G-Protein gekoppelte Rezeptoren. Genomische Datenanalyse 3. Kapitel

Größe: px
Ab Seite anzeigen:

Download "G-Protein gekoppelte Rezeptoren. Genomische Datenanalyse 3. Kapitel"

Transkript

1 G-Protein gekoppelte Rezeptoren Genomische Datenanalyse 3. Kapitel

2 Proteinsequenzen: Eine andere Form genomischer Daten MEEPGAQCAPPPPAGSETWVPQANL SSAPSQNCSAKDYIYQDSISLPWKV LLVMLLALITLATTLSNAFVIATVY RTRKLHTPANYLIASLAVTDLLVSI LVMPISTMYTVTGRWTLGQVVCDFW LSSDITCCTASILHLCVIALDRYWA ITDAVEYSAKRTPKRAAVMIALVWV FSISISLPPFFWRQAKAEEEVSECV VNTDHILYTVYSTVGAFYFPTLLLI ALYGRIYVEARSRILKQTPNRTGKR LTRAQLITDSPGSTSSVTSINSRVP DVPSESGSPVYVNQVKVRVSDALLE KKKLMAARERKATKTLGIILGAFIV CWLPFFIISLVMPICKDACWFHLAI FDFFTWLGYLNSLINPIIYTMSNED FKQAFHKLIRFKCTS Alphabet von 20 Buchstaben (Aminosäuren) Buchstaben haben sehr unterschiedliche Häufigkeiten

3 Die Raumstruktur der Proteine ergibt sich direkt aus der Sequenz, durch Wechselwirkung der Aminosäuren untereinander und mit der Umgebung Also müssen auch diese Sequenzen Struktur enthalten und sind keineswegs zufällig

4 Rezeptoren sind Proteine, die nach Bindung eines Liganden einen Effekt auslösen. z.b. Nach Bindung eines Blutdruck senkenden Medikaments (Ligand) den Blutdruck senken (Effekt). Die meisten Rezeptoren sind in der Zellmembran verankert, sie binden einen Liganden außerhalb der Zelle und bewirken einen Effekt innerhalb der Zelle. Dies sind für die pharmazeutische Industrie besonders interessante Moleküle, denn über sie kann man in den Stoffwechsel der Zelle eingreifen, ohne dass das Medikament selbst in die Zelle eindringen muss. G-Protein gekoppelte Rezeptoren (GPCR) sind die häufigste Form solcher Transmembran-Rezeptoren.

5 G-Protein gekoppelte Rezeptoren machen etwa 80% aller Rezeptoren aus. Sie haben eine charakteristische räumliche Struktur: Das Protein faltet sich so, dass die Sequenz 7 mal die Membran durchquert, insgesamt gibt es also sieben Sequenzabschnitte, die in der Membran liegen. Dazwischen sind Abschnitte, die entweder außerhalb der Zelle oder innerhalb der Zelle liegen.

6 Außerhalb der Zelle bindet ein Ligand. Dies führt zu einer veränderten räumlichen Struktur des Rezeptors, die sich auch innerhalb der Zelle bemerkbar macht. Die veränderte Struktur in der Zelle bindet und aktiviert ein GProtein, dass eine sehr spezifische Signalkaskade auslöst.

7 Es gibt viele GPCR. Sie haben alle 7 Transmembran-Abschnitte. Der Mechanismus, mit dem sie ein Signal von außerhalb der Zelle ins Innere der Zelle weiterleiten, scheint in etwa immer der Gleiche zu sein. Die Bindestelle für den Liganden ist spezifisch für unterschiedliche GPCR und ebenso die Bindestelle für den G-Protein-Komplex. Das macht auch Sinn, denn schließlich soll ein bestimmtes äußeres Signal auch eine bestimmte und wohl definierte Reaktion im Innern der Zelle auslösen. Die ganze Familie wird als homologe Proteinfamilie angesehen. Das heißt, man geht davon aus, dass sie alle aus einem Urrezeptor entstanden sind. Dieser hat sich dann durch Genduplikationen vervielfältigt. Der Mechanismus der Signalweiterleitung wurde konserviert, aber die jeweiligen Bindestellen sind mutiert, so dass sowohl andere Liganden als auch andere G-Proteine binden können.

8 Wobei spielen GPCR eine Rolle? Beim Sehen Photonen lösen die Aktivierung aus und diese leitet optische Information ins Gehirn. Beim Riechen Wir haben Rezeptoren für alle möglichen Substanzen, für die es vorteilhaft ist, dass man ihre Präsenz detektieren (riechen) kann. Sie binden an GPCR und lösen eine Geruchsempfindung aus. Medikamente Rauschgift

9 Wie kann sich das GPCR in der Membran verankern und richtig ausrichten? Die Membran besteht aus Lipiden (Fetten). Der Bereich in der Zelle und außerhalb der Zelle besteht hauptsächlich aus Wasser. Es gibt Aminosäuren, die wasserabweisend (hydrophob), und andere, die wasseranziehend (hydrophil) sind. Genauer kann jeder Aminosäure ein Hydrophobizitätswert zugeordnet werden. Weist die räumliche Struktur nun Bereiche auf, die eine hohe mittlere Hydrophobizität haben und davon andere räumlich getrennte mit niedriger Hydrophobizität, so werden die ersten vom Wasser abgestoßen und wandern in eine Membram, die sie nicht abstößt, die letzteren richten sich dagegen zum Wasser hin aus. Hydrophobe Bereiche in einem Protein verankern dieses in einer Membran. Beim GPCR sind dies sieben helikale Bereiche, die die Membran durchqueren und diese Bereiche auch in der Sequenz zusammenhängen.

10 Es gibt sieben Sequenzabschnitte, die so sehr wasserabweisend aber nicht fettabweisend sind, dass sich das Protein mit ihrer Hilfe in der Membran verankern kann. Wie kann man diese Bereiche in der Sequenz finden? MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVM LLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTM YTVTGRWTLGQVVCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRT PKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGA FYFPTLLLIALYGRIYVEARSRILKQTPNRTGKRLTRAQLITDSPGSTSSVTSI NSRVPDVPSESGSPVYVNQVKVRVSDALLEKKKLMAARERKATKTLGIILGAFI VCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYLNSLINPIIYTMSNEDFKQ AFHKLIRFKCTS

11 Jede Aminosäure hat eine charakteristische Hydrophobizität

12 Wir übersetzen die Sequenz von Aminosäuren in einen Vektor von Hydrophobizitäten: M K S I L D G

13 Der Vektor von Hydrophobizitäten gibt uns einen Datensatz reeller Zahlen. Werfen wir einen Blick auf ihre Verteilung (mit Hilfe eines Histogramms) Hier kann man wenig erkennen: Über die ganze Sequenz verstreut gibt es etwa gleich viel hydrophobe wie hydrophile Aminosäuren.

14 Wir können uns unter anschauen, wo die Transmembran-Abschnitte liegen: DOMAIN EXTRACELLULAR (POTENTIAL). TRANSMEM (POTENTIAL). DOMAIN CYTOPLASMIC (POTENTIAL). TRANSMEM (POTENTIAL). DOMAIN EXTRACELLULAR (POTENTIAL). TRANSMEM (POTENTIAL). DOMAIN CYTOPLASMIC (POTENTIAL). TRANSMEM (POTENTIAL). DOMAIN EXTRACELLULAR (POTENTIAL). TRANSMEM (POTENTIAL). DOMAIN CYTOPLASMIC (POTENTIAL). TRANSMEM (POTENTIAL). DOMAIN EXTRACELLULAR (POTENTIAL). TRANSMEM (POTENTIAL). DOMAIN CYTOPLASMIC (POTENTIAL).

15 Teilen wir die Sequenz in Transmembran-Segmente und Nicht- Transmembran-Segmente auf, und betrachten die Verteilung der Hydrophobizitätswerte in den einzelnen Bereichen getrennt voneinander, dann beobachten wir, was zu vermuten war. In den Transmembran- Segmenten gibt es viele hohe Hydrophobizitätswerte, weit mehr als niedrige, und außerhalb ist es gerade umgekehrt.

16 Wenn das so ist, dann hätten wir die Transmembran-Segmente gar nicht nachschlagen müssen, sondern hätten sie direkt an der Sequenz erkennen können: Betrachte jeweils nur ein Teilsegment der Sequenz, z.b. Position 1-20, dann Position 2-21, dann bis man am Ende der Sequenz angekommen ist. Man spricht von einem gleitendem Fenster (sliding window), mit dem die Sequenz analysiert wird. Problem: Man müsste sich viele Histogramme nacheinander anschauen. Wir sind bei den Histogrammen aber nur daran interessiert, ob sie links- oder rechtslastig sind. Jedes Fenster bestimmt ein Sequenz-Segment, für dass wir ein Histogramm der Hydro-Werte betrachten können.

17 Wie kann man Histogramme (und damit Daten) zusammenfassen? Welche Information enthalten Histogramme? Was ist wichtig, was weniger?

18 Die Lage der Daten: Die Form der Histogramme ist recht ähnlich, aber die Daten in Histogramm 1 streuen in etwa um den Wert 0, während die in Histogramm 2 weiter rechts liegen, und um 1.5 streuen.

19 Die Daten in Histogramm 1 streuen in etwa um den Wert 0, währen die in Histogramm 2 weiter rechts liegen und um 1.5 streuen. Wir sprechen hier von der Lage der Daten, und drücken sie nach Inspektion mit dem Auge in einer einzigen Zahl aus. Wie kann man einen solches Lagemaß definieren? Man kann den häufigsten Wert (den Modus) zur Beschreibung der Lage der Daten verwenden. Dies ist o.k. für glockenförmige Histogramme. Aber im Fall des linken Histogramms sieht man ein Problem. Die meisten Daten liegen doch links vom Modus.

20 Am häufigsten wird der Mittelwert benutzt: Hat man n reellwertige Datenpunkte x=(x 1,...x n ), dann ist das arithmetische Mittel dieser Daten. z.b.

21 Im Datensatz oben liegt der Mittelwert mitten in den Daten. Unten ist dies nicht der Fall. Es ist klar, dass der Grund dafür der Ausreißer ist. Ob der Mittelwert trotzdem die Daten geeignet zusammenfasst, ist fraglich. Ausreißer

22 Mittelwert getrimmter Mittelwert Eine Möglichkeit, den Mittelwert robuster gegen Ausreißer zu machen, ist Trimming. Trimming bedeutet die größten x% und die kleinsten x% der Werte wegzulassen, und den Mittelwert aus dem Rest zu berechnen. Alternativ kann man auch den Median verwenden: Dazu ordnet man die Daten x 1,..,x n der Größe nach. Der Median ist der Wert in der Mitte. Es liegen immer gleich viele Werte rechts wie links von ihm. Ist n gerade, dann gibt es nicht einen Wert in der Mitte, sondern zwei. In diesem Fall ist der Median das Mittel dieser beiden Zahlen Median

23 Lagemaße Der Modus ist der häufigste Wert in den Daten. Der Mittelwert ist das Mittel der Daten. Der Median ist der Wert in der Mitte der Daten. Um den Mittelwert zu berechnen, muss man mit den Daten rechnen können, sie müssen numerisch sein. Um den Median zu berechnen, muss man die Daten ordnen können, sie müssen ordinal sein. Den Modus kann man theoretisch immer berechnen. Es macht aber nur Sinn, wenn die Werte mehrfach auftauchen. Sind alle Werte verschieden, sind sie auch alle Moden. Beim Zusammenfassen der Häufigkeiten von Basen in Sequenzen ist der Modus die einzig mögliche der drei beschriebenen Maßzahlen... Auch wenn der Begriff Lagemaß hier nicht treffend ist. Mittelwert und Median sind eindeutig. Der Modus ist dies nicht, es kann mehrere gleich häufige Werte geben. Ein Vektor mit den Häufigkeiten aller vorkommenden Werte ist ausreichend, um alle drei Lagemaße zu berechnen.

24 In beiden Histogrammen verteilen sich die Daten um den Wert 0. Aber die Daten links streuen weit weniger als die rechts. Wie quantifiziert man Streuung um den Mittelwert? Wie definiert man ein Streuungsmaß? Hat man Daten x=(x 1,...,x n ), dann sind: Die Varianz und die Standardabweichung von x.

25 mittlerer quadratischer Abstand der Daten zu ihrem Mittelwert Warum n-1? Warum Quadrat? Warum Wurzel? Varianz und Standardabweichung messen Streuung relativ zum Mittelwert!

26 Streuung ist immer Streuung um s=2.51 s = 0.99

27 Die 5 Zahlen-Zusammenfassung eines Histogramms und der Boxplot Ausreißer? Größter Wert 3. Quartil (wie Median nur mit 3/4 der Daten links und 1/4 rechts) Median (2.Quartil) 1. Quartil (wie 3. Quartil nur mit 1/4 der Daten links und 3/4 rechts) Kleinster Wert Min. 1st Qu. Median 3rd Qu. Max

28 Empirische Verteilungsfunktion (Fn-Plot) Daten: Sortiert: Wertebereich (alle vorkommenden Werte einmal genannt): Empirische Verteilungsfunktion: Für eine beliebige Zahl x berechne Fn(x): die relative Häufigkeit der Werte < x. Trage x gegen Fn(x) ab.

29 Ein x%-quantil ist die Zahl q, so dass x% der Daten kleiner als q und 100-x% größer als q sind. Kann man diese Zahl nicht genau bestimmen, trifft man im Fn-Plot auf eine Lücke, dann wird das Mittel des oberen und des unteren Wertes genommen. Das 1. Quartil ist das 25%-Quantil Der Median das 50%- Quantil Das 3. Quartil ist das 75%-Quantil

30 Der Fn-Plot fasst das Histogramm nicht zusammen, sondern enthält die gleiche Information über die Daten in anders aufbereiteter Form. Die Höhe der Sprünge entspricht der relativen Häufigkeit der Beobachtungen, ist also proportional zur Höhe des entsprechenden Balkens im Histogramm.

31 Zurück zu den GPCR und den gleitenden Fenster Statt den vielen Histogrammen können wir jetzt auch zusammenfassende Messzahlen betrachten.

32 Zunächst Mittelwerte (Moving Average Plot) am Beispiel des Cannabinoid Rezeptors: Fenster der Länge 11

33 Trotz der starken Oszillationen erkennt man sieben Peaks (Spitzen). Diese entstehen durch Fenster der Länge 11 mit hoher mittlerer Hydrophobizität. Die sieben typischen Transmembran- Segmente eines GPCR?

34 TRANSMEM TRANSMEM TRANSMEM TRANSMEM TRANSMEM TRANSMEM TRANSMEM Das passt ja geradezu perfekt!

35 Mit der Fensterlänge haben wir aber etwas experimentieren müssen: Länge 5 Länge 11 Länge 40

36 Hier ein Plot, in dem die Standardabweichung pro Fenster abgetragen ist. Man erkennt auch hier die Transmembran-Segmente sehr deutlich als Bereiche mit deutlich verminderter Streuung der Hydrophobizität (um die jeweiligen Fenster- Mittelwerte). Scheinbar gibt es einen höheren selektiven Druck auf die Transmembran-Segmente. Dies wird auch durch Sequenzvergleich bestätigt. Die GPCR-Sequenzen ähneln sich kaum noch. Die Zeitpunkte der Genom- Verdopplungen liegen lange zurück. Wenn überhaupt, dann sieht man die gemeinsame Abstammung in den Transmembran-Segmenten.

37 Beide Beobachtungen: Erhöhte Hydrophobizität führt zur Verankerung in der Membran. Weniger Variabilität in den Transmembran- Segmenten, vermutlich durch höheren selektiven Druck. T: Transmembran-Segment D: Nicht-Transmembran-Segment... sieht man noch einmal sehr gut in diesen fensterweisen Boxplots. Diesmal sind die Fensterlängen nicht konstant, sondern die Fenster sind den annotierten Domänen angepasst.

38 Zusammenfassung - Mittelwert - Median - Modus - Streuung - Varianz - Standardabweichung - Ausreißer - robust - Quartil - Quantil - Boxplot - Fn-Plot - Fenster - Moving Average

39 Literatur: Freedman, Pisani, Purves: Kapitel 4 Berry: Kapitel 2.6 Stanton Glantz: Kapitel 2 Stahel: Kapitel 2

Proteinsequenzen. Raumstruktur GPCR. G-Protein gekoppelte Rezeptoren

Proteinsequenzen. Raumstruktur GPCR. G-Protein gekoppelte Rezeptoren G-Protein gekoppelte Rezeptoren Proteinsequenzen MEEPGAQCAPPPPAGSETWVPQANL SSAPSQNCSAKDYIYQDSISLPWKV LLVMLLALITLATTLSNAFVIATVY RTRKLHTPANYLIASLAVTDLLVSI LVMPISTMYTVTGRWTLGQVVCDFW LSSDITCCTASILHLCVIALDRYWA

Mehr

2. Deskriptive Statistik 2.1. Häufigkeitstabellen, Histogramme, empirische Verteilungsfunktionen

2. Deskriptive Statistik 2.1. Häufigkeitstabellen, Histogramme, empirische Verteilungsfunktionen 4. Datenanalyse und Modellbildung Deskriptive Statistik 2-1 2. Deskriptive Statistik 2.1. Häufigkeitstabellen, Histogramme, empirische Verteilungsfunktionen Für die Auswertung einer Messreihe, die in Form

Mehr

1 Verteilungen und ihre Darstellung

1 Verteilungen und ihre Darstellung GKC Statistische Grundlagen für die Korpuslinguistik Kapitel 2: Univariate Deskription von Daten 8.11.2004 Univariate (= eindimensionale) Daten bestehen aus Beobachtungen eines einzelnen Merkmals. 1 Verteilungen

Mehr

Genexpression. Expression eines einzelnen Gens. Expressionsmessung. Genexpressionsmessung. Transkription (Vorgang) Genexpression

Genexpression. Expression eines einzelnen Gens. Expressionsmessung. Genexpressionsmessung. Transkription (Vorgang) Genexpression Genexpressionsmessung Genexpression Transkription (Vorgang) Genexpression (quantitativ) Wieviele m-rna Moleküle eines bestimmten Gens sind in den Zellen? Genomische Datenanalyse 8. Kapitel Wie mißt man

Mehr

Datenanalyse und Statistik

Datenanalyse und Statistik Datenanalyse und Statistik p. 1/44 Datenanalyse und Statistik Vorlesung 2 (Graphik I) K.Gerald van den Boogaart http://www.stat.boogaart.de Datenanalyse und Statistik p. 2/44 Daten Schätzung Test Mathe

Mehr

Statistik I für Betriebswirte Vorlesung 2

Statistik I für Betriebswirte Vorlesung 2 Statistik I für Betriebswirte Vorlesung 2 PD Dr. Frank Heyde TU Bergakademie Freiberg Institut für Stochastik 16. April 2015 PD Dr. Frank Heyde Statistik I für Betriebswirte Vorlesung 2 1 ii) empirische

Mehr

1,11 1,12 1,13 1,14 1,15 1,16 1,17 1,17 1,17 1,18

1,11 1,12 1,13 1,14 1,15 1,16 1,17 1,17 1,17 1,18 3. Deskriptive Statistik Ziel der deskriptiven (beschreibenden) Statistik (explorativen Datenanalyse) ist die übersichtliche Darstellung der wesentlichen in den erhobenen Daten enthaltene Informationen

Mehr

Übung 8. 1. Zellkommunikation. Vorlesung Bio-Engineering Sommersemester 2008. Kapitel 4. 4

Übung 8. 1. Zellkommunikation. Vorlesung Bio-Engineering Sommersemester 2008. Kapitel 4. 4 Bitte schreiben Sie Ihre Antworten direkt auf das Übungsblatt. Falls Sie mehr Platz brauchen verweisen Sie auf Zusatzblätter. Vergessen Sie Ihren Namen nicht! Abgabe der Übung bis spätestens 05. 05. 08

Mehr

2. Eindimensionale (univariate) Datenanalyse

2. Eindimensionale (univariate) Datenanalyse 2. Eindimensionale (univariate) Datenanalyse Dr. Antje Kiesel Institut für Angewandte Mathematik WS 2011/2012 Kennzahlen, Statistiken In der Regel interessieren uns nicht so sehr die beobachteten Einzeldaten

Mehr

Eine computergestützte Einführung mit

Eine computergestützte Einführung mit Thomas Cleff Deskriptive Statistik und Explorative Datenanalyse Eine computergestützte Einführung mit Excel, SPSS und STATA 3., überarbeitete und erweiterte Auflage ^ Springer Inhaltsverzeichnis 1 Statistik

Mehr

2.3 Univariate Datenanalyse in R

2.3 Univariate Datenanalyse in R 2.3. UNIVARIATE DATENANALYSE IN R 47 2.3 Univariate Datenanalyse in R Wir wollen nun lernen, wie man in R Daten elementar analysiert. R bietet eine interaktive Umgebung, Befehlsmodus genannt, in der man

Mehr

Erstellen einer Formel

Erstellen einer Formel Software Erstellen einer Formel In Excel kann man individuelle Formeln erstellen, dabei wird eine Formel mit ein Gleichzeichen = eingeleitet. Man kann direkt in eine Zelle schreiben oder in dem dafür vorgesehen

Mehr

Häufigkeitstabellen. Balken- oder Kreisdiagramme. kritischer Wert für χ2-test. Kontingenztafeln

Häufigkeitstabellen. Balken- oder Kreisdiagramme. kritischer Wert für χ2-test. Kontingenztafeln Häufigkeitstabellen Menüpunkt Data PivotTable Report (bzw. entsprechendes Icon): wähle Data Range (Zellen, die die Daten enthalten + Zelle mit Variablenname) wähle kategoriale Variable für Spalten- oder

Mehr

Franz Kronthaler. Statistik angewandt. Datenanalyse ist (k)eine Kunst. Excel Edition. ^ Springer Spektrum

Franz Kronthaler. Statistik angewandt. Datenanalyse ist (k)eine Kunst. Excel Edition. ^ Springer Spektrum Franz Kronthaler Statistik angewandt Datenanalyse ist (k)eine Kunst Excel Edition ^ Springer Spektrum Inhaltsverzeichnis Teil I Basiswissen und Werkzeuge, um Statistik anzuwenden 1 Statistik ist Spaß 3

Mehr

Statistik und Wahrscheinlichkeitsrechnung

Statistik und Wahrscheinlichkeitsrechnung Statistik und Wahrscheinlichkeitsrechnung Übung 2 28.02.2008 1 Inhalt der heutigen Übung Beschreibende Statistik Gemeinsames Lösen der Übungsaufgaben 2.1: Häufigkeitsverteilung 2.2: Tukey Boxplot 25:Korrelation

Mehr

SAS-Vertiefung zur Statistischen Software im SS 2010 Übungsaufgaben

SAS-Vertiefung zur Statistischen Software im SS 2010 Übungsaufgaben SAS-Vertiefung zur Statistischen Software im SS 2010 Übungsaufgaben Helmut Küchenhoff, Cornelia Oberhauser, Monia Mahling, Armin Monecke Im Folgenden gibt es 4 Aufgabenblöcke. Block 1: Daten einlesen,

Mehr

1 Darstellen von Daten

1 Darstellen von Daten 1 Darstellen von Daten BesucherInnenzahlen der Bühnen Graz in der Spielzeit 2010/11 1 Opernhaus 156283 Hauptbühne 65055 Probebühne 7063 Ebene 3 2422 Next Liberty 26800 Säulen- bzw. Balkendiagramm erstellen

Mehr

Word 2010 Grafiken exakt positionieren

Word 2010 Grafiken exakt positionieren WO.009, Version 1.2 10.11.2014 Kurzanleitung Word 2010 Grafiken exakt positionieren Wenn Sie eine Grafik in ein Word-Dokument einfügen, wird sie in die Textebene gesetzt, sie verhält sich also wie ein

Mehr

Deskriptive Statistik

Deskriptive Statistik Deskriptive Statistik [descriptive statistics] Ziel der deskriptiven (beschreibenden) Statistik einschließlich der explorativen Datenanalyse [exploratory data analysis] ist zunächst die übersichtliche

Mehr

StatStream : Statistical Monitoring of Thousands of Data Streams in Real Time Yunyue Zhu,Dennis Sasha. Vorgetragen von Matthias Altmann

StatStream : Statistical Monitoring of Thousands of Data Streams in Real Time Yunyue Zhu,Dennis Sasha. Vorgetragen von Matthias Altmann StatStream : Statistical Monitoring of Thousands of Data Streams in Real Time Yunyue Zhu,Dennis Sasha Vorgetragen von Matthias Altmann Mehrfache Datenströme Beispiel Luft und Raumfahrttechnik: Space Shuttle

Mehr

Methoden der empirischen Sozialforschung I

Methoden der empirischen Sozialforschung I Methoden der empirischen Sozialforschung I Annelies Blom, PhD TU Kaiserslautern Wintersemester 2011/12 Übersicht Quantitative Datenauswertung: deskriptive und induktive Statistik Wiederholung: Die wichtigsten

Mehr

Willkommen zur Vorlesung Statistik

Willkommen zur Vorlesung Statistik Willkommen zur Vorlesung Statistik Thema dieser Vorlesung: Maßzahlen für zentrale Tendenz, Streuung und andere Eigenschaften von Verteilungen Prof. Dr. Wolfgang Ludwig-Mayerhofer Universität Siegen Philosophische

Mehr

Expertenrunde Gruppe 1: Wiederholungsgruppe EXCEL (Datenerfassung, Darstellungsformen, Verwertung)

Expertenrunde Gruppe 1: Wiederholungsgruppe EXCEL (Datenerfassung, Darstellungsformen, Verwertung) Epertenrunde Gruppe 1: Wiederholungsgruppe EXCEL (Datenerfassung, Darstellungsformen, Verwertung) Im Folgenden wird mit Hilfe des Programms EXEL, Version 007, der Firma Microsoft gearbeitet. Die meisten

Mehr

Beschreibende Statistik Eindimensionale Daten

Beschreibende Statistik Eindimensionale Daten Mathematik II für Biologen 16. April 2015 Prolog Geordnete Stichprobe Rang Maße für die mittlere Lage der Daten Robustheit Quantile Maße für die Streuung der Daten Erkennung potentieller Eindimensionales

Mehr

VORANGEGANGENE MODELLE

VORANGEGANGENE MODELLE VORANGEGANGENE MODELLE UNSER THEMA HEUTE Ziel dieses Papers: - Nähere Charakterisierung der AuxREs - Analyse eines zu den AuxREs gehörenden Transkriptionsfaktors WAS BEREITS BEKANNT WAR: - Auxin moduliert

Mehr

Auswertung zu "Projektmanagement B, SS08"

Auswertung zu Projektmanagement B, SS08 Auswertung zu "Projektmanagement B, SS08" Liebe Dozentin, lieber Dozent, anbei erhalten Sie die Ergebnisse der Evaluation Ihres Seminars. Zu dieser Veranstaltung wurden 30 Bewertungen (bei 30 TeilnehmerInnen)

Mehr

1 45, 39, 44, 48, 42, 39, 40, , 31, 46, 35, 31, 42, 51, , 42, 33, 46, 33, 44, 43

1 45, 39, 44, 48, 42, 39, 40, , 31, 46, 35, 31, 42, 51, , 42, 33, 46, 33, 44, 43 1) Ermittle jeweils das arithmetische Mittel. Ordne die Datenerhebungen nach der Größe der arithmetischen Mittel. Beginne mit dem Größten. 1 45, 39, 44, 48, 42, 39, 40, 31 2 35, 31, 46, 35, 31, 42, 51,

Mehr

90-minütige Klausur Statistik für Studierende der Kommunikationswissenschaft

90-minütige Klausur Statistik für Studierende der Kommunikationswissenschaft Prof. Dr. Helmut Küchenhoff SS08 90-minütige Klausur Statistik für Studierende der Kommunikationswissenschaft am 22.7.2008 Anmerkungen Überprüfen Sie bitte sofort, ob Ihre Angabe vollständig ist. Sie sollte

Mehr

Formale Methoden der Ökonomik: Einführung in die empirische Wirtschaftsforschung

Formale Methoden der Ökonomik: Einführung in die empirische Wirtschaftsforschung Übung Formale Methoden der Ökonomik: Einführung in die empirische Wirtschaftsforschung BACHELOR FT 2013 (HSU) Übung Emp. WiFo FT 2013 1 / 15 Datensätze Statistische Auswertungen gehen in den meisten Fällen

Mehr

Kapitel 34 Boxplots und Fehlerbalken

Kapitel 34 Boxplots und Fehlerbalken Kapitel 34 Boxplots und Fehlerbalken Boxplots und Fehlerbalken sind dazu geeignet, die Lage und Verteilung der Werte einer Stichprobe grafisch darzustellen. Die beiden Diagrammtypen sind auf die Darstellungen

Mehr

Statistik mit Excel. für Praktiker: Statistiken aufbereiten und präsentieren HORST-DIETER RADKE

Statistik mit Excel. für Praktiker: Statistiken aufbereiten und präsentieren HORST-DIETER RADKE Statistik mit Excel für Praktiker: Statistiken aufbereiten und präsentieren HORST-DIETER RADKE INHALTS- VERZEICHNIS Vorwort 13 Schreiben Sie uns! 15 1 Statistische Untersuchungen 17 Wozu Statistik? 18

Mehr

Statistik im Versicherungs- und Finanzwesen

Statistik im Versicherungs- und Finanzwesen Springer Gabler PLUS Zusatzinformationen zu Medien von Springer Gabler Grimmer Statistik im Versicherungs- und Finanzwesen Eine anwendungsorientierte Einführung 2014 1. Auflage Übungsaufgaben zu Kapitel

Mehr

Auswertung und Darstellung wissenschaftlicher Daten (1)

Auswertung und Darstellung wissenschaftlicher Daten (1) Auswertung und Darstellung wissenschaftlicher Daten () Mag. Dr. Andrea Payrhuber Zwei Schritte der Auswertung. Deskriptive Darstellung aller Daten 2. analytische Darstellung (Gruppenvergleiche) SPSS-Andrea

Mehr

Kapitel 1: Deskriptive Statistik

Kapitel 1: Deskriptive Statistik Kapitel 1: Deskriptive Statistik Grafiken 1 Statistische Kennwerte 5 z-standardisierung 7 Grafiken Mit Hilfe von SPSS lassen sich eine Vielzahl unterschiedlicher Grafiken für unterschiedliche Zwecke erstellen.

Mehr

4. Auswertung eindimensionaler Daten

4. Auswertung eindimensionaler Daten 4. Auswertung eindimensionaler Daten Ziel dieses Kapitels: Präsentation von Methoden zur statistischen Auswertung eines einzelnen Merkmals 64 Bezeichnungen (Wiederholung): Merkmalsträger: e 1,..., e n

Mehr

Kapitel 13 Häufigkeitstabellen

Kapitel 13 Häufigkeitstabellen Kapitel 13 Häufigkeitstabellen Die gesammelten und erfaßten Daten erscheinen in der Datendatei zunächst als unübersichtliche Liste von Werten. In dieser Form sind die Daten jedoch wenig aussagekräftig

Mehr

Histogramm und Wahrscheinlichkeitsnetz 1/16

Histogramm und Wahrscheinlichkeitsnetz 1/16 Histogramm und Wahrscheinlichkeitsnetz 1/16 Ziel: Ziel der Aufgabe Ziel ist es, die Grafiken Histogramm und Wahrscheinlichkeitsnetz und die Funktionalitäten (z.b. C-Wert-Funktion) von qs-stat ME kennen

Mehr

Faustformeln / Zusammenhänge a) Binomialverteilung als Poissonverteilung:

Faustformeln / Zusammenhänge a) Binomialverteilung als Poissonverteilung: Faustformeln / Zusammenhänge a) Binomialverteilung als Poissonverteilung: k ( np) np B( n, p; k) Poi( np, k) e k! falls gilt: p

Mehr

Deskriptive Statistik

Deskriptive Statistik Deskriptive Statistik In der beschreibenden Statistik werden Methoden behandelt, mit deren Hilfe man Daten übersichtlich darstellen und kennzeichnen kann. Die Urliste (=Daten in der Reihenfolge ihrer Erhebung)

Mehr

Eine zweidimensionale Stichprobe

Eine zweidimensionale Stichprobe Eine zweidimensionale Stichprobe liegt vor, wenn zwei qualitative Merkmale gleichzeitig betrachtet werden. Eine Urliste besteht dann aus Wertepaaren (x i, y i ) R 2 und hat die Form (x 1, y 1 ), (x 2,

Mehr

Evaluation der Normalverteilungsannahme

Evaluation der Normalverteilungsannahme Evaluation der Normalverteilungsannahme. Überprüfung der Normalverteilungsannahme im SPSS P. Wilhelm; HS SPSS bietet verschiedene Möglichkeiten, um Verteilungsannahmen zu überprüfen. Angefordert werden

Mehr

Genregulation bei Eukaryoten II

Genregulation bei Eukaryoten II Genregulation bei Eukaryoten II Aktivierung und Repression der Transkription erfolgen durch Protein-Protein-Wechselwirkungen Protein-Protein-Wechselwirkungen spielen bei der Genregulation der Eukaryoten

Mehr

Statistik eindimensionaler Größen

Statistik eindimensionaler Größen Statistik eindimensionaler Größen Michael Spielmann Inhaltsverzeichnis 1 Aufgabe der eindimensionalen Statistik 2 2 Grundbegriffe 2 3 Aufbereiten der Stichprobe 3 4 Die Kennzahlen Mittelwert und Streuung,

Mehr

1. Allgemeine Hinweise Alexander.Martin.Koenig@TU-Clausthal.de

1. Allgemeine Hinweise Alexander.Martin.Koenig@TU-Clausthal.de 1. Allgemeine Hinweise Alexander.Martin.Koenig@TU-Clausthal.de Man sollte eine Excel-Tabelle immer so übersichtlich wie möglich halten. Dazu empfiehlt es sich, alle benötigten Daten, Konstanten und Messwerte

Mehr

3.1 Annuitätsfunktionen (Rentenfunktionen)

3.1 Annuitätsfunktionen (Rentenfunktionen) Funktionen 3 Excel verfügt über eine unglaubliche Menge von Funktionen. Sie haben bereits einige Funktionen in diesem Buch kennen gelernt, und es werden noch viele dieser Funktionen angesprochen und deren

Mehr

Fachrechnen für Tierpfleger

Fachrechnen für Tierpfleger Z.B.: Fachrechnen für Tierpfleger A10. Statistik 10.1 Allgemeines Was ist Statistik? 1. Daten sammeln: Durch Umfragen, Zählung, Messung,... 2. Daten präsentieren: Tabellen, Grafiken 3. Daten beschreiben/charakterisieren:

Mehr

Einfache Statistiken in Excel

Einfache Statistiken in Excel Einfache Statistiken in Excel Dipl.-Volkswirtin Anna Miller Bergische Universität Wuppertal Schumpeter School of Business and Economics Lehrstuhl für Internationale Wirtschaft und Regionalökonomik Raum

Mehr

Molekulare Mechanismen der Signaltransduktion

Molekulare Mechanismen der Signaltransduktion Molekulare Mechanismen der Signaltransduktion 07 - Identifizierung von ARF1 + Hinweise für Vorträge Folien: http://tinyurl.com/modul-mms http://www.pnas.org/content/111/14/5427/f1.large.jpg neues Modell

Mehr

G-Protein gekoppelte Rezeptoren

G-Protein gekoppelte Rezeptoren G-Protein gekoppelte Rezeptoren Bedeutung, Funktionen, Liganden Prinzipielle Funktionsmechanismen Klassifizierung und Eigenschaften von G-Proteinen Desensitivierung Beispiele G-Protein gekoppelte Rezeptoren

Mehr

BLAST. Datenbanksuche mit BLAST. Genomische Datenanalyse 10. Kapitel

BLAST. Datenbanksuche mit BLAST.  Genomische Datenanalyse 10. Kapitel Datenbanksuche mit BLAST BLAST Genomische Datenanalyse 10. Kapitel http://www.ncbi.nlm.nih.gov/blast/ Statistische Fragen Datenbanksuche Query Kann die globale Sequenzähnlichkeit eine Zufallsfluktuation

Mehr

Inhaltsverzeichnis. Teil 1 Basiswissen und Werkzeuge, um Statistik anzuwenden

Inhaltsverzeichnis. Teil 1 Basiswissen und Werkzeuge, um Statistik anzuwenden Inhaltsverzeichnis Teil 1 Basiswissen und Werkzeuge, um Statistik anzuwenden 1 Statistik ist Spaß 3 Warum Statistik? 3 Checkpoints 4 Daten 4 Checkpoints 7 Skalen - lebenslang wichtig bei der Datenanalyse

Mehr

Allgemeine Pharmakologie

Allgemeine Pharmakologie Allgemeine Pharmakologie Pharmakologie Arzneistoff: Wirkstoff, der zur Vorbeugung, Linderung, Heilung oder Erkennung von Erkrankungen dient Pharmakon: biologisch Wirksame Substanz Lehre von den Wirkungen

Mehr

Teil II: Einführung in die Statistik

Teil II: Einführung in die Statistik Teil II: Einführung in die Statistik (50 Punkte) Bitte beantworten Sie ALLE Fragen. Es handelt sich um multiple choice Fragen. Sie müssen die exakte Antwortmöglichkeit angeben, um die volle Punktzahl zu

Mehr

Einführung in statistische Analysen

Einführung in statistische Analysen Einführung in statistische Analysen Andreas Thams Econ Boot Camp 2008 Wozu braucht man Statistik? Statistik begegnet uns jeden Tag... Weihnachten macht Deutschen Einkaufslaune. Im Advent überkommt die

Mehr

4. Erstellen von Klassen

4. Erstellen von Klassen Statistik mit Tabellenkalkulation 4. Erstellen von Klassen Mit einem einfachen Befehl lässt sich eine Liste von Zahlen auf die Häufigkeit der einzelnen Werte untersuchen. Verwenden Sie dazu den Befehl

Mehr

FAKTORIELLE VERSUCHSPLÄNE. Andreas Handl

FAKTORIELLE VERSUCHSPLÄNE. Andreas Handl FAKTORIELLE VERSUCHSPLÄNE Andreas Handl 1 Inhaltsverzeichnis 1 Versuchsplanung 4 2 Einfaktorielle Varianzanalyse 6 2.1 DieAnnahmen... 6 2.2 Die ANOVA-Tabelle und der F -Test... 6 2.3 Versuche mit zwei

Mehr

Einführung in die Statistik mit EXCEL und SPSS

Einführung in die Statistik mit EXCEL und SPSS Christine Duller 2008 AGI-Information Management Consultants May be used for personal purporses only or by libraries associated to dandelon.com network. Einführung in die Statistik mit EXCEL und SPSS Ein

Mehr

InDesign CC. Grundlagen. Peter Wies. 1. Ausgabe, 1. Aktualisierung, März 2014 INDCC

InDesign CC. Grundlagen. Peter Wies. 1. Ausgabe, 1. Aktualisierung, März 2014 INDCC InDesign CC Peter Wies 1. Ausgabe, 1. Aktualisierung, März 2014 Grundlagen INDCC 12 InDesign CC - Grundlagen 12 Grafiken und verankerte Objekte In diesem Kapitel erfahren Sie wie Sie Grafiken im Dokument

Mehr

Stochastik für die Naturwissenschaften

Stochastik für die Naturwissenschaften Stochastik für die Naturwissenschaften Dr. C.J. Luchsinger 5. Erwartungswert E und Varianz V Literatur Kapitel 5 * Storrer: (37.9)-(37.12), (38.4), (40.6)-(40.9), (41.2) * Stahel: Kapitel 5 und 6 (nur

Mehr

Einfache statistische Auswertungen mit dem TI-Nspire

Einfache statistische Auswertungen mit dem TI-Nspire 1. Neues Dokument und darin eine neue Seite anlegen Als Typ 6: Lists & Spreadsheet wählen. Darin die Messwerte in einer Spalte erfassen. Dies ergibt die Urliste. Wenn mehrere Messwerte vorliegen, die diejenigen,

Mehr

Teil III. Wahrscheinlichkeitsrechnung und Statistik

Teil III. Wahrscheinlichkeitsrechnung und Statistik Teil III Wahrscheinlichkeitsrechnung und Statistik 145 Kapitel 7 Grundlagen aus der Wahrscheinlichkeitsrechnung 7.1 Die Begriffe Zufallsvariable, Messmethode, Experiment Die Abhängigkeit einer Variablen

Mehr

4. Kumulierte Häufigkeiten und Quantile

4. Kumulierte Häufigkeiten und Quantile 4. Kumulierte Häufigkeiten und Quantile Kumulierte Häufigkeiten Oft ist man nicht an der Häufigkeit einzelner Merkmalsausprägungen interessiert, sondern an der Häufigkeit von Intervallen. Typische Fragestellung:

Mehr

Unterlagen zum Tutorium der Lehrveranstaltung. MATHEMATIK für NATURWISSENSCHAFTEN (STATISTIK) Christoph Huber FB Mathematik der Universität Salzburg

Unterlagen zum Tutorium der Lehrveranstaltung. MATHEMATIK für NATURWISSENSCHAFTEN (STATISTIK) Christoph Huber FB Mathematik der Universität Salzburg Unterlagen zum Tutorium der Lehrveranstaltung MATHEMATIK für NATURWISSENSCHAFTEN (STATISTIK) Christoph Huber FB Mathematik der Universität Salzburg Stand: 30. April 2008 INHALTSVERZEICHNIS I Inhaltsverzeichnis

Mehr

Trennungsverfahren Techniken (in der Biologie)

Trennungsverfahren Techniken (in der Biologie) Trennungsverfahren Techniken (in der Biologie)? Biomoleküle können getrennt werden aufgrund ihrer - chemischen Eigenschaften: Ladung, Löslichkeit, Wechselwirkung mit spezifischen Reagenzen, Molmasse -

Mehr

Einführung in die Statistik mit EXCEL und SPSS

Einführung in die Statistik mit EXCEL und SPSS Christine Duller Einführung in die Statistik mit EXCEL und SPSS Ein anwendungsorientiertes Lehr- und Arbeitsbuch Zweite, überarbeitete Auflage Mit 71 Abbildungen und 26 Tabellen Physica-Verlag Ein Unternehmen

Mehr

Statistik mit Excel. für Praktiker: Statistiken aufbereiten und präsentieren HORST-DIETER RADKE. Markt+Technik

Statistik mit Excel. für Praktiker: Statistiken aufbereiten und präsentieren HORST-DIETER RADKE. Markt+Technik Statistik mit Excel für Praktiker: Statistiken aufbereiten und präsentieren HORST-DIETER RADKE Markt+Technik Vorwort Schreiben Sie uns! 13 15 Statistische Untersuchungen 17 Wozu Statistik? 18 Wirtschaftliche

Mehr

Box-and-Whisker Plot -0,2 0,8 1,8 2,8 3,8 4,8

Box-and-Whisker Plot -0,2 0,8 1,8 2,8 3,8 4,8 . Aufgabe: Für zwei verschiedene Aktien wurde der relative Kurszuwachs (in % beobachtet. Aus den jeweils 20 Quartaldaten ergaben sich die folgenden Box-Plots. Box-and-Whisker Plot Aktie Aktie 2-0,2 0,8,8

Mehr

Kapitel 1 Beschreibende Statistik

Kapitel 1 Beschreibende Statistik Beispiel 1.25: fiktive Aktienkurse Zeitpunkt i 0 1 2 Aktienkurs x i 100 160 100 Frage: Wie hoch ist die durchschnittliche Wachstumsrate? Dr. Karsten Webel 53 Beispiel 1.25: fiktive Aktienkurse (Fortsetzung)

Mehr

Einführung in SPSS. 1. Die Datei Seegräser

Einführung in SPSS. 1. Die Datei Seegräser Einführung in SPSS 1. Die Datei Seegräser An 25 verschiedenen Probestellen wurde jeweils die Anzahl der Seegräser pro m 2 gezählt und das Vorhandensein von Seeigeln vermerkt. 2. Programmaufbau Die wichtigsten

Mehr

Lage- und Streuungsmaße

Lage- und Streuungsmaße Sommersemester 2009 Modus Median Arithmetisches Mittel Symmetrie/Schiefe Wölbung/Exzess 4 6 8 10 ALQ Tutorien Begleitend zur Vorlesung, inhaltlich identisch mit der Übung Mögliche Zeiten: Do 10-12, Do

Mehr

Physica-Lehrbuch. Ein anwendungsorientiertes Lehr- und Arbeitsbuch. von Christine Duller

Physica-Lehrbuch. Ein anwendungsorientiertes Lehr- und Arbeitsbuch. von Christine Duller Physica-Lehrbuch Einführung in die Statistik mit EXCEL und SPSS Ein anwendungsorientiertes Lehr- und Arbeitsbuch von Christine Duller Neuausgabe Einführung in die Statistik mit EXCEL und SPSS Duller schnell

Mehr

Verbesserte Basenpaarung bei DNA-Analysen

Verbesserte Basenpaarung bei DNA-Analysen Powered by Seiten-Adresse: https://www.gesundheitsindustriebw.de/de/fachbeitrag/aktuell/verbesserte-basenpaarungbei-dna-analysen/ Verbesserte Basenpaarung bei DNA-Analysen Ein Team aus der Organischen

Mehr

Stochastik und Statistik

Stochastik und Statistik Stochastik und Statistik p. 1/44 Stochastik und Statistik Vorlesung 2 (Graphik I) K.Gerald van den Boogaart http://www.stat.boogaart.de Stochastik und Statistik p. 2/44 Daten Schätzung Test Mathe Die Datenminen

Mehr

Olfaktion. Olfaktion

Olfaktion. Olfaktion Olfaktion Emotionen und Verhalten Erinnerung Sozialverhalten Aroma Kontrolle der Nahrung Reviermarkierung Partnerwahl Orientierung in der Umwelt Duftstoffwahrnehmung Axel, R. Spektrum der Wissenschaft,

Mehr

Statistische Auswertung (Signifikanzen) Projekt: Evaluation der Langzeitauswirkung des Imago Paartherapie Workshops

Statistische Auswertung (Signifikanzen) Projekt: Evaluation der Langzeitauswirkung des Imago Paartherapie Workshops Auswertung: Irina Zamfirescu Auftraggeber: Mag. Klaus Brehm Statistische Auswertung (Signifikanzen) Projekt: Evaluation der Langzeitauswirkung des Imago Paartherapie Workshops Fragestellung: Wirkt sich

Mehr

Melanie Kaspar, Prof. Dr. B. Grabowski 1

Melanie Kaspar, Prof. Dr. B. Grabowski 1 7. Hypothesentests Ausgangssituation: Man muss sich zwischen 2 Möglichkeiten (=Hypothesen) entscheiden. Diese Entscheidung soll mit Hilfe von Beobachtungen ( Stichprobe ) getroffen werden. Die Hypothesen

Mehr

Kapitel 1: Deskriptive Statistik

Kapitel 1: Deskriptive Statistik Kapitel 1: Deskriptive Statistik Grafiken Mit Hilfe von SPSS lassen sich eine Vielzahl unterschiedlicher Grafiken für unterschiedliche Zwecke erstellen. Wir besprechen hier die zwei in Kapitel 1.1 thematisierten

Mehr

Veranstaltung Statistik (BWL) an der FH Frankfurt/Main im WS 2004/05 (Dr. Faik) Klausur 09.02.2005 - GRUPPE A - BEARBEITER/IN (NAME, VORNAME):

Veranstaltung Statistik (BWL) an der FH Frankfurt/Main im WS 2004/05 (Dr. Faik) Klausur 09.02.2005 - GRUPPE A - BEARBEITER/IN (NAME, VORNAME): Veranstaltung Statistik (BWL) an der FH Frankfurt/Main im WS 2004/05 (Dr. Faik) Klausur 09.02.2005 - GRUPPE A - BEARBEITER/IN (NAME, VORNAME): MATRIKELNUMMER: Alte Prüfungsordnung/Neue Prüfungsordnung

Mehr

Theoretische Grundlagen - Physikalisches Praktikum. Versuch 11: Mikroskopie

Theoretische Grundlagen - Physikalisches Praktikum. Versuch 11: Mikroskopie Theoretische Grundlagen - Physikalisches Praktikum Versuch 11: Mikroskopie Strahlengang das Lichtmikroskop besteht aus zwei Linsensystemen, iv und Okular, die der Vergrößerung aufgelöster strukturen dienen;

Mehr

Einführung in die statistische Datenanalyse I

Einführung in die statistische Datenanalyse I Einführung in die statistische Datenanalyse I Inhaltsverzeichnis 1. EINFÜHRUNG IN THEORIEGELEITETES WISSENSCHAFTLICHES ARBEITEN 2 2. KRITIERIEN ZUR AUSWAHL STATISTISCH METHODISCHER VERFAHREN 2 3. UNIVARIATE

Mehr

SPSS-Skriptum. 1. Vorbereitungen für die Arbeit mit SPSS (im Seminar)

SPSS-Skriptum. 1. Vorbereitungen für die Arbeit mit SPSS (im Seminar) Die folgenden Erklärungen und Abbildungen sollen den Umgang mit SPSS im Rahmen des POK erleichtern. Diese beschreiben nicht alle Möglichkeiten, die SPSS bietet, sondern nur die Verfahren, die im Seminar

Mehr

Ionenkanäle der Zellmembran. Seminar Differenzialgleichungen in der Biomedizin SoSe09 Karoline Jäger

Ionenkanäle der Zellmembran. Seminar Differenzialgleichungen in der Biomedizin SoSe09 Karoline Jäger Ionenkanäle der Zellmembran Seminar Differenzialgleichungen in der Biomedizin SoSe09 Karoline Jäger Inhaltsverzeichnis 1. Strom-Spannung Beziehung 2. Unabhängigkeit, Sättigung, Ussing Fluss Rate 3. Elektrodiffusions

Mehr

11./ 12. April 2006. Andrea Ossig andrea.ossig@web.de. Prof. Dr. Helmut Küchenhoff kuechenhoff@stat.uni-muenchen.de

11./ 12. April 2006. Andrea Ossig andrea.ossig@web.de. Prof. Dr. Helmut Küchenhoff kuechenhoff@stat.uni-muenchen.de Einführung in SPSS 11./ 12. April 2006 Andrea Ossig andrea.ossig@web.de Prof. Dr. Helmut Küchenhoff kuechenhoff@stat.uni-muenchen.de Monia Mahling monia.mahling@web.de 1 Vor /Nachteile von SPSS +/ intuitiv

Mehr

3.2 Streuungsmaße. 3 Lage- und Streuungsmaße 133. mittlere Variabilität. geringe Variabilität. große Variabilität 0.0 0.1 0.2 0.3 0.4 0.

3.2 Streuungsmaße. 3 Lage- und Streuungsmaße 133. mittlere Variabilität. geringe Variabilität. große Variabilität 0.0 0.1 0.2 0.3 0.4 0. Eine Verteilung ist durch die Angabe von einem oder mehreren Mittelwerten nur unzureichend beschrieben. Beispiel: Häufigkeitsverteilungen mit gleicher zentraler Tendenz: geringe Variabilität mittlere Variabilität

Mehr

Medizinische Biometrie (L5)

Medizinische Biometrie (L5) Medizinische Biometrie (L5) Vorlesung II Daten Deskription Prof. Dr. Ulrich Mansmann Institut für Medizinische Informationsverarbeitung, Biometrie und Epidemiologie mansmann@ibe.med.uni-muenchen.de IBE,

Mehr

Korrelation - Regression. Berghold, IMI

Korrelation - Regression. Berghold, IMI Korrelation - Regression Zusammenhang zwischen Variablen Bivariate Datenanalyse - Zusammenhang zwischen 2 stetigen Variablen Korrelation Einfaches lineares Regressionsmodell 1. Schritt: Erstellung eines

Mehr

Lerninhalte und Kompetenzerwartungen in der Klasse 8 mit Bezug zum eingeführten Lehrwerk: Mathematik Neue Wege 8 (Schroedel-Verlag Bestell.-Nr.

Lerninhalte und Kompetenzerwartungen in der Klasse 8 mit Bezug zum eingeführten Lehrwerk: Mathematik Neue Wege 8 (Schroedel-Verlag Bestell.-Nr. Lerninhalte und Kompetenzerwartungen in der Klasse 8 mit Bezug zum eingeführten Lehrwerk: Mathematik Neue Wege 8 (Schroedel-Verlag Bestell.-Nr. 85478) Viele der im Kernlehrplan aufgeführten Kompetenzbereiche

Mehr

Leseprobe. Wilhelm Kleppmann. Versuchsplanung. Produkte und Prozesse optimieren ISBN: 978-3-446-42033-5. Weitere Informationen oder Bestellungen unter

Leseprobe. Wilhelm Kleppmann. Versuchsplanung. Produkte und Prozesse optimieren ISBN: 978-3-446-42033-5. Weitere Informationen oder Bestellungen unter Leseprobe Wilhelm Kleppmann Versuchsplanung Produkte und Prozesse optimieren ISBN: -3-44-4033-5 Weitere Informationen oder Bestellungen unter http://www.hanser.de/-3-44-4033-5 sowie im Buchhandel. Carl

Mehr

Der Sehprozess - Überblick

Der Sehprozess - Überblick Der Sehprozess - Überblick? optischer Reiz?? el. Signal (Nerven) Thema und Inhalt Biophysik des Sehens vom Reiz zum Signal Fragen: Wie funktioniert die Signalwandlung? Wie wird das Signal verstärkt (>

Mehr

Häufigkeitsauszählungen, zentrale statistische Kennwerte und Mittelwertvergleiche

Häufigkeitsauszählungen, zentrale statistische Kennwerte und Mittelwertvergleiche Lehrveranstaltung Empirische Forschung und Politikberatung der Universität Bonn, WS 2007/2008 Häufigkeitsauszählungen, zentrale statistische Kennwerte und Mittelwertvergleiche 30. November 2007 Michael

Mehr

Alle WGKT-Empfehlungen können unter www.wgkt.de eingesehen und heruntergeladen werden.

Alle WGKT-Empfehlungen können unter www.wgkt.de eingesehen und heruntergeladen werden. WGKT-Empfehlung Betriebswirtschaftliche Kennzahlen von Krankenhäusern Stand: 05.11.2009 Arbeitskreismitglieder: Prof. Dr. K. Lennerts (Leitung), Karlsruhe; Prof. Dr. C. Hartung, Hannover; Dr. T. Förstemann,

Mehr

4. Quantitative Analyse der Ligand-Bindungsstudien

4. Quantitative Analyse der Ligand-Bindungsstudien 4. Quantitative Analyse der Ligand-Bindungsstudien Im folgenden apitel sollen die grundlegenden analytischen Methoden zur Interpretation der experimentell gewonnenen Bindungsdaten vorgestellt werden. ie

Mehr

a) Zeichnen Sie in das nebenstehende Streudiagramm mit Lineal eine Regressionsgerade ein, die Sie für passend halten.

a) Zeichnen Sie in das nebenstehende Streudiagramm mit Lineal eine Regressionsgerade ein, die Sie für passend halten. Statistik für Kommunikationswissenschaftler Wintersemester 2009/200 Vorlesung Prof. Dr. Helmut Küchenhoff Übung Cornelia Oberhauser, Monia Mahling, Juliane Manitz Thema 4 Homepage zur Veranstaltung: http://www.statistik.lmu.de/~helmut/kw09.html

Mehr

2 Physikalische Eigenschaften von Fettsäuren: Löslichkeit, Dissoziationsverhalten, Phasenzustände

2 Physikalische Eigenschaften von Fettsäuren: Löslichkeit, Dissoziationsverhalten, Phasenzustände 2 Physikalische Eigenschaften von Fettsäuren: Löslichkeit, Dissoziationsverhalten, Phasenzustände Als Fettsäuren wird die Gruppe aliphatischer Monocarbonsäuren bezeichnet. Der Name Fettsäuren geht darauf

Mehr

Über den Autor 7 Über den Fachkorrektor 7. Einführung 19

Über den Autor 7 Über den Fachkorrektor 7. Einführung 19 Inhaltsverzeichnis Über den Autor 7 Über den Fachkorrektor 7 Einführung 19 Über dieses Buch 19 Törichte Annahmen über den Leser 20 Wie dieses Buch aufgebaut ist 20 Teil I: Ein paar statistische Grundlagen

Mehr

B 2. " Zeigen Sie, dass die Wahrscheinlichkeit, dass eine Leiterplatte akzeptiert wird, 0,93 beträgt. (genauerer Wert: 0,933).!:!!

B 2.  Zeigen Sie, dass die Wahrscheinlichkeit, dass eine Leiterplatte akzeptiert wird, 0,93 beträgt. (genauerer Wert: 0,933).!:!! Das folgende System besteht aus 4 Schraubenfedern. Die Federn A ; B funktionieren unabhängig von einander. Die Ausfallzeit T (in Monaten) der Federn sei eine weibullverteilte Zufallsvariable mit den folgenden

Mehr

Forschungsstatistik I

Forschungsstatistik I Prof. Dr. G. Meinhardt. Stock, Nordflügel R. 0-49 (Persike) R. 0- (Meinhardt) Sprechstunde jederzeit nach Vereinbarung Forschungsstatistik I Dr. Malte Persike persike@uni-mainz.de WS 008/009 Fachbereich

Mehr

- Eine typische Ausfallrate, wie sie bei vielen technischen Anwendungen zu sehen ist hat die Form einer Badewanne, deshalb nennt man diese Kurve auch

- Eine typische Ausfallrate, wie sie bei vielen technischen Anwendungen zu sehen ist hat die Form einer Badewanne, deshalb nennt man diese Kurve auch 1 2 - Eine typische Ausfallrate, wie sie bei vielen technischen Anwendungen zu sehen ist hat die Form einer Badewanne, deshalb nennt man diese Kurve auch Badewannenkurve. -mit der Badewannenkurve lässt

Mehr

3.5 Beschreibende Statistik. Inhaltsverzeichnis

3.5 Beschreibende Statistik. Inhaltsverzeichnis 3.5 Beschreibende Statistik Inhaltsverzeichnis 1 beschreibende Statistik 26.02.2009 Theorie und Übungen 2 1 Die Darstellung von Daten 1.1 Das Kreisdiagramm Wir beginnen mit einem Beispiel, welches uns

Mehr