Beiträge der Biotechnologie zur Therapie des Diabetes mellitus

Größe: px
Ab Seite anzeigen:

Download "Beiträge der Biotechnologie zur Therapie des Diabetes mellitus"


1 Beiträge der Biotechnologie zur Therapie des Diabetes mellitus Professor Dr. Eberhard Ehlers Hofheim/D Goethe-Universität Frankfurt GDCh-Wissenschaftsforum Chemie 2009 Frankfurt am Main, 2.eptember 2009 Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 1

2 Inhalt Diabetes: Grundlagen, Definitionen, Behandlungsmöglichkeiten Insulin: Entdeckung, Meilensteine, truktur, Bedarf Insulin-Herstellung: Eine Erfolgsgeschichte der Gentechnik Insulinanaloga Neue Therapieansätze chlussbemerkungen Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 2

3 Diabetes - Zahlen und Fakten Etwa 8 Millionen Bundesbürger leiden an Diabetes mellitus ca. 10% sind Typ 1-Diabetiker ( Jugendlicher Diabetes ) ca. 90% leiden an Typ 2-Diabetes ( Altersdiabetes ) 20% normalgewichtige Typ 2a-Diabetiker 80% übergewichtige Typ 2b-Diabetiker Diabetiker tragen ein 5-fach höheres Herzinfarktrisiko und ein 3-fach höheres chlaganfallrisiko als Nichtdiabetiker Diabetes ist Hauptursache für: Dialysepflicht (Nierenversagen) Bein-/Fußamputationen (diabetischer Fuß) Erblindungen (diabetische Retinopathie) Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 3

4 Zuckerstoffwechsel beim Nichtdiabetiker Was ist Diabetes? Kohlenhydrate aus der Nahrung werden im Darm in einzelne Zuckermoleküle (hauptsächlich Glucose) gespalten Diese Glucosemoleküle ( ) werden in die Blutbahn aufgenommen Die B-Zellen der Bauchspeicheldrüse reagieren auf den Anstieg der Blutzuckerkonzentration mit einer Insulinausschüttung ( ) Das Insulin gelangt über die Blutbahn zu den Zielgeweben (Muskel, Leber, etc.) und wirkt dort als chlüssel Die Insulinwirkung ermöglicht also die Aufnahme von Glucose aus dem Blut in die Zellen Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 4

5 Was ist Diabetes? Zuckerstoffwechsel beim Diabetiker Typ 1: Keine Insulinsekretion aus den B-Zellen Typ 2: Die Zielgewebe sprechen nicht mehr (genügend) auf das ausgeschüttete Insulin an Beide Diabetes-Typen führen also 1. zu einem Mangel an Glucose in den Zielgeweben 2. zu einem Überschuss an Glucose im Blut Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 5

6 Folgeschäden Ein wichtiges Ziel der Diabetesbehandlung ist auch die Vermeidung von Folgeschäden den: Arteriosklerose (Herzerkrankung, chlaganfall, Gefäßverschlüsse an den Beinen) (ca tödliche Infarkte/Jahr - ca tödliche chlaganfälle/jahr) Nierenschädigung, Nierenversagen (Dialyse - ca neue Fälle/Jahr) Netzhautschädigung (Erblindung - ca neue Fälle /Jahr) Nervenschädigung (ensibilitätsstörungen, Neuropathie)) (ca Amputationen/Jahr - Impotenz?) Hauterkrankungen (Infektionen, schlecht heilende Wunden) Das Risiko, Folgeerkrankungen zu erleiden, lässt sich durch geeignete Therapieschemata und engmaschige Kontrollmaßnahmen erheblich mindern! Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 6

7 Therapieziele Welche Werte sind mit Hilfe therapeutischer Maßnahmen anzustreben? Parameter Zielwerte Blutglucose (nüchtern) mg/dl HbA 1c < 6,5% Harnglucose 0% Gesamtcholesterin < 200 mg/dl Triglyceride < 150 mg/dl Body Mass Index (Körpergewicht/Körpergrösse 2 ) w: kg/m 2 m: kg/m 2 Blutdruck < 140/90 mmhg Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 7

8 Welche Therapien stehen zur Verfügung? Nichtmedikamentöse Therapiemöglichkeiten: Diät Bewegung Nikotinentwöhnung Mit der aus diesen Maßnahmen resultierenden Gewichtsreduktion wird nicht selten eine ausreichende Einstellung von Typ 2-Diabetikern erreicht. In jedem Falle wird der fortschreitenden Insulinresistenz entgegengewirkt. Die Gewichtsreduktion stellt darüber hinaus die kausale Behandlung des sog. Metabolischen yndroms dar, das sich bei vielen Typ 2-Diabetikern entwickelt: Insulinresistenz ( erhöhte Blutzuckerwerte) Übergewicht (Adipositas)( erhöhte Blutfettwerte) Bluthochdruck (Hypertonie) evtl. erhöhte Harnsäurewerte ( Gicht) Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 8

9 Medikamentöse Behandlung Folgende Arzneistoffe stehen für die Behandlung des Diabetes zur Verfügung: Insuline Rinderinsulin chweineinsulin biotechnologisch hergestelltes Humaninsulin, Insulinanaloga Orale Antidiabetika ulfonylharnstoffe (Tolbutamid, Glibenclamid, Glimepirid u.a.) Glinide (Repaglinid, Nateglinid) Insulin-ensitizer (Glitazone) (Pioglitazon, Rosiglitazon) Metformin Acarbose/Miglitol (α-glucosidase-inhibitoren) u.a.m. Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 9

10 Die Entdeckung des Insulins 1921 Isolierung von Insulin aus Inselzellen des Pankreas 1923 Nobelpreis in Physiologie und Medizin Banting und Best Macleod JJR Collip JB Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 10

11 Insulin-Therapie des Diabetes Eine der ersten mit Insulin behandelten Patientinnen 1922 Elizabeth Evans Hughes ( ) Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 11

12 Insulin-Therapie des Diabetes Wichtige Meilensteine der Insulinforschung 20er 30er 40er 50er 60er 70er 80er 90er Insulin-Isolierung, Kristallisation (1926 Abel) Protamin-Zink-Insuline, Zink-Insuline NPH-Insulin (neutrales Protamin Hagedorn-Insulin) Lente-Insulin, Primärstruktur (1954 anger), Radio-Immunoassay Insulinreinigung, Biosynthese (Proinsulin) Raumstruktur, Totalsynthese (Katsoyannis, Zahn) Glucose-Monitoring, kontinuierliche Infusion, Gentechnik, Humaninsulin Pens, implantierbare Pumpen, Insulinanaloga, inhalierbares Insulin, Insulindetemir Ehlers_Mainz_12Juli2005 Hier wird Wissen Wirklichkeit 12

13 Insulin-Therapie des Diabetes Primärstruktur des Humaninsulins A-Kette Gly-Ile-Val-Glu-Gln-Cys-Cys-Thr-er-Ile-Cys-er-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn Phe-Val-Asn-Gln-His-Leu-Cys-Gly-er-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Thr B-Kette 51 Aminosäuren: A-Kette: 21 / B-Kette: 30 3 Disulfidbrücken Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 13

14 Insulinstrukturen 1: Humaninsulin 2: chwein, Hund 3: Rind 4: chaf, Ziege 5: Katze 6:Pferd Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 14

15 Insulinversorgung in den UA Prognose 1976 Mrd. Insulineinheiten 100 Insulinbedarfsentwicklung Unberücksichtigt blieben: Produzierte Menge Bessere Nutzung verfügbarer Drüsen Verfügbarkeit von - Drüsen aus dem Ausland - Insulin aus dem Ausland Mögliche Ausbeuteverbesserungen Bessere orale Antidiabetika Durchbrüche in den Genforschung 40 Fakten Theoretischer Insulin Bedarf Quelle: A tudy of Insulin upply and Demand, NIH 1976 Ein gesunder Mensch produziert rund 2 mg Insulin pro Tag Ein Typ-I-Diabetiker verbraucht ca. 1,5 mg tierisches Insulin pro Tag Ein chweinepankreas ergibt tierisches Insulin für 10 Tage eit 1982: gentechnisch hergestelltes Humaninsulin Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 15

16 Insulin-Therapie des Diabetes Diabetiker weltweit ( ) % % % % % World: 2000 = 171 Million 1995 = 118 Million (2.8 %) 2010 = 221 Million 2010 = 221 Million Zunahme 87% (4.4 %) % Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 16

17 Definition der Gentechnik Was ist Gentechnik? Neukombination von Nucleinsäuren - Herstellung von Proteinen für medizinische und technische Anwendungen - Herstellung von transgenen Pflanzen und Tieren - Gendiagnostik - Gentherapie Was ist Gentechnik nicht? Klassische Züchtungsverfahren Extrakorporale Befruchtung Übertragung von Embryonen auf Leihmütter (Zell)Biologische Verfahren - Herstellung von tierischen Hybriden (chiege = chaf + Ziege) - Herstellung von Pflanzenhybriden (Nektarine) - Klonieren von Organismen (z. B. tecklinge, Ableger) - Embryoteilung und Embryotransfer bei Nutztieren Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 17

18 Von der DNA-truktur zum Protein Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 18

19 Insulin-Therapie des Diabetes truktur und Funktion des Humaninsulins A-Kette B-Kette Monomer Monomer-Wechselwirkung Assoziation von drei Dimeren zum Hexamer Bindung an den Rezeptor Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 19

20 Der biotechnologische Prozess Upstream Processing Downstream Processing Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 20

21 Gentechnische Herstellung von Humaninsulin Ansätze zur gentechnischen Herstellung von Humaninsulin: 1. Expression der beiden Insulin-Ketten in unterschiedlichen E.coli-tämmen 2. Expression von Proinsulin in E.coli-tämmen (in Anlehnung an die Insulin-Biosynthese) Primärprodukt ist das Prä-Proinsulin aus ignal-peptid, der B-Kette, dem C-Peptid und der A-Kette 3. Expression von Mini-Proinsulin in acharomyces cerevisiae Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 21

22 Expressionsvektor für Humaninsulin Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 22

23 Der Fermentations-Prozess Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 23

24 Die Basisreinigung Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 24

25 Die Hochreinigung Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 25


27 Insulinanaloga Int. Bezeichnung (Handelsname) Modifizierte Positionen Unterdrückung Hexamerenbildung chnellere Anflutung pritz-ess- Abstand kürzer Basalinsulin (24 h) IEP im Neutralen Wirkungsveränderung Lispro (Humalog ) Aspart (NovoRapid ) Glulisin (Apidra ) Glargin (Lantus) B28Lys-B30Pro (Vertauschung) B28Asp Austausch Pro B3Lys statt Asp B29Glu statt Lys A21Gly statt Asp B31Arg-B32Arg Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 27

28 Exendin-4-Derivate Eine neue Behandlung des Typ 2- Diabetes Exenatid ein synthetisches Abwandlungsprodukt eines Polypeptids (39 A) (GLP-1-Agonist = Glucagon like peptide) ab 2006 im Handel Gila-Krustenechse (im peichel) (Heloderma horridum and Heloderma suspectum) Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 28

29 Glucagon like peptide (GLP)-Wirkmechanismus Insulin Ausschüttung Insulin Biosynthese Glucagon ekretion β-zell-erhaltung Leber Glucose Produktion Magenentleerung Nahrungsaufnahme Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 29

30 GLP-1-Agonisten: Chemie GLP-1-Analoge (Liraglutide, Taspoglutide und CJC-1131) Exendin-Analoge (Exendin-4 = Exenatide und AVE0010) Exendin-4 H2N-HGEGTFTDLKQMEEEAVRLFIEWKNGGGGPGAPPP-NH2 Taspoglutide H2N-HXEGTFTDVYLEGQAAKEFIAWLVKXR-NH2 (X = Aminoisobuttersäure) Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 30

31 Exendin-4-Derivate - Neuer therapeutischer Ansatz Frühstadium Fortgeschrittenes tadium Diät/port Orale Antidiabetika Monotherapie Kombination GLP-1 Agonist Insulin GLP-1-Rezeptoragonisten bilden eventuell eine Brücke zwischen Oralen Antidiabetika und Insulin Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 31

32 chlussbemerkungen (1) In der Biotechnik werden natürliche yntheseleistungen von Mikroorganismen, tierischen und pflanzlichen Zellen zur industriellen Gewinnung von toffen insbesondere Pharmaka genutzt. Ein weiterer Zweig der Biotechnik ist die Gewinnung von Enzymen (Biokatalysatoren) zur schonenden Modifizierung von toffen. Biotechnologische Prozesse nutzen Zellen als chemische Fabrik. olche Prozesse sind äußerst effizient, nachhaltig und hoch innovativ! Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 32

33 chlussbemerkungen (2) In der Gentechnik werden ebenfalls Produkte durch lebende Organismen gewonnen. Im Unterschied zur Biotechnik wird aber im Laufe des Verfahrens DNA isoliert und gezielt verändert. Die modifizierte DNA wird wieder in einen Organismus integriert, um dadurch eine neue Eigenschaft des betreffenden Organismus für eine yntheseleistung nutzen zu können. Die Gentechnik erweitert daher die Möglichkeiten der Biotechnik und eröffnet neue Chancen der Wirkstoffproduktion. Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 33

34 Vielen Dank für Ihre Aufmerksamkeit! Ich danke der Firma anofi-aventis für die Überlassung einiger Abbildungen. Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 34

Fortbildungskurs Klinische Diabetologie der DDG 8. Oktober2012 Insulin: Biosynthese und Sekretion

Fortbildungskurs Klinische Diabetologie der DDG 8. Oktober2012 Insulin: Biosynthese und Sekretion Fortbildungskurs Klinische Diabetologie der DDG 8. Oktober2012 Insulin: Biosynthese und ekretion Thomas Meissner Universitäts Kinderklinik Düsseldorf DDG Kurs 2012 Gliederung Insulin Insulinbiosynthese


Humanisierung von Schweine-Insulin

Humanisierung von Schweine-Insulin Humanisierung von Schweine-Insulin Für die Herstellung von Humaninsulin werden zwei Alternativen erwähnt: Die enzymatische Umwandlung von Insulin aus Schweinepankreas, wobei hier darauf hingewiesen wird,


Insulin Engineering der Wirkdauer

Insulin Engineering der Wirkdauer Insulin Engineering der Wirkdauer Mona Bausch Proteinbiochemie/Proteinengineering 07.07.2015 [1], [2] Insulin und dessen Aufgabe Hormon Produziert in β-zellen der Langerhanß schen Inseln der Bauchspeicheldrüse


Typ 2 Diabetes Einbahnstraße in die Insulinpflicht? Hans Hauner

Typ 2 Diabetes Einbahnstraße in die Insulinpflicht? Hans Hauner Typ 2 Diabetes Einbahnstraße in die Insulinpflicht? Hans Hauner Lehrstuhl für Ernährungsmedizin, KKG Typ 2 Diabetes Technische Universität München Besonderheiten des Typ 2 Diabetes Beim Typ 2 Diabetes


Aminosäurenanalytik. Probenvorbereitung Eiweißfällung, Oxidation und Hydrolyse Karl-Heinz Jansen SYKAM CHROMATOGRAPHIE

Aminosäurenanalytik. Probenvorbereitung Eiweißfällung, Oxidation und Hydrolyse Karl-Heinz Jansen SYKAM CHROMATOGRAPHIE Aminosäurenanalytik Probenvorbereitung Eiweißfällung, Oxidation und Hydrolyse Karl-Heinz Jansen SYKAM CHROMATOGRAPHIE Proteinfällung 2 Proteinfällung 3 Proteinfällung 4 Proteinfällung 5 Proteinfällung


- Diabetes im Blickfeld Diabetes:

- Diabetes im Blickfeld Diabetes: - Diabetes im Blickfeld Diabetes: Häufigkeit Vorkommen Symptome Gefahr der Folgeschäden Behandlung Vortag von Dr. Bernhard Walter HELIOS Rosmann Klinik Breisach Definition Diabetes mellitus = honigsüßer


Neue Medikamente bei der Behandlung von Typ II Diabetes. Prim. Dr. Ewald Binter Privatklinik Althofen Ärztezentrum St. Veit/Glan

Neue Medikamente bei der Behandlung von Typ II Diabetes. Prim. Dr. Ewald Binter Privatklinik Althofen Ärztezentrum St. Veit/Glan Neue Medikamente bei der Behandlung von Typ II Diabetes Prim. Dr. Ewald Binter Privatklinik Althofen Ärztezentrum St. Veit/Glan Therapie Medikamentöse Maßnahmen Resorptionshemmung Besserung der Insulinwirkung



DIABETES MELLITUS I. HAUPTSYMPTOME, DIAGNOSE, KLASSIFIKATION + THERAPIE DIABETES MELLITUS I. HAUPTSYMPTOME, DIAGNOSE, KLASSIFIKATION + THERAPIE Dr. med. Peter Igaz PhD DSc Klinik II. der Inneren Medizin Medizinische Fakultät Semmelweis Universität Beschwerden bei manifesten


Insulin same procedure as every year? Barbara Felix KliFo 2013 KSBL Standort Bruderholz

Insulin same procedure as every year? Barbara Felix KliFo 2013 KSBL Standort Bruderholz Insulin same procedure as every year? Barbara Felix KliFo 2013 KSBL Standort Bruderholz -Zellfunktion (%) Verlust der - Zellfunktion 100 Diabetes mellitus 75 IGT 50 25 Postprandiale Hyperglykämie Phase



STOFFWECHSEL DIABETES MELLITUS 2 Therapieziele und empfohlene Kontrollhäufigkeit Für alle genannten Parameter müssen mit dem Patienten individuelle Zielvorgaben getroffen werden. Von aufgeführten Zielwerten kann im Einzelfall entsprechend


Neue Wirkstoffe und Therapieansätze zur Behandlung von Typ-2-Diabetes

Neue Wirkstoffe und Therapieansätze zur Behandlung von Typ-2-Diabetes Neue Wirkstoffe und Therapieansätze zur Behandlung von Typ-2-Diabetes Nürnberg 2015 PD Dr. Michael Hummel Diabetologische SPP Rosenheim & Forschergruppe Diabetes der TU München & Institut für Diabetesforschung


Papyrus Ebers 1550 v. Christus. Erste Beschreibung der Symptomatik des Diabetes mellitus

Papyrus Ebers 1550 v. Christus. Erste Beschreibung der Symptomatik des Diabetes mellitus Diabetes I Papyrus Ebers 1550 v. Christus Erste Beschreibung der Symptomatik des Diabetes mellitus 1869 Entdeckung der B-Zellen des Pankreas durch Langerhans 1921 Gewinnung von Insulin aus Pankreasgewebe


Die Natur als Vorbild Isolierung neuer Arzneimittel aus natürlichen Quellen

Die Natur als Vorbild Isolierung neuer Arzneimittel aus natürlichen Quellen Die Natur als Vorbild Isolierung neuer Arzneimittel aus natürlichen Quellen Professor Dr. Eberhard Ehlers Hofheim/D Goethe-Universität Frankfurt am Main 14.Stuttgarter Chemietage Institut Dr. Flad Stuttgart,


WAS IST DIABETES? 1. Zucker - Kraftstoff des Menschen

WAS IST DIABETES? 1. Zucker - Kraftstoff des Menschen WAS IST DIABETES? 1. Zucker - Kraftstoff des Menschen Traubenzucker liefert Energie Bei jedem Menschen ist ständig eine geringe Menge Traubenzucker (Glukose) im Blut gelöst. Dieser Blutzucker ist der Kraftstoff


Biologicals Innovationen der besonderen Art. Prof. Dr. Theo Dingermann Institut für Pharmazeutische Biologie JWG-Universität Frankfurt.

Biologicals Innovationen der besonderen Art. Prof. Dr. Theo Dingermann Institut für Pharmazeutische Biologie JWG-Universität Frankfurt. Biologicals Innovationen der besonderen Art Prof. Dr. Theo Dingermann Institut für Pharmazeutische Biologie JWG-Universität Frankfurt Arzneimittel sind Stoffe oder Stoffgemische unterschiedlicher chemischer


Programm und Übersicht

Programm und Übersicht Programm und Übersicht Referenten der Veranstaltung: Dr. med. Frank Merfort und Dr. med. Simone van Haag Diabetologische Schwerpunktpraxis Grevenbroich Samstag, 22.10.2011 Praktische Diabetologie im Krankenhaus


Therapie des Typ 2 - Diabetes. W. A. Scherbaum

Therapie des Typ 2 - Diabetes. W. A. Scherbaum Therapie des Typ 2 - Diabetes W. A. Scherbaum Klinik für Endokrinologie, Diabetologie und Rheumatologie Direktor: Prof. Dr. med. Werner A. Scherbaum Vorlesung am 24. Mai 2011 Häufige Komorbiditäten beim


Tabletteneinstellung Neuigkeiten in der Diabetestherapie

Tabletteneinstellung Neuigkeiten in der Diabetestherapie Tabletteneinstellung Neuigkeiten in der Diabetestherapie Wirkung des Insulins Darm und Muskel- und Fettzellen Diabetes Mellitus Typ I-Diabetes Zerstörung der insulinbildenden Zellen in der Bauchspeicheldrüse


Ihre Babenberg-Apotheke informiert: Fachbegriffe zum Thema Diabetes

Ihre Babenberg-Apotheke informiert: Fachbegriffe zum Thema Diabetes Ihre informiert: Fachbegriffe zum Thema Diabetes Acarbose ACE-Hemmer Aceton Albumin Aminosäuren Angina-pectoris-Anfall Angiopathie Arteriosklerose Arzneimittelwirkstoff, der die Verdauung der Kohlenhydrate


Medizin im Vortrag. Herausgeber: Prof. Dr. med. Christoph Frank Dietrich. Diabetes mellitus

Medizin im Vortrag. Herausgeber: Prof. Dr. med. Christoph Frank Dietrich. Diabetes mellitus Medizin im Vortrag Herausgeber: Prof. Dr. med. Christoph Frank Dietrich Diabetes mellitus Autoren: Kerstin Siehr Dr. med. Katrin Schartmann Prov. Dr. med. Thomas Haak Priv.-Doz. Dr. med. Christoph Frank



RUHR-UNIVERSITÄT BOCHUM MEDIZINISCHE UNIKLINIK KNAPPSCHAFTSKRANKENHAUS. Was hilft wie? Dr. Anja Figge Typ 2 Diabetes mellitus Was hilft wie? Dr. Anja Figge Insulin-Resistenz Typ 2 Diabetiker Pankreas = Insulinfabrik des Körpers Fettdepots Gewicht Insulin Insulin Muskel Fettgewebe Leber der Doktor hat gesagt,


WAS IST DIABETES MELLITUS? URSACHEN UND FOLGEN. Leben so normal wie möglich. Lilly Deutschland GmbH Werner-Reimers-Straße 2 4 61352 Bad Homburg

WAS IST DIABETES MELLITUS? URSACHEN UND FOLGEN. Leben so normal wie möglich. Lilly Deutschland GmbH Werner-Reimers-Straße 2 4 61352 Bad Homburg WAS IST DIABETES MELLITUS? URSACHEN UND FOLGEN DEDBT01425 Lilly Deutschland GmbH Werner-Reimers-Straße 2 4 61352 Bad Homburg Leben so normal wie möglich Was ist


Peptide Proteine. 1. Aminosäuren. Alle optisch aktiven proteinogenen Aminosäuren gehören der L-Reihe an: 1.1 Struktur der Aminosäuren

Peptide Proteine. 1. Aminosäuren. Alle optisch aktiven proteinogenen Aminosäuren gehören der L-Reihe an: 1.1 Struktur der Aminosäuren 1. Aminosäuren Aminosäuren Peptide Proteine Vortragender: Dr. W. Helliger 1.1 Struktur 1.2 Säure-Basen-Eigenschaften 1.2.1 Neutral- und Zwitterion-Form 1.2.2 Molekülform in Abhängigkeit vom ph-wert 1.3


Honigsüßer Durchfluss

Honigsüßer Durchfluss Honigsüßer Durchfluss Gliederung 1. Volkskrankheit Diabetes 2. Insulin: Türöffner für den Blutzucker 3. Formen des Diabetes mellitus 3.1 Typ-1-Diabetes 3.2 Typ-2-Diabetes 3.3 Gestationsdiabetes 4. Symptomatik


Diabetesbehandlung: Simulation am PC

Diabetesbehandlung: Simulation am PC Grundlagen Diabetesbehandlung: Simulation am PC Mit Hilfe eines Computerprogramms soll ein Typ I Diabetiker auf seine speziellen Eßgewohnheiten eingestellt werden. Das Programm bietet die Möglichkeiten,


Leben mit Diabetes - Die Herausforderung meistern! - Mechthild Segna Diabetesberaterin DDG

Leben mit Diabetes - Die Herausforderung meistern! - Mechthild Segna Diabetesberaterin DDG Leben mit Diabetes - Die Herausforderung meistern! - Mechthild Segna Diabetesberaterin DDG Leben mit Diabetes Welche Typen von Diabetes? Wie entsteht Diabetes? Welche Folgen kann Diabetes haben? Wie kann


Neuentwicklungen in der Insulintherapie Auf dem Weg zum perfekten Insulin. abhängig von einem veränderten Blutzuckerwert freigesetzt:

Neuentwicklungen in der Insulintherapie Auf dem Weg zum perfekten Insulin. abhängig von einem veränderten Blutzuckerwert freigesetzt: Auf dem Weg zum perfekten Insulin Seit der Insulin-Entdeckung im Jahr 1921 hat die Insulingabe ihren festen Platz in der Therapie des Typ-1- und des Typ-2-Diabetes. Und seit der Entdeckung gab es niemals


Diabetes im Kindesalter aktuelle Therapieformen

Diabetes im Kindesalter aktuelle Therapieformen Diabetes im Kindesalter aktuelle Therapieformen 11. Dreiländertagung 2012 Dr.oec.troph. Astrid Tombek Bad Mergentheim Klassifikation des Diabetes Typ 1 (Subtypen 1a-ideopatisch und 1b-autoimmun) Typ 2


Der Diabetes liegt mir am Herzen

Der Diabetes liegt mir am Herzen Der Diabetes liegt mir am Herzen Priv.Doz. Dr. med. Frank Muders Fachärztliche Gemeinschaftspraxis für Innere Medizin und Kardiologie, Ärztehaus Weiden Diabetikeradern altern schneller Gefäßwandveränderungen


Erweiterte Anerkennung als Behandlungseinrichtung für Typ 1 und Typ 2 Diabetiker/innen

Erweiterte Anerkennung als Behandlungseinrichtung für Typ 1 und Typ 2 Diabetiker/innen Erweiterte Anerkennung als Behandlungseinrichtung für Typ 1 und Typ 2 Diabetiker/innen nach den Richtlinien der Deutschen Diabetes Gesellschaft(DDG) mit diabetesspezifischem Qualitätsmanagement (DQM Stufe


15. Aminosäuren, Peptide und Proteine

15. Aminosäuren, Peptide und Proteine 15. Aminosäuren, Peptide und Proteine 1 Proteine (Polypeptide) erfüllen in biologischen ystemen die unterschiedlichsten Funktionen. o wirken sie z.b. bei vielen chemischen eaktionen in der atur als Katalysatoren


Neue Medikamente in der Behandlung des Typ-2-Diabetes

Neue Medikamente in der Behandlung des Typ-2-Diabetes Hegau-Bodensee-Klinikum Radolfzell Diabeteszentrum Neue Medikamente in der Behandlung des Typ-2-Diabetes 9. Diabetikertag in Radolfzell 16. November 2008 Behandlungsmöglichkeiten: Insulinresistenz bessern


12. WAZ- Nachtforum Transplantation bei Diabetes

12. WAZ- Nachtforum Transplantation bei Diabetes 12. WAZ- Nachtforum Transplantation bei Diabetes Pankreastransplantation in Bochum Dr. Peter Schenker Klinikum der Ruhr-Universität Bochum Chirurgische Klinik Knappschaftskrankenhaus Bochum Diabetes in


Vorlesung Innere Medizin, Endokrinologie. Therapie des Typ 1 Diabetes. Prof. Dr. med. W. A. Scherbaum

Vorlesung Innere Medizin, Endokrinologie. Therapie des Typ 1 Diabetes. Prof. Dr. med. W. A. Scherbaum Vorlesung Innere Medizin, Endokrinologie Therapie des Typ 1 Diabetes Prof. Dr. med. W. A. Scherbaum Klinik für Endokrinologie, Diabetologie und Rheumatologie Direktor: Prof. Dr. med. Werner A. Scherbaum


Diabetestherapie Neues und Bewährtes

Diabetestherapie Neues und Bewährtes Diagnose des Diabetes mellitus Diabetestherapie Neues und Bewährtes Dr. med. Vojtech Pavlicek 10. Thurgauer Symposium Innere Medizin Weinfelden 3. September 2015 Test Beurteilung Nüchtern Blutzucker (Plsamaglukose)


Facharbeit LK Biologie der Freiherr-vom-Stein-Schule, Hessisch-Lichtenau. zum Thema:

Facharbeit LK Biologie der Freiherr-vom-Stein-Schule, Hessisch-Lichtenau. zum Thema: Facharbeit LK Biologie der Freiherr-vom-Stein-Schule, Hessisch-Lichtenau zum Thema: Diabetes mellitus: Welche Vor- und Nachteile hat eine Insulintherapie für den Typ 2 Diabetes? von Anna Christina Lohr


Hausärztliche Fortbildung Referententandem aus Hausarzt und Diabetologe

Hausärztliche Fortbildung Referententandem aus Hausarzt und Diabetologe Hausärztliche Fortbildung Referententandem aus Hausarzt und Diabetologe Insulintherapie bei Typ-2-Diabetes Michael Jecht GK und MVZ Havelhöhe Diabetologie Kladower Damm 221, 14089 Berlin


Matthias Birnstiel. Diabetes. Modul. Medizinisch wissenschaftlicher Lehrgang CHRISANA. Wissenschaftliche Lehrmittel, Medien, Aus- und Weiterbildung

Matthias Birnstiel. Diabetes. Modul. Medizinisch wissenschaftlicher Lehrgang CHRISANA. Wissenschaftliche Lehrmittel, Medien, Aus- und Weiterbildung Matthias Birnstiel Modul Diabetes Medizinisch wissenschaftlicher Lehrgang CHRISANA Wissenschaftliche Lehrmittel, Medien, Aus- und Weiterbildung Inhaltsverzeichnis des Moduls Diabetes Anatomie des Knochengewebes


Praktische Diabetologie. BOT orale Therapie mit basaler Insulin-Unterstützung: Wer, wann, was?

Praktische Diabetologie. BOT orale Therapie mit basaler Insulin-Unterstützung: Wer, wann, was? Praktische Diabetologie BOT orale Therapie mit basaler Insulin-Unterstützung: Wer, wann, was? N. Tiling Fallbeispiel 1 72 jähriger Patient + 8 kg / Jahr 89 kg, 1,65 cm, BMI


Vorwort zur 9. Auflage 11

Vorwort zur 9. Auflage 11 6 Inhaltsverzeichnis Vorwort zur 9. Auflage 11 Verschiedene Formen und Typen des Diabetes 13 Zwei Formen des Diabetes 13 Zwei Typen des genuinen Diabetes 14 Diagnose des Diabetes 15 Pathologische Glukosetoleranz


FIT 1 Herzlich willkommen

FIT 1 Herzlich willkommen FIT 1 Herzlich willkommen Der Weg ist das Ziel! (Konfuzius) Quelle: Funktionelle Insulintherapie = FIT Nahezu - normoglykämische Insulinsubstitution = NIS Basis - Bolus: Langzeit-Fasteninsulin


Diabetes mellitus Typ 2

Diabetes mellitus Typ 2 Diabetes mellitus Typ 2 von Dr. med. Andreas Liebl und Dr. phil. nat. Eric Martin Mit 13 Abbildungen und 13 Tabellen Schriftenreihe der Bayerischen Landesapothekerkammer Heft 71 München 2005 Govi-Verlag


Behandlung und Therapieformen

Behandlung und Therapieformen Behandlung und Therapieformen In diesem Kapitel möchten wir Sie über den aktuellen Stand der Behandlungsmöglichkeiten informieren. Insulinbehandlung allgemein Insulinbehandlung allgemein Wie bereits beschrieben,


Appetit... Essen... sich wohler fühlen. Diabetes mellitus. Ein paar grundlegende Gedanken. Was ist Diabetes mellitus? Was ist die Ursache?

Appetit... Essen... sich wohler fühlen. Diabetes mellitus. Ein paar grundlegende Gedanken. Was ist Diabetes mellitus? Was ist die Ursache? Diabetes mellitus Appetit... Essen... sich wohler fühlen Diabetes mellitus Ein paar grundlegende Gedanken Das Wort Diabetes mellitus kommt aus dem Griechischen und bedeutet honigsüßer Durchfluss. Das heißt,


die Senkung des Blutzuckers durch Förderung der Zuckeraufnahme in Muskel-, Fett und Leberzelle und die Hemmung der Zuckerneubildung in der Leber

die Senkung des Blutzuckers durch Förderung der Zuckeraufnahme in Muskel-, Fett und Leberzelle und die Hemmung der Zuckerneubildung in der Leber Selbsthilfegruppe diabetischer Kinder und Typ-1 Diabetiker 97 e.v. Schweinfurt Verschiedene Insulinpräparate - unterschiedliche Wirkung Zum Thema sprach Dr. Reinhard Koch, Diabetologe DDG und Oberarzt


Einfluss des DMP auf die Antidiabetikaverordnungen

Einfluss des DMP auf die Antidiabetikaverordnungen Einfluss des DMP auf die Antidiabetikaverordnungen Dr. Andrea Wienecke AOK Westfalen Lippe Dr. Gholamreza Pirasteh Dr. Birgit Grave Ute Kirchhof Andreas Heeke 12. Jahrestagung der GAA, 30. Nov. bis 1.Dez.


Einsatz neuer Medikamente: GLP1-Analoga & DPP4-Hemmer

Einsatz neuer Medikamente: GLP1-Analoga & DPP4-Hemmer 16. Welt Diabetes Tag an der Charité Einsatz neuer Medikamente: GLP1-Analoga & DPP4-Hemmer Lenka Bosanska Was bedeutet: GLP-1 DPP-4 Hormone des Glucosestoffwechsels Pankreas (Bauchspeicheldrüse) Insulin


Neue Diabetestherapien. Pharmakologie WS 06/07

Neue Diabetestherapien. Pharmakologie WS 06/07 Neue Diabetestherapien Pharmakologie WS 06/07 Zimt: Allgemeines Chinesischer Zimt (Cinnamomum cassia) Wirksamer Ceylon-Zimt (Cinnamomum ceylanicum) Zimt: Toxikologie Einsatz in weiten Teilen der Lebensmittelindustrie


Zuckerkrankheit griech. honigsüßer Durchfluss

Zuckerkrankheit griech. honigsüßer Durchfluss DIABETES MELLITUS Zuckerkrankheit griech. honigsüßer Durchfluss Es gibt 2 Arten des Diabetes mellitus: Diabetes mellitus Typ I insulinpflichtig Diabetes mellitus Typ II nicht Formatvorlage insulinpflichtig


Moderne Diabetestherapie evidence based medicine oder managed care? Martin Pfohl

Moderne Diabetestherapie evidence based medicine oder managed care? Martin Pfohl Moderne Diabetestherapie evidence based medicine oder managed care? Martin Pfohl Med. Klinik I EVK Bethesda GmbH Duisburg Evidence based medicine Medizinische Entscheidungen aufgrund von evidence ärztlicher


Rekombinante Wirkstoffe. Prof. Dr. Theo Dingermann Institut für Pharmazeutische Biologie Goethe-Universität Frankfurt Dingermann@em.uni-frankfurt.

Rekombinante Wirkstoffe. Prof. Dr. Theo Dingermann Institut für Pharmazeutische Biologie Goethe-Universität Frankfurt Dingermann@em.uni-frankfurt. Rekombinante Wirkstoffe Prof. Dr. Theo Dingermann Institut für Pharmazeutische Biologie Goethe-Universität Frankfurt Praktische Definitionen Gentechnik Unmittelbare neukombination


Inhaltsverzeichnis VORWORT

Inhaltsverzeichnis VORWORT Inhaltsverzeichnis VORWORT Bis zum Jahr 1922 waren Typ-1-Diabetiker zum Tode verurteilt. Doch schon ein Jahr später konnten Zuckerkranke auf ein langes, erfülltes und produktives Leben hoffen. Gemeinsam


Diagnose: Nicht insulinpflichtiger Diabetes Typ 2 mit erhöhten Blutfettwerten (Hypertriglyzeridämie)

Diagnose: Nicht insulinpflichtiger Diabetes Typ 2 mit erhöhten Blutfettwerten (Hypertriglyzeridämie) Diagnose: Nicht insulinpflichtiger Diabetes Typ 2 mit erhöhten Blutfettwerten (Hypertriglyzeridämie) Warum die Stoffwechseloptimierung im Hinblick auf Zucker und Fett so wichtig ist. Information für Patienten


Ich habe Diabetes was kann ich tun? Kurhan Ӏ

Ich habe Diabetes was kann ich tun? Kurhan Ӏ Ich habe Diabetes was kann ich tun? Kurhan Ӏ Diabetes mellitus was bedeutet das? Diabetes mellitus ist eine Störung Ihres Stoffwechsels, bei der sich im Blut zu viel Zucker (Glukose) ansammelt.


1971: Manipulation eines Viren-Genoms mit Restriktionsenzymen. 1973: Erstes gentechnisch verändertes Bakterium - Geburt der "Gentechnik"

1971: Manipulation eines Viren-Genoms mit Restriktionsenzymen. 1973: Erstes gentechnisch verändertes Bakterium - Geburt der Gentechnik Geschichte der Gentechnik Ein kleiner Überblick: 1970-1983 1/28 1966: Entschlüsselung des genetischen Codes 1970: Entdeckung der Restriktionsenzyme in Bakterien. 1971: Manipulation eines Viren-Genoms mit


Human Insulin in der Ph.Eur.

Human Insulin in der Ph.Eur. Human Insulin in der Ph.Eur. Das europäische Arzneibuch enthält insgesamt 11 Monographien zum Thema Insuline: Lösliches Insulin als Injektionslösung (6.0/0834) Insulin human (6.0/0838) Insulin vom Rind


Insulin aus den Langerhansschen Inseln

Insulin aus den Langerhansschen Inseln Insulin Themen Insulinproduktion Insulinsekretion Insulinsorten Wirkprofile Lagerung und Anwendung von Insulinen Insulintherapieformen Pause und praktische Übung Insulindosisanpassung (BE, BE-Faktor, 30


Süßes Blut Diabetes mellitus Typ 2

Süßes Blut Diabetes mellitus Typ 2 Süßes Blut Diabetes mellitus Typ 2 [ von Dr. Ute Koch ] In Deutschland gibt es acht Millionen Diabetiker, hinzu kommt eine hohe Dunkelziffer. Hauptverantwortlich für diese dramatische Zahl ist der Typ-2-Diabetes:


Definition. Diagnostik. Hinweise: Kein Diabetes mellitus. DEGAM-Anwenderversion der NVL KURZVERSION

Definition. Diagnostik. Hinweise: Kein Diabetes mellitus. DEGAM-Anwenderversion der NVL KURZVERSION Deutsche Gesellschaft für Allgemeinmedizin und Familienmedizin DEGAM-Anwenderversion der NVL KURZVERSION Diabetes mellitus Typ 2 Definition Ein manifester Diabetes mellitus Typ 2 liegt vor, wenn Gelegenheitsplasmaglukose


Kontroversen und neue Daten zur medikamentösen Therapie des Typ 2-Diabetes U. Brödl

Kontroversen und neue Daten zur medikamentösen Therapie des Typ 2-Diabetes U. Brödl Medizinische Klinik und Poliklinik II Campus Grosshadern Kontroversen und neue Daten zur medikamentösen Therapie des Typ 2-Diabetes U. Brödl Medizinische Klinik und Poliklinik II Campus Grosshadern Interessenskonflikt:


Foliensatz; Arbeitsblatt; Internet. Je nach chemischem Wissen können die Proteine noch detaillierter besprochen werden.

Foliensatz; Arbeitsblatt; Internet. Je nach chemischem Wissen können die Proteine noch detaillierter besprochen werden. 03 Arbeitsauftrag Arbeitsauftrag Ziel: Anhand des Foliensatzes soll die Bildung und der Aufbau des Proteinhormons Insulin erklärt werden. Danach soll kurz erklärt werden, wie man künstlich Insulin herstellt.



SVEN-DAVID MÜLLER CHRISTIANE WEISSENBERGER SVEN-DAVID MÜLLER CHRISTIANE WEISSENBERGER Ernährungsratgeber Typ-2-Diabetes Genießen erlaubt 18 Diabetes mellitus wichtig zu wissen Alkohol ist generell für Diabetiker nicht geeignet. Fettleber sollten


Priv.-Doz. Dr. Joachim Feldkamp Klinik für Innere Medizin Endokrinologie und Diabetologie, Pneumologie, Infektiologie

Priv.-Doz. Dr. Joachim Feldkamp Klinik für Innere Medizin Endokrinologie und Diabetologie, Pneumologie, Infektiologie Priv.-Doz. Dr. Joachim Feldkamp Klinik für Innere Medizin Endokrinologie und Diabetologie, Pneumologie, Infektiologie Städtische Kliniken Bielefeld-Mitte Zimmet P, Alberti KG, Shaw J. Nature 2001; 414:


Metabolisches Syndrom was ist das eigentlich?

Metabolisches Syndrom was ist das eigentlich? Metabolisches Syndrom, Diabetes und KHK Volkskrankheiten auf dem Vormarsch Dr. med. Axel Preßler Lehrstuhl und Poliklinik für Präventive und Rehabilitative Sportmedizin Klinikum rechts der Isar TU München


des Diabetes mellitus Typ2

des Diabetes mellitus Typ2 S157 Behandlung des Diabetes mellitus Typ2 Autoren S.Matthaei 1,H.U.Häring 2 Institute 1 Diabetes-Zentrum Quakenbrück,Fachabteilung für Diabetes, Stoffwechselkrankheiten und Endokrinologie am Christlichen


MERKSÄTZE DIABETES MELLITUS. Annals of Internal Medicine. Welche Rolle spielt die Blutzuckerkontrolle zu Hause?

MERKSÄTZE DIABETES MELLITUS. Annals of Internal Medicine. Welche Rolle spielt die Blutzuckerkontrolle zu Hause? Therapie bei Diabetes Typ 2 ein Update Umfassender Review des American College of Physicians Das Ziel einer Diabetesbehandlung besteht in der Ver - meidung oder Minimierung mikro- und makrovaskulärer Komplikationen.


Diabetes mellitus. Juliane Briest, Anne Röhrs, Dorota Niezgodka

Diabetes mellitus. Juliane Briest, Anne Röhrs, Dorota Niezgodka Diabetes mellitus Juliane Briest, Anne Röhrs, Dorota Niezgodka Regulation des Blutzuckers Für die Sicherstellung der Versorgung der Körperzellen mit Glukose wird der Blutzuckerspiegel in einem Organismus


Bewährte Medikamente neu betrachtet

Bewährte Medikamente neu betrachtet Bewährte Medikamente neu betrachtet Prim. Univ.-Prof. Dr. Bernhard Ludvik 1.Medizinische Abteilung mit Diabetologie, Endokrinologie und Department für Nephrologie Krankenanstalt Rudolfstiftung Zur Diabetes


Diabetes kompakt für die Hausarztpraxis

Diabetes kompakt für die Hausarztpraxis Diabetes kompakt für die Hausarztpraxis Deutscher Diabetes Kongress, Berlin, 16. Mai 2015 In Kooperation von Start mit Insulin Wann starte ich mit Insulin? Wie starte ich mit Insulin? Welches Insulin sollte


Multiple-Choice-Fragen zu Kapitel 12

Multiple-Choice-Fragen zu Kapitel 12 12.1.1 Fragetyp B, eine Antwort falsch Einer der folgenden Faktoren ist nicht typisch für das metabolische Syndrom. Welcher? a. Bauchbetontes Übergewicht b. Erhöhte bzw. veränderte Blutfettwerte c. niedriger


Pharmakotherapie des Diabetes mellitus Typ 2 SS 2010

Pharmakotherapie des Diabetes mellitus Typ 2 SS 2010 Pharmakotherapie des Diabetes mellitus Typ 2 SS 2010 Diabetes mellitus Typ 1 (juvenil) absoluter Insulinmangel infolge Zerstörung pankreatischer B- Zellen Katabole Stoffwechsellage, autoimmune Pathogenese


Therapie des Diabetes mellitus Typ 2. Esther Menzel Krankenschwester, Diabetesassistentin

Therapie des Diabetes mellitus Typ 2. Esther Menzel Krankenschwester, Diabetesassistentin Therapie des Diabetes mellitus Typ 2 Esther Menzel Krankenschwester, Diabetesassistentin Spock: Pille, hast du eine Pille gegen Diabetes? Pille: Kleinigkeit! Hier! In 5 Minuten ist dein Diabetes Sternenstaub!


Neue Therapiemöglichkeit: Hemmung der Zuckerwiederaufnahme im Urin

Neue Therapiemöglichkeit: Hemmung der Zuckerwiederaufnahme im Urin Neue Therapiemöglichkeit: Hemmung der Zuckerwiederaufnahme im Urin Uta Berndt November 2014 Welt-Diabetes-Tag Berlin 1 Krankheitsmechanismus Diabetes mellitus Typ 2 verminderte Insulinwirkung am Insulinrezeptor


Management von Diabetes mellitus

Management von Diabetes mellitus Management von Diabetes mellitus Dr. Petra Sandow 1 2 3 4 Management von Diabetes Mellitus TdA Berlin 6.09.14 1 5 6 2014? 7 8 Management von Diabetes Mellitus TdA Berlin 6.09.14 2 Prävalenz des Metabolischen


MOL.504 Analyse von DNA- und Proteinsequenzen

MOL.504 Analyse von DNA- und Proteinsequenzen MOL.504 Analyse von DNA- und Proteinsequenzen Kurs 1 Monika Oberer, Karl Gruber MOL.504 Modul-Übersicht Einführung, Datenbanken BLAST-Suche, Sequenzalignment Proteinstrukturen Virtuelles Klonieren Abschlusstest


Besondere Aspekte in der Behandlung dialysepflichtiger Diabetespatienten Dr. Josef Zimmermann Fulda, 29.10.2006

Besondere Aspekte in der Behandlung dialysepflichtiger Diabetespatienten Dr. Josef Zimmermann Fulda, 29.10.2006 Besondere Aspekte in der Behandlung dialysepflichtiger Diabetespatienten Dr. Josef Zimmermann Fulda, 29.10.2006 Epidemiologie Komorbiditätbei terminal niereninsuffizienten Diabetespatienten Diabetestherapie


Insuline. Goldstandard in der Therapie des Diabetes mellitus REFERAT

Insuline. Goldstandard in der Therapie des Diabetes mellitus REFERAT Insuline Goldstandard in der Therapie des Diabetes mellitus In Deutschland sind etwa 5% der Bevölkerung an Diabetes mellitus erkrankt. Davon sind 5 10% Typ I-Diabetiker. Schon im 2.Jhd. wird von Aretaios


Aktuelle medikamentöse Therapieoptionen beim Diabetes

Aktuelle medikamentöse Therapieoptionen beim Diabetes Zentrum für Endokrinologie, Diabetologie und Präventivmedizin (ZEDP) Max-Planck-Institut für Stoffwechselforschung Aktuelle medikamentöse Therapieoptionen beim Diabetes Köln Köln 2015 Unterzeile zum Titel


Prüfungsfragenkatalog für für Grundlagen der Gentechnik und Biotechnologie (Prof. Prof. Rudolf Bauer und Prof. Karin Ardjomand-Wölkart)

Prüfungsfragenkatalog für für Grundlagen der Gentechnik und Biotechnologie (Prof. Prof. Rudolf Bauer und Prof. Karin Ardjomand-Wölkart) Prüfungsfragenkatalog für für Grundlagen der Gentechnik und Biotechnologie (Prof. Prof. Rudolf Bauer und Prof. Karin Ardjomand-Wölkart) Stand: September 2014 Termin: 29.09.2014 1. Was ist Western Blot?


Behandlungs- und Schulungsprogramm für Typ-2-Diabetiker, die Normalinsulin spritzen

Behandlungs- und Schulungsprogramm für Typ-2-Diabetiker, die Normalinsulin spritzen Behandlungs- und Schulungsprogramm für Typ-2-Diabetiker, die spritzen Fortbildungsseminar: 15 bis 19 Uhr: für Ärzte und Praxispersonal Vorstellung des Therapie- und Schulungsprogramms, Diskussion über


Aminosäuren - Proteine

Aminosäuren - Proteine Aminosäuren - Proteine ÜBERBLICK D.Pflumm KSR / MSE Aminosäuren Überblick Allgemeine Formel für das Grundgerüst einer Aminosäure Carboxylgruppe: R-COOH O Aminogruppe: R-NH 2 einzelnes C-Atom (α-c-atom)


C R H H O H H O. Peptide

C R H H O H H O. Peptide Peptide Peptide: Ketten aus Aminosäuren Enzymatische Prozesse vermögen Aminosäuren im rganismus zu größeren Molekülen, den Peptiden, zu verknüpfen 1. Diese erfüllen vielfältige physiologische Aufgaben,


Diabetes was heißt das?

Diabetes was heißt das? Diabetes was heißt das? Sie haben Diabetes: Was heißt das? Die Zuckerkrankheit war schon im Mittelalter bekannt. Die Ärzte diagnostizierten sie, indem sie den Urin des Patienten abschmeckten. War er süß,


Ein besseres Leben mit Diabetes Typ 2

Ein besseres Leben mit Diabetes Typ 2 Ein besseres Leben mit Diabetes Typ 2 Informationsmaterial für Menschen mit Diabetes Typ 2 31-MAR-2012 Jan-2009-BE-2041-BT Was ist Diabetes Typ 2 - Zuckerkrankheit? Bei Diabetes Typ 2 ist zu viel Glukose


Diabetes Mellitus - Zuckerkrankheit Ihre Gesundheit - Unser Thema ist ein Service Ihrer niedergelassenen Ärzte und Psychotherapeuten in Bayern

Diabetes Mellitus - Zuckerkrankheit Ihre Gesundheit - Unser Thema ist ein Service Ihrer niedergelassenen Ärzte und Psychotherapeuten in Bayern Patienteninformation Diabetes Mellitus - Zuckerkrankheit Ihre Gesundheit - Unser Thema ist ein Service Ihrer niedergelassenen Ärzte und Psychotherapeuten in Bayern Mehr als sechs Millionen Menschen leiden


Diagnostik und Therapie des Diabetes mellitus Typ 2

Diagnostik und Therapie des Diabetes mellitus Typ 2 S. Fischer, K. Schmidt-Göhrich, M. Verlohren, J. Schulze Diagnostik und Therapie des Diabetes mellitus Typ 2 TU Dresden Medizinische Fakultät III. Medizinische Klinik Zusammenfassung In den nächsten Jahren


Diabetes (Zuckerkrankheit)

Diabetes (Zuckerkrankheit) arztpraxis limmatplatz Definition... 2 Häufigkeit... 2 Krankheitsursachen... 2 Typ-I- und Typ-II-Diabetes... 2 Typ-I-Diabetes (= IDDM Insulin dependent diabetes mellitus)... 2 Typ-II-Diabetes (NIDDM =


Arzneimittel im Blickpunkt

Arzneimittel im Blickpunkt Arzneimittel im Blickpunkt Sitagliptin / Exenatide Ausgabe 7 / 2007 In dieser Ausgabe des Studienguckers möchten wir zwei neue Arzneimittel vorstellen, die sich in Deutschland seit kurzem auf dem Markt


Schulungsprogramm für Typ 2-Diabetiker, die nicht Insulin spritzen

Schulungsprogramm für Typ 2-Diabetiker, die nicht Insulin spritzen Anlage 12: Schulungsprogramme Diabetes Typ 2 zu dem Vertrag nach 73a SGB V über ein strukturiertes Behandlungsprogramm (DMP) zur Verbesserung der Qualität der Versorgung von Typ 2 Diabetikern zwischen


Westdeutsches Diabetes- und

Westdeutsches Diabetes- und Westdeutsches Diabetes- und Gesundheitszentrum (WDGZ) Hat sich die Versorgungslandschaft für Diabetes in den letzten Jahren verändert? Diabeteshäufigkeit Diabetesbehandlung Versorgungsstruktur Prinzip


Das basale Insulin als Schlüssel zum Therapieerfolg

Das basale Insulin als Schlüssel zum Therapieerfolg Das basale Insulin als Schlüssel zum Therapieerfolg Dr. C. Schweiger Altenmarkt, 15.05.2011 Universitätsklinik für Kinder und Jugendheilkunde Salzburg C. Schweiger / Paracelsus Medizinische Privatuniversität


Orale Antidiabetika & Insulin Wirkungen, Nebenwirkungen & Wechselwirkungen. Apotheke Bulgariplatz Linz Mag. pharm.

Orale Antidiabetika & Insulin Wirkungen, Nebenwirkungen & Wechselwirkungen. Apotheke Bulgariplatz Linz Mag. pharm. Orale Antidiabetika & Insulin Wirkungen, Nebenwirkungen & Wechselwirkungen Gewissensfrage: Wie viele Medikamente nehmen Sie? Die normale Österreicherin Ihre Arzneimittel 1 x Thyrex 0,1 mg 3 x Glucophage


Diabetes mellitus Einführung

Diabetes mellitus Einführung Diabetes mellitus Einführung Was ist D.m. Diabetes mellitus honigsüßer Durchfluß Bekannt schon bei den alten Ägyptern Was ist D.m. 3 interessante Fragen: 1. Hat jeder Mensch Zucker im Blut? Ja!!!! Was


Identifizierung und Bestimmung von Humaninsulin, synthetischen. Insulinanalogen, Humanplasma zu Dopingkontrollzwecken

Identifizierung und Bestimmung von Humaninsulin, synthetischen. Insulinanalogen, Humanplasma zu Dopingkontrollzwecken Identifizierung und Bestimmung von Humaninsulin, synthetischen Insulinanalogen, deren Abbauprodukten und C-Peptid in Humanurin und Humanplasma zu Dopingkontrollzwecken mittels Flüssigkeitschromatographie


Diabetes mellitus. Glucose AS, FS, Gi-Hormone (z.b. Gastrin) Wirkung von Glucocorticoiden T3, T4. Glucagon. Somatostatin.

Diabetes mellitus. Glucose AS, FS, Gi-Hormone (z.b. Gastrin) Wirkung von Glucocorticoiden T3, T4. Glucagon. Somatostatin. Diabetes mellitus 1. Einführung: Diabetes im Rahmen des Metabolischen Syndroms Physiologiefolie 2. Vergleich Typ I & II Diabetes 3. Diabetes Typ II Übersicht Therapieziele Verlauf nicht pharmakologische


Diabetologie Intensiv 2015 Haben Sulfonylharnstoffe und Glinide noch eine Berechtigung in der Therapie des Typ 2-Diabetes?

Diabetologie Intensiv 2015 Haben Sulfonylharnstoffe und Glinide noch eine Berechtigung in der Therapie des Typ 2-Diabetes? CAMPUS INNENSTADT Diabetes Zentrum Diabetologie Intensiv 2015 Haben Sulfonylharnstoffe und Glinide noch eine Berechtigung in der Therapie des Typ 2-Diabetes? Jochen Seißler Ludwig-Maximilians-Universität


DMP Diabetes - Themenübersicht

DMP Diabetes - Themenübersicht DMP Diabetes - Themenübersicht Allgemeines Behandlung Med. Therapie Leitlinien OAD und Insuline Ernährung und Diät Sport und Bewegung Spätfolgen, Komplikationen Hypoglycämien Sonstige Komplikationen Diabetischer


Pharmakologie der Blutzuckerregulation Insulin 1.) Chemie >

Pharmakologie der Blutzuckerregulation Insulin 1.) Chemie > Pharmakologie der Blutzuckerregulation Autor: C. Nanoff Institut für Pharmakologie, Medizinische Universität Wien (siehe Freissmuth, Offermanns, Böhm, Pharmakologie & Toxikologie Kapitel 54, S. 602-622)


Fallvorsstellung. Zweifache Ursache des Typ 2 Diabetes. Ungelöste Probleme bei der Behandlung des Typ 2 Diabetes

Fallvorsstellung. Zweifache Ursache des Typ 2 Diabetes. Ungelöste Probleme bei der Behandlung des Typ 2 Diabetes Fortbildung Scuol Diabetes Update 5./6. September 2009 Fallvorsstellung Andreas Rohrer/Roger Lehmann Klinik Endokrinologie und Diabetologie Zweifache Ursache des Typ 2 Diabetes? Pankreas Zu wenig und zu


Einsatz von prandialen GLP-1- Rezeptoragonisten bei der Therapie des Typ-2-Diabetes mellitus. Wirkprinzip und Einsatzmöglichkeiten

Einsatz von prandialen GLP-1- Rezeptoragonisten bei der Therapie des Typ-2-Diabetes mellitus. Wirkprinzip und Einsatzmöglichkeiten Einsatz von prandialen GLP-1- Rezeptoragonisten bei der Therapie des Typ-2-Diabetes mellitus Wirkprinzip und Einsatzmöglichkeiten Diabetes-Prävalenz in Deutschland und weltweit Weltweit wachsendes Problem
