparenzprobleme zu lösen. Wenn das System freiwillig ist, ist vor allem eine breite Akzeptanz notwendig. Dafür wäre vor allem die Nutzung bestehender Systeme (z. B. Länderzeichen) sinnvoll. Die Beschreibung dieses Szenarios wird mit Herrn Thiedig noch detaillierter ausgearbeitet. Für die Modelle Anerkennung sieht der Handel keine große Akzeptanz auf der Handelsebene. Zum Ausdruck wurde gegeben, dass der Verarbeitungsort für die anwesenden Handelsunternehmen das wichtigste Kriterium ist und weniger die klare Auslobung der Rohstoffherkunft. Mit Blick auf das Regionalfenster wurde angemerkt, dass auch hier trotz der verhältnismäßig etwas geringer erscheinenden Belastung kleiner Hersteller in Bezug auf Kontrollaufgaben, die Ressourcen auf Lieferantenseite überschätzt werden könnten. 3 Weiteres Vorgehen Bis Befragung verschiedener Vertreter der Hersteller/Industrie Präsentation des Gutachtens im BMELV (Bonn) Präsentation im Rahmen der Grünen Woche/Zukunftsforum ländliche Entwicklung. Regionalsiegel: Arbeitstreffen BVL FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 2

170 Frankfurt, den Axel Wirz Regionalsiegel: Arbeitstreffen BVL FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH Seite 3

171 12.9 Positionspapier BVL vom FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH




175 12.10 Protokoll AMK vom FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH


177 12.11 Positionspapier VZ FiBL Deutschland e.v. und MGH GUTES AUS HESSEN GmbH

178 30. November 2010 Verbrauchergerechte Kennzeichnung von regionalen Lebensmitteln Positionspapier des Verbraucherzentrale Bundesverbandes und der Verbraucherzentralen Verbraucherzentrale Bundesverband e.v. vzbv Markgrafenstr Berlin

179 vzbv Kennzeichnung von regionalen Lebensmitteln Laut aktuellen Marktforschungsergebnissen bevorzugen Verbraucher zunehmend regionale Produkte (Dorandt 2005; Nestlé/Allensbach 2009). Nach der 2010 veröffentlichten Befragung des Forsa-Institutes im Auftrag des Bundesministeriums für Ernährung, Landwirtschaft und Verbraucherschutz (BMELV) achten inzwischen 65 Prozent beim Kauf ihrer Lebensmittel immer oder meistens auf die regionale Herkunft, wobei mit regionaler Herkunft nicht nur der Ort oder die Region der Verarbeitung und/oder Herstellung gemeint ist, sondern auch die Herkunft der Rohstoffe. Häufig besteht auch die Erwartung, dass regionale Erzeugnisse zusätzliche Produktqualitäten wie mehr Frische, ohne Gentechnik, Ökoqualität oder artgerechte Tierhaltung gewährleisten sollen. Verbraucher werden derzeit in vielfältiger Weise mit regionalen Herkunfts- und Qualitätsangaben umworben und sollen für diese Produkte zudem häufig mehr bezahlen. Daher müssen Regionalangaben korrekt und wahr sein. Sie sind derzeit jedoch rechtlich nur ungenügend geregelt, und es bestehen vielfältige Möglichkeiten der Verbrauchertäuschung. Die regionale Herkunft und beworbene Qualitäten sind sogenannte Vertrauenseigenschaften, deren Wahrheitsgehalt Verbraucher weder am Lebensmittel noch im Handel oder über andere Informationsquellen selbst überprüfen können. 1. Regionalkennzeichnung kann irreführen In einer Piloterhebung hatte die Verbraucherzentrale Hessen 2009 im Rhein-Main- Gebiet verteilte Hauswurfsendungen und Zeitungsbeilagen im Hinblick auf Regionalwerbung gesichtet. Es wurden insgesamt 17 Flyer von sechs Handelsunternehmen 1 mit Werbung für insgesamt 318 angebliche Regionalprodukte herangezogen. In der Bewertung zeigten sich die Facetten der Irreführung, die sich auch auf andere Regionen übertragen lassen: Bei 14 Flyern fehlte jeder räumliche und geographische Bezug. Für die Verbraucher wird in den meisten Fällen nicht klar, auf welche Region sich die Regionalwerbung bezieht. Drei Werbeflyer (alle Rewe) warben mit ganzen Seiten Obst und Gemüse aus Hessen. Hierbei wurde ein räumlich begrenzter Regionalbezug hergestellt. Auf Nachfrage bei Rewe, stellte sich jedoch heraus, dass ein Teil der beworbenen Produkte in angrenzenden Bundesländern erzeugt wurde 2. Das deutet auf ein fehlendes unabhängiges Kontrollsystem für den Herkunftsnachweis bei Rewe hin. Nur ein regional beworbenes Produkt war mit einem Herkunftssiegel, dem Länderzeichen Geprüfte Qualität - Hessen gekennzeichnet, das die regionale Herkunft durch neutrale Prüfinstitute und Sachverständige regelt (siehe auch. Abschnitt 2 Länderzeichen). 21 Produkte waren mit einer Produktbezeichnung versehen, die einen Orts- oder Regionalbezug nennt, unter anderem Selters Mineralwasser, Sylter Salatfrische, Wetterauer-Gold-Apfelwein, Rhöner Fruchtwein, Elsässer Flammkuchen, Pfälzer Saumagen. Bei diesen Bezeichnungen können Verbraucher meist nur vermuten, ob es sich um örtlich bezogene Herstellungs- oder Herkunftsangaben oder um besondere Zubereitungsverfahren beziehungsweise Rezepturen handelt. 1 Es wurden Hauswurfsendungen und Zeitungsbeilagen der Handelsunternehmen Rewe, Real, toom, tegut, Edeka und Plus mit Outlets in Frankfurt und in den umgebenden Gemeinden vom Jan bis Dez ausgewertet. 2 Persönliche Mitteilung der Rewe vom

180 vzbv Kennzeichnung von regionalen Lebensmitteln Weiterhin wurden Firmennamen und Markenbezeichnungen wie Weihenstephaner (Milch), Rhöngut (Schinken), Berchtesgadener Land (Milch) und Hochstädter (Apfelwein) gefunden, die einen Orts- oder Regionsbezug herstellen. Auch bei diesen Produkten liefert die Bezeichnung kaum eine Orientierung, ob sie sich auf den Verarbeitungsort oder die Herkunft der Rohstoffe oder auf beides bezieht. Bis auf eine Ausnahme konnte man bei 318 regional gekennzeichneten beziehungsweise. beworbenen Lebensmitteln nicht erkennen, ob die Lebensmittel oder. deren Zutaten aus der ausgelobten Region stammen oder ob beispielsweise nur die Verarbeitung regional erfolgte. 2. Länderzeichen: Regionale Herkunfts- und Qualitätszeichen Einige Bundesländer haben eigene Länderzeichen als eingetragene Marken entwickelt, die besondere Anforderungen an Herkunft und Qualität der gekennzeichneten Lebensmittel stellen. Die Verbraucherzentralen gaben 2009 eine Transparenzuntersuchung über diese öffentlich mitfinanzierten Landesprogramme in Auftrag. Die Ergebnisse zeigen, dass die regionale Herkunft dieser Produkte nicht durchgängig sichergestellt ist, als Qualitätszeichen sind sie wenig ambitioniert und die Vorschriften für die Zeichennutzung sind vage und wenig transparent. Beispielsweise sind die Vorgaben für verarbeitete Regionalprodukte sehr unterschiedlich. So verlangt Geprüfte Qualität Thüringen nur einen Anteil von 50,1 Prozent der Zutaten aus regionaler Herkunft, während Fleischerzeugnisse Gesicherte Qualität Baden Württemberg zu 100 Prozent aus dem Bundesland stammen müssen (Zühlsdorf, Franz 2010). Zu bemängeln ist, dass die Anforderungen an die Produktqualität nur selten über die gesetzlichen Standards beziehungsweise Marktstandards hinausgehen. Auch die Kontrollen und Sanktionen der regionalen Herkunftsangaben der Länderzeichen sind sehr unterschiedlich geregelt. Den Anforderungen einer unabhängigen Kontrolle werden sie häufig nicht gerecht. Eine Bewertung der Wirksamkeit der Kontrollsysteme ist kaum möglich und die Dokumentation der Kontrolle unübersichtlich und wenig transparent. Die Länderzeichen nutzen zudem meist die jeweiligen Landesfarben und zeichen, um sich einen amtlichen Charakter zu geben. Dadurch werden die Verbrauchererwartungen hinsichtlich Herkunft und Qualität noch zusätzlich erhöht. 3. Abmahnungen und Gerichtsverfahren Marke Mark Brandenburg Ende 2007 wurde die Campina GmbH & Co. KG von der Verbraucherzentrale Berlin wegen irreführender Werbung abgemahnt. Das Unternehmen hatte unter der Bezeichnung Mark Brandenburg in Berlin und den neuen Bundesländern Milch vertrieben. Diese stammte jedoch aus Nordrhein-Westfalen und wurde in Köln abgefüllt. Die Campina GmbH & CO. KG verpflichtete sich außergerichtlich dazu, keine Molkereiprodukte mit der Bezeichnung Mark Brandenburg zu verkaufen, wenn sie nicht aus der genannten Region stammen. Speisequark frisch aus unserer Region und Faire Milch Edeka-Südwest bot unter seiner Marke "Gut & Günstig" unter anderem in Stuttgart und Konstanz Speisequark mit dem Hinweis "Frisch aus unserer Region" an. Hersteller waren die Hochwald-Nahrungsmittelwerke in Saarbrücken (Saarland). Diese Werbung wurde von der Verbraucherzentrale Baden-Württemberg abgemahnt. Das Landgericht 3

181 vzbv Kennzeichnung von regionalen Lebensmitteln Offenburg stellte mit der Entscheidung vom 26.März fest, dass es sich um eine irreführende Werbung im Sinne des 5 UWG handelt und verurteilte Edeka zur Unterlassung. Das Gericht stellte klar, dass bei der Definition von Region die Auffassung der Verbraucher und nicht die der Unternehmen zugrunde zu legen ist. Es urteilte, dass die Bezeichnung "Frisch aus unserer Region" nicht vom Unternehmen auf dessen Absatzgebiet und damit auf den gesamten südwestdeutschen Raum bezogen werden darf. Zudem stellte das Gericht fest, dass das Produkt vor allem deshalb als "frisch" beworben werden darf, wenn es über kurze Wege transportiert wird. Auch die Werbung für die Faire Milch der Milchverwertungsgesellschaft MVS wurde von der Verbraucherzentrale Baden-Württemberg abgemahnt. Kritisiert wurde die Angabe, die Milch stamme aus Ihrer Region und die heimische Produktion spart unnötige Transportwege. Eine solche Kennzeichnung und Bewerbung ist nicht zulässig, wenn diese Milch in Stuttgart angeboten wird, die Milch jedoch im Allgäu erzeugt und im hessischen Schlüchtern verarbeitet wurde. Das Unternehmen hat eine Unterlassungserklärung abgegeben. Diese rechtlichen Auseinandersetzungen machen deutlich, dass eine gesetzlich verbindliche Definition für Regionalangaben notwendig ist. 4. Bestehende EU-Regelungen zur Herkunftskennzeichnung Eine verpflichtende nationale Herkunftsangabe bei Lebensmitteln wird derzeit auf europäischer Ebene im Rahmen der Überarbeitung des allgemeinen Lebensmittelkennzeichnungsrechts (EG-Verordnungsvorschlag zur Lebensmittelinformation) diskutiert. In einigen Bereichen wie beispielsweise bei Rindfleisch, Eiern und den meisten Obst- und Gemüsearten ist sie bisher schon obligatorisch. Bei der kleinräumigeren, regionalen Herkunftskennzeichnung gibt es zurzeit erst wenige Regelungsansätze 4. Die geschützte Ursprungsbezeichnung (g. U.) setzt voraus, dass entsprechende Lebensmittel in einem abgegrenzten geographischen Gebiet erzeugt, verarbeitet und hergestellt wurden. Die Verkehrsbezeichnung derart geschützter Produkte weist auf den Herkunftsort hin und bietet Verbraucher eine sichere Orientierung. Beispiele für Produkte mit g. U. sind Allgäuer Emmentaler, Altenburger Ziegenkäse oder etwa Feta. Die geschützte geographische Angabe (g. g. A.) gewährleistet eine Verbindung zwischen mindestens einer der Produktionsstufen der Erzeugung, Verarbeitung oder Herstellung - und dem Herkunftsgebiet. So findet zum Beispiel beim Schwarzwälder Schinken nur die Herstellung (Würzen, Pökeln, Räuchern) im Schwarzwald statt. Die Schweinehaltung und Schlachtung können dagegen in anderen Regionen stattfinden. Die garantiert traditionelle Spezialität (g. t. S.) bezieht sich nicht auf einen geographischen Ursprung, sondern hebt die traditionelle 3 LG Offenburg, Urteil vom Az.: 5 O114/07 KfH 4 EU-Verordnung Nr. 2081/92 und Nr. 510/2006 vom

1021101 UNIVERSITÄT SALZBURG Benedikt Weber

1021101 UNIVERSITÄT SALZBURG Benedikt Weber Internationales Qualitätsmanagement und Gütesiegel. Was ist Marketing und was nachhaltige Zertifizierung gebrauchssicherer Produkte. Seminar Strategisches Management 1021101 UNIVERSITÄT SALZBURG Benedikt


Lebenslagen Jugendlicher als Ausgangspunkt kommunaler Politikgestaltung

Lebenslagen Jugendlicher als Ausgangspunkt kommunaler Politikgestaltung Lebenslagen Jugendlicher als Ausgangspunkt kommunaler Politikgestaltung Eine Expertise zur beteiligungsorientierten Erhebung von jugendpolitischen Bedarfen Liane Pluto, Eric van Santen, Mike Seckinger


nachgefragt: 28 Antworten zum Stand des Wissens rund um Öko-Landbau und Bio-Lebensmittel

nachgefragt: 28 Antworten zum Stand des Wissens rund um Öko-Landbau und Bio-Lebensmittel nachgefragt: 28 Antworten zum Stand des Wissens rund um Öko-Landbau und Bio-Lebensmittel nachgefragt: 28 Antworten zum Stand des Wissens rund um Öko-Landbau und Bio-Lebensmittel inhaltsverzeichnis Vorwort...


Nachhaltigkeit durch regionale Vernetzung

Nachhaltigkeit durch regionale Vernetzung Inge Asendorf Martin Demmeler Burghard Flieger Joachim Jaudas Dieter Sauer Stephan Scholz Nachhaltigkeit durch regionale Vernetzung Erzeuger-Verbraucher-Gemeinschaften im Bedürfnisfeld Ernährung - Endbericht


Ein praxisorientierter Leitfaden für mittelständische Unternehmen in Anlehnung an die G4-Leitlinien der Global Reporting Initiative (GRI)

Ein praxisorientierter Leitfaden für mittelständische Unternehmen in Anlehnung an die G4-Leitlinien der Global Reporting Initiative (GRI) In 7 Schritten zum Nachhaltigkeitsbericht Ein praxisorientierter Leitfaden für mittelständische Unternehmen in Anlehnung an die G4-Leitlinien der Global Reporting Initiative (GRI) Bundesverband der Deutschen


Leitfaden zum Deutschen Nachhaltigkeitskodex. Orientierungshilfe für mittelständische Unternehmen

Leitfaden zum Deutschen Nachhaltigkeitskodex. Orientierungshilfe für mittelständische Unternehmen Leitfaden zum Deutschen Nachhaltigkeitskodex Orientierungshilfe für mittelständische Unternehmen Nachhaltigkeit bedeutet Wohlstand für alle, aber weder auf Kosten anderer Länder, anderer Menschen und künftiger





Das gesellschaftliche Engagement von Familienunternehmen Dokumentation der Ergebnisse einer Unternehmensbefragung

Das gesellschaftliche Engagement von Familienunternehmen Dokumentation der Ergebnisse einer Unternehmensbefragung Das gesellschaftliche Engagement von Familienunternehmen Dokumentation der Ergebnisse einer Unternehmensbefragung Projektdurchführung Betriebswirtschaftliches Institut Abteilung III Lehrstuhl für Allgemeine


Bio muss regionaler werden

Bio muss regionaler werden Hintergrund istockphoto Wettbewerb Bio muss regionaler werden Wer Regionalität erfolgreich vermarkten will, muss zwei Dinge beachten: Die Herkunft ehrlich definieren und dennoch bedenken, dass Region mehr


Fair oder nicht fair? w w w. f o r u m - f a i r e r - h a n d e l. d e

Fair oder nicht fair? w w w. f o r u m - f a i r e r - h a n d e l. d e Fair oder nicht fair? Drei Gütesiegel- und Kodex-Systeme im Vergleich mit dem zertifizierten Fairen Handel Autor: Olaf Paulsen w w w. f o r u m - f a i r e r - h a n d e l. d e Forum Fairer Handel Fair



KANN SICH FREIBURG SELBST ERNÄHREN? Albert-Ludwigs-Universität Freiburg Institut für Physische Geographie KANN SICH FREIBURG SELBST ERNÄHREN? Bachelorarbeit an der Fakultät für Umwelt und Ressourcen von Dominique Bednarek vorgelegt im März


Waldinvestments. Artenreichtum oder Rendite? Eukalyptus-Plantage. Naturwald, intakt. Teak-Plantage, durchgeforstet

Waldinvestments. Artenreichtum oder Rendite? Eukalyptus-Plantage. Naturwald, intakt. Teak-Plantage, durchgeforstet Waldinvestments Artenreichtum oder Rendite? Naturwald, intakt Eukalyptus-Plantage Teak-Plantage, durchgeforstet Inhalt 3 Grußwort Alternative Finanzquellen für den Schutz der Biodiversität Waldinvestments


Kommunale Beschaffung im Umbruch

Kommunale Beschaffung im Umbruch Institut für den öffentlichen Sektor Kommunale Beschaffung im Umbruch Große deutsche Kommunen auf dem Weg zu einem nachhaltigen Einkauf? S tudie In Kooperation mit Inhalt Vorwort und Danksagung 3 Nachhaltigkeit


Corporate Citizenship Was tun deutsche Großunternehmen?

Corporate Citizenship Was tun deutsche Großunternehmen? Corporate Citizenship Was tun deutsche Großunternehmen? Unsere Studie gibt Ihnen einen aufschlussreichen Einblick in die aktuelle Situation des Managements von sozialem Engagement



IM OSTEN WAS NEUES? DAS BILD POLENS UND RUSSLANDS IN DEUTSCHLAND IM OSTEN WAS NEUES? JACEK KUCHARCZYK AGNIESZKA ŁADA CORNELIUS OCHMANN ŁUKASZ WENERSKI Die Deutschen verbinden Polen hauptsächlich mit Erfahrungen aus dem Alltagsleben mit guten polnischen Arbeitern, schönen Landschaften, aber auch mit... Diebstählen. Die deutsche Gesellschaft nimmt den


Offliner-Studie Qualitative Ursachenforschung zur Nicht-Nutzung des Internet in Österreich

Offliner-Studie Qualitative Ursachenforschung zur Nicht-Nutzung des Internet in Österreich Wien, August 2011 Offliner-Studie Qualitative Ursachenforschung zur Nicht-Nutzung des Internet in Österreich Dr. Flooh Perlot (Institut für Strategieanalysen) Thomas Holzinger (Mediaclub) Univ.-Prof. Dr.


Umwelt- und Sozialsiegel: Wie informativ und glaubwürdig sind sie? Zur Aufhebung von Informationsasymmetrien beim ethischen Konsum von Waren

Umwelt- und Sozialsiegel: Wie informativ und glaubwürdig sind sie? Zur Aufhebung von Informationsasymmetrien beim ethischen Konsum von Waren 2 Umwelt- und Sozialsiegel: Wie informativ und glaubwürdig sind sie? Zur Aufhebung von Informationsasymmetrien beim ethischen Konsum von Waren Inhalt Einleitung der Herausgeber... 3 Umwelt- und sozialverträglicher


UnternehmerPerspektiven Gemeinsam mehr erreichen

UnternehmerPerspektiven Gemeinsam mehr erreichen Frauen und Männer an der Spitze: So führt der deutsche Mittelstand UnternehmerPerspektiven Gemeinsam mehr erreichen Inhalt I 3 Inhalt Vorworte 07 Summary 14 I. Führungsvielfalt: Management jenseits des


Ergebnisse einer Online-Befragung bayerischer Arbeitgeber

Ergebnisse einer Online-Befragung bayerischer Arbeitgeber Expertise: Als Arbeitgeber attraktiv auch in schwierigen Zeiten Ergebnisse einer Online-Befragung bayerischer Arbeitgeber im Auftrag des zbw - Zentrum für betriebliches Weiterbildungsmanagement f-bb /


Nr. 574. Dokumentationen.

Nr. 574. Dokumentationen. Dokumentation Nr. 574 Dokumentationen Wissensbilanz Made in Germany Leitfaden 2.0 zur Erstellung einer Wissensbilanz U2 Impressum Autoren Kay Alwert, alwert GmbH & Co. KG Manfred Bornemann,


Zukunftsforum Politik

Zukunftsforum Politik Zukunftsforum Politik Broschürenreihe herausgegeben von der Konrad-Adenauer-Stiftung e.v. Nr. 77 Frank Jessen / Ulrich von Wilamowitz-Moellendorff Das Kopftuch Entschleierung eines Symbols? Sankt Augustin/Berlin,


Study on Volunteering in the European Union Executive summary DE FREIWILLIGENTÄTIGKEIT IN DER EU

Study on Volunteering in the European Union Executive summary DE FREIWILLIGENTÄTIGKEIT IN DER EU FREIWILLIGENTÄTIGKEIT IN DER EU 1 2 ZUSAMMENFASSUNG Einführung Diese Zusammenfassung präsentiert die wichtigsten Ergebnisse einer Studie zur Freiwilligentätigkeit in der EU. Die Studie wurde von GHK im



VOM PROJEKT ZUR STRUKTUR VOM PROJEKT ZUR STRUKTUR Projekte, Maßnahmen und Kommunen der UN-Dekade Bildung für nachhaltige Entwicklung B I L D U N G W I S S E N S C H A F T K U L T U R K O M M U N I K A T I O N INHALT Inhaltsverzeichnis


MiD 2008. Mobilität in Deutschland 2008. Ergebnisbericht Struktur Aufkommen Emissionen Trends. beauftragt vom

MiD 2008. Mobilität in Deutschland 2008. Ergebnisbericht Struktur Aufkommen Emissionen Trends. beauftragt vom MiD 2008 Mobilität in Deutschland 2008 Ergebnisbericht Struktur Aufkommen Emissionen Trends beauftragt vom Bietergemeinschaft infas Institut für angewandte Sozialwissenschaft GmbH Friedrich-Wilhelm-Straße


Interkulturelle Öffnung der Verwaltung Mehr als nur PR?

Interkulturelle Öffnung der Verwaltung Mehr als nur PR? MIGRATION & GLEICHBERECHTIGUNG DOKUMENTATION Interkulturelle Öffnung der Verwaltung Mehr als nur PR? Tagung am 10.12.2012 86 SCHRIFTENREIHE MIGRATION UND ARBEITSWELT Gefördert durch: Interkulturelle Öffnung


Engagementforschung als Gemeinschaftsaufgabe Strategische Bedarfe, Agenda, Programmatik

Engagementforschung als Gemeinschaftsaufgabe Strategische Bedarfe, Agenda, Programmatik Engagementforschung als Gemeinschaftsaufgabe Strategische Bedarfe, Agenda, Programmatik Dokumentation zur Tagung am 15.03.2010 im Wissenschaftszentrum Bonn Veranstalter: Bertelsmann Stiftung, Fritz Thyssen


Ein Jahr Bundesfreiwilligendienst Erste Erkenntnisse einer begleitenden Untersuchung

Ein Jahr Bundesfreiwilligendienst Erste Erkenntnisse einer begleitenden Untersuchung Erste Erkenntnisse einer begleitenden Untersuchung Helmut K. Anheier Annelie Beller Rabea Haß Georg Mildenberger Volker Then Ein Jahr Bundesfreiwilligendienst Erste Erkenntnisse einer begleitenden Untersuchung


Deutschland 2030: Herausforderungen als Chancen für Soziale Innovationen

Deutschland 2030: Herausforderungen als Chancen für Soziale Innovationen Deutschland 2030: Herausforderungen als Chancen für Soziale Innovationen Autoren Dr. Susan Müller Dominik Rüede Kathrin Lurtz Dr. Hartmut Kopf Prof. Dr. Peter Russo Die Durchführung der Delphi-Studie wurde


Dieter Dohmen, Annegret Erbes, Kathrin Fuchs, Juliane Günzel

Dieter Dohmen, Annegret Erbes, Kathrin Fuchs, Juliane Günzel Dieter Dohmen, Annegret Erbes, Kathrin Fuchs, Juliane Günzel Unter Mitarbeit von Anne Knauf, Andreas Kunzler, Andrea Schmidt, Bernadette Tirschmann Was wissen wir über Nachhilfe? Sachstand und Auswertung


Betriebsklima geht jeden an!

Betriebsklima geht jeden an! Bayerisches Staatsministerium für Arbeit und Sozialordnung, Familie, Frauen und Gesundheit Betriebsklima geht jeden an! Von Prof. Dr. Lutz von Rosenstiel unter Mitarbeit von Dipl.-Soz. Rudolf Bögel mit
