Beiträge der Biotechnologie zur Therapie des Diabetes mellitus

Größe: px
Ab Seite anzeigen:

Download "Beiträge der Biotechnologie zur Therapie des Diabetes mellitus"

Transkript

1 Beiträge der Biotechnologie zur Therapie des Diabetes mellitus Professor Dr. Eberhard Ehlers Hofheim/D Goethe-Universität Frankfurt GDCh-Wissenschaftsforum Chemie 2009 Frankfurt am Main, 2.eptember 2009 Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 1

2 Inhalt Diabetes: Grundlagen, Definitionen, Behandlungsmöglichkeiten Insulin: Entdeckung, Meilensteine, truktur, Bedarf Insulin-Herstellung: Eine Erfolgsgeschichte der Gentechnik Insulinanaloga Neue Therapieansätze chlussbemerkungen Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 2

3 Diabetes - Zahlen und Fakten Etwa 8 Millionen Bundesbürger leiden an Diabetes mellitus ca. 10% sind Typ 1-Diabetiker ( Jugendlicher Diabetes ) ca. 90% leiden an Typ 2-Diabetes ( Altersdiabetes ) 20% normalgewichtige Typ 2a-Diabetiker 80% übergewichtige Typ 2b-Diabetiker Diabetiker tragen ein 5-fach höheres Herzinfarktrisiko und ein 3-fach höheres chlaganfallrisiko als Nichtdiabetiker Diabetes ist Hauptursache für: Dialysepflicht (Nierenversagen) Bein-/Fußamputationen (diabetischer Fuß) Erblindungen (diabetische Retinopathie) Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 3

4 Zuckerstoffwechsel beim Nichtdiabetiker Was ist Diabetes? Kohlenhydrate aus der Nahrung werden im Darm in einzelne Zuckermoleküle (hauptsächlich Glucose) gespalten Diese Glucosemoleküle ( ) werden in die Blutbahn aufgenommen Die B-Zellen der Bauchspeicheldrüse reagieren auf den Anstieg der Blutzuckerkonzentration mit einer Insulinausschüttung ( ) Das Insulin gelangt über die Blutbahn zu den Zielgeweben (Muskel, Leber, etc.) und wirkt dort als chlüssel Die Insulinwirkung ermöglicht also die Aufnahme von Glucose aus dem Blut in die Zellen Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 4

5 Was ist Diabetes? Zuckerstoffwechsel beim Diabetiker Typ 1: Keine Insulinsekretion aus den B-Zellen Typ 2: Die Zielgewebe sprechen nicht mehr (genügend) auf das ausgeschüttete Insulin an Beide Diabetes-Typen führen also 1. zu einem Mangel an Glucose in den Zielgeweben 2. zu einem Überschuss an Glucose im Blut Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 5

6 Folgeschäden Ein wichtiges Ziel der Diabetesbehandlung ist auch die Vermeidung von Folgeschäden den: Arteriosklerose (Herzerkrankung, chlaganfall, Gefäßverschlüsse an den Beinen) (ca tödliche Infarkte/Jahr - ca tödliche chlaganfälle/jahr) Nierenschädigung, Nierenversagen (Dialyse - ca neue Fälle/Jahr) Netzhautschädigung (Erblindung - ca neue Fälle /Jahr) Nervenschädigung (ensibilitätsstörungen, Neuropathie)) (ca Amputationen/Jahr - Impotenz?) Hauterkrankungen (Infektionen, schlecht heilende Wunden) Das Risiko, Folgeerkrankungen zu erleiden, lässt sich durch geeignete Therapieschemata und engmaschige Kontrollmaßnahmen erheblich mindern! Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 6

7 Therapieziele Welche Werte sind mit Hilfe therapeutischer Maßnahmen anzustreben? Parameter Zielwerte Blutglucose (nüchtern) mg/dl HbA 1c < 6,5% Harnglucose 0% Gesamtcholesterin < 200 mg/dl Triglyceride < 150 mg/dl Body Mass Index (Körpergewicht/Körpergrösse 2 ) w: kg/m 2 m: kg/m 2 Blutdruck < 140/90 mmhg Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 7

8 Welche Therapien stehen zur Verfügung? Nichtmedikamentöse Therapiemöglichkeiten: Diät Bewegung Nikotinentwöhnung Mit der aus diesen Maßnahmen resultierenden Gewichtsreduktion wird nicht selten eine ausreichende Einstellung von Typ 2-Diabetikern erreicht. In jedem Falle wird der fortschreitenden Insulinresistenz entgegengewirkt. Die Gewichtsreduktion stellt darüber hinaus die kausale Behandlung des sog. Metabolischen yndroms dar, das sich bei vielen Typ 2-Diabetikern entwickelt: Insulinresistenz ( erhöhte Blutzuckerwerte) Übergewicht (Adipositas)( erhöhte Blutfettwerte) Bluthochdruck (Hypertonie) evtl. erhöhte Harnsäurewerte ( Gicht) Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 8

9 Medikamentöse Behandlung Folgende Arzneistoffe stehen für die Behandlung des Diabetes zur Verfügung: Insuline Rinderinsulin chweineinsulin biotechnologisch hergestelltes Humaninsulin, Insulinanaloga Orale Antidiabetika ulfonylharnstoffe (Tolbutamid, Glibenclamid, Glimepirid u.a.) Glinide (Repaglinid, Nateglinid) Insulin-ensitizer (Glitazone) (Pioglitazon, Rosiglitazon) Metformin Acarbose/Miglitol (α-glucosidase-inhibitoren) u.a.m. Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 9

10 Die Entdeckung des Insulins 1921 Isolierung von Insulin aus Inselzellen des Pankreas 1923 Nobelpreis in Physiologie und Medizin Banting und Best Macleod JJR Collip JB Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 10

11 Insulin-Therapie des Diabetes Eine der ersten mit Insulin behandelten Patientinnen 1922 Elizabeth Evans Hughes ( ) Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 11

12 Insulin-Therapie des Diabetes Wichtige Meilensteine der Insulinforschung 20er 30er 40er 50er 60er 70er 80er 90er Insulin-Isolierung, Kristallisation (1926 Abel) Protamin-Zink-Insuline, Zink-Insuline NPH-Insulin (neutrales Protamin Hagedorn-Insulin) Lente-Insulin, Primärstruktur (1954 anger), Radio-Immunoassay Insulinreinigung, Biosynthese (Proinsulin) Raumstruktur, Totalsynthese (Katsoyannis, Zahn) Glucose-Monitoring, kontinuierliche Infusion, Gentechnik, Humaninsulin Pens, implantierbare Pumpen, Insulinanaloga, inhalierbares Insulin, Insulindetemir Ehlers_Mainz_12Juli2005 Hier wird Wissen Wirklichkeit 12

13 Insulin-Therapie des Diabetes Primärstruktur des Humaninsulins A-Kette Gly-Ile-Val-Glu-Gln-Cys-Cys-Thr-er-Ile-Cys-er-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn Phe-Val-Asn-Gln-His-Leu-Cys-Gly-er-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Thr B-Kette 51 Aminosäuren: A-Kette: 21 / B-Kette: 30 3 Disulfidbrücken Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 13

14 Insulinstrukturen 1: Humaninsulin 2: chwein, Hund 3: Rind 4: chaf, Ziege 5: Katze 6:Pferd Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 14

15 Insulinversorgung in den UA Prognose 1976 Mrd. Insulineinheiten 100 Insulinbedarfsentwicklung Unberücksichtigt blieben: Produzierte Menge Bessere Nutzung verfügbarer Drüsen Verfügbarkeit von - Drüsen aus dem Ausland - Insulin aus dem Ausland Mögliche Ausbeuteverbesserungen Bessere orale Antidiabetika Durchbrüche in den Genforschung 40 Fakten Theoretischer Insulin Bedarf Quelle: A tudy of Insulin upply and Demand, NIH 1976 Ein gesunder Mensch produziert rund 2 mg Insulin pro Tag Ein Typ-I-Diabetiker verbraucht ca. 1,5 mg tierisches Insulin pro Tag Ein chweinepankreas ergibt tierisches Insulin für 10 Tage eit 1982: gentechnisch hergestelltes Humaninsulin Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 15

16 Insulin-Therapie des Diabetes Diabetiker weltweit ( ) % % % % % World: 2000 = 171 Million 1995 = 118 Million (2.8 %) 2010 = 221 Million 2010 = 221 Million Zunahme 87% (4.4 %) % Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 16

17 Definition der Gentechnik Was ist Gentechnik? Neukombination von Nucleinsäuren - Herstellung von Proteinen für medizinische und technische Anwendungen - Herstellung von transgenen Pflanzen und Tieren - Gendiagnostik - Gentherapie Was ist Gentechnik nicht? Klassische Züchtungsverfahren Extrakorporale Befruchtung Übertragung von Embryonen auf Leihmütter (Zell)Biologische Verfahren - Herstellung von tierischen Hybriden (chiege = chaf + Ziege) - Herstellung von Pflanzenhybriden (Nektarine) - Klonieren von Organismen (z. B. tecklinge, Ableger) - Embryoteilung und Embryotransfer bei Nutztieren Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 17

18 Von der DNA-truktur zum Protein Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 18

19 Insulin-Therapie des Diabetes truktur und Funktion des Humaninsulins A-Kette B-Kette Monomer Monomer-Wechselwirkung Assoziation von drei Dimeren zum Hexamer Bindung an den Rezeptor Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 19

20 Der biotechnologische Prozess Upstream Processing Downstream Processing Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 20

21 Gentechnische Herstellung von Humaninsulin Ansätze zur gentechnischen Herstellung von Humaninsulin: 1. Expression der beiden Insulin-Ketten in unterschiedlichen E.coli-tämmen 2. Expression von Proinsulin in E.coli-tämmen (in Anlehnung an die Insulin-Biosynthese) Primärprodukt ist das Prä-Proinsulin aus ignal-peptid, der B-Kette, dem C-Peptid und der A-Kette 3. Expression von Mini-Proinsulin in acharomyces cerevisiae Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 21

22 Expressionsvektor für Humaninsulin Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 22

23 Der Fermentations-Prozess Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 23

24 Die Basisreinigung Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 24

25 Die Hochreinigung Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 25

26 Trypsin-paltung von Prä-Proinsulin ALA -NH2 THR THR ER THR GLY AN ER ALA ARG -1 PHE 1 60 LY ARG GLN GLY 1 LEU ALA LEU PRO GLN GLU GLY LEU ER ILE VAL GLU GLN CY CY THR ER ILE CY ER LEU TYR GLN LEU GLU AN TYR CY AN -COOH LEU ER GLY ALA GLY PRO VAL AN GLN HI LEU CY GLY ER HI LEU VAL GLU ALA LEU TYR LEU VAL CY GLY GLU ARG GLY PHE TYR THR PRO LY 5 PHE GLY GLY GLY LEU GLU 40 VAL GLN GLY 35 VAL GLN PRO AP GLU THR 30 ALA ARG GLU ARG Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 26

27 Insulinanaloga Int. Bezeichnung (Handelsname) Modifizierte Positionen Unterdrückung Hexamerenbildung chnellere Anflutung pritz-ess- Abstand kürzer Basalinsulin (24 h) IEP im Neutralen Wirkungsveränderung Lispro (Humalog ) Aspart (NovoRapid ) Glulisin (Apidra ) Glargin (Lantus) B28Lys-B30Pro (Vertauschung) B28Asp Austausch Pro B3Lys statt Asp B29Glu statt Lys A21Gly statt Asp B31Arg-B32Arg Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 27

28 Exendin-4-Derivate Eine neue Behandlung des Typ 2- Diabetes Exenatid ein synthetisches Abwandlungsprodukt eines Polypeptids (39 A) (GLP-1-Agonist = Glucagon like peptide) ab 2006 im Handel Gila-Krustenechse (im peichel) (Heloderma horridum and Heloderma suspectum) Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 28

29 Glucagon like peptide (GLP)-Wirkmechanismus Insulin Ausschüttung Insulin Biosynthese Glucagon ekretion β-zell-erhaltung Leber Glucose Produktion Magenentleerung Nahrungsaufnahme Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 29

30 GLP-1-Agonisten: Chemie GLP-1-Analoge (Liraglutide, Taspoglutide und CJC-1131) Exendin-Analoge (Exendin-4 = Exenatide und AVE0010) Exendin-4 H2N-HGEGTFTDLKQMEEEAVRLFIEWKNGGGGPGAPPP-NH2 Taspoglutide H2N-HXEGTFTDVYLEGQAAKEFIAWLVKXR-NH2 (X = Aminoisobuttersäure) Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 30

31 Exendin-4-Derivate - Neuer therapeutischer Ansatz Frühstadium Fortgeschrittenes tadium Diät/port Orale Antidiabetika Monotherapie Kombination GLP-1 Agonist Insulin GLP-1-Rezeptoragonisten bilden eventuell eine Brücke zwischen Oralen Antidiabetika und Insulin Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 31

32 chlussbemerkungen (1) In der Biotechnik werden natürliche yntheseleistungen von Mikroorganismen, tierischen und pflanzlichen Zellen zur industriellen Gewinnung von toffen insbesondere Pharmaka genutzt. Ein weiterer Zweig der Biotechnik ist die Gewinnung von Enzymen (Biokatalysatoren) zur schonenden Modifizierung von toffen. Biotechnologische Prozesse nutzen Zellen als chemische Fabrik. olche Prozesse sind äußerst effizient, nachhaltig und hoch innovativ! Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 32

33 chlussbemerkungen (2) In der Gentechnik werden ebenfalls Produkte durch lebende Organismen gewonnen. Im Unterschied zur Biotechnik wird aber im Laufe des Verfahrens DNA isoliert und gezielt verändert. Die modifizierte DNA wird wieder in einen Organismus integriert, um dadurch eine neue Eigenschaft des betreffenden Organismus für eine yntheseleistung nutzen zu können. Die Gentechnik erweitert daher die Möglichkeiten der Biotechnik und eröffnet neue Chancen der Wirkstoffproduktion. Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 33

34 Vielen Dank für Ihre Aufmerksamkeit! Ich danke der Firma anofi-aventis für die Überlassung einiger Abbildungen. Ehlers_Mainz_12Juli Hier wird Wissen Wirklichkeit 34

Insulin Engineering der Wirkdauer

Insulin Engineering der Wirkdauer Insulin Engineering der Wirkdauer Mona Bausch Proteinbiochemie/Proteinengineering 07.07.2015 [1], [2] Insulin und dessen Aufgabe Hormon Produziert in β-zellen der Langerhanß schen Inseln der Bauchspeicheldrüse

Mehr

Humanisierung von Schweine-Insulin

Humanisierung von Schweine-Insulin Humanisierung von Schweine-Insulin Für die Herstellung von Humaninsulin werden zwei Alternativen erwähnt: Die enzymatische Umwandlung von Insulin aus Schweinepankreas, wobei hier darauf hingewiesen wird,

Mehr

Typ 2 Diabetes Einbahnstraße in die Insulinpflicht? Hans Hauner

Typ 2 Diabetes Einbahnstraße in die Insulinpflicht? Hans Hauner Typ 2 Diabetes Einbahnstraße in die Insulinpflicht? Hans Hauner Lehrstuhl für Ernährungsmedizin, KKG Typ 2 Diabetes Technische Universität München Besonderheiten des Typ 2 Diabetes Beim Typ 2 Diabetes

Mehr

STOFFWECHSEL DIABETES MELLITUS 2

STOFFWECHSEL DIABETES MELLITUS 2 Therapieziele und empfohlene Kontrollhäufigkeit Für alle genannten Parameter müssen mit dem Patienten individuelle Zielvorgaben getroffen werden. Von aufgeführten Zielwerten kann im Einzelfall entsprechend

Mehr

Neue Wirkstoffe und Therapieansätze zur Behandlung von Typ-2-Diabetes

Neue Wirkstoffe und Therapieansätze zur Behandlung von Typ-2-Diabetes Neue Wirkstoffe und Therapieansätze zur Behandlung von Typ-2-Diabetes Nürnberg 2015 PD Dr. Michael Hummel Diabetologische SPP Rosenheim & Forschergruppe Diabetes der TU München & Institut für Diabetesforschung

Mehr

Ihre Babenberg-Apotheke informiert: Fachbegriffe zum Thema Diabetes

Ihre Babenberg-Apotheke informiert: Fachbegriffe zum Thema Diabetes Ihre informiert: Fachbegriffe zum Thema Diabetes Acarbose ACE-Hemmer Aceton Albumin Aminosäuren Angina-pectoris-Anfall Angiopathie Arteriosklerose Arzneimittelwirkstoff, der die Verdauung der Kohlenhydrate

Mehr

Neuentwicklungen in der Insulintherapie Auf dem Weg zum perfekten Insulin. abhängig von einem veränderten Blutzuckerwert freigesetzt:

Neuentwicklungen in der Insulintherapie Auf dem Weg zum perfekten Insulin. abhängig von einem veränderten Blutzuckerwert freigesetzt: Auf dem Weg zum perfekten Insulin Seit der Insulin-Entdeckung im Jahr 1921 hat die Insulingabe ihren festen Platz in der Therapie des Typ-1- und des Typ-2-Diabetes. Und seit der Entdeckung gab es niemals

Mehr

Diabetesbehandlung: Simulation am PC

Diabetesbehandlung: Simulation am PC Grundlagen Diabetesbehandlung: Simulation am PC Mit Hilfe eines Computerprogramms soll ein Typ I Diabetiker auf seine speziellen Eßgewohnheiten eingestellt werden. Das Programm bietet die Möglichkeiten,

Mehr

Biologicals Innovationen der besonderen Art. Prof. Dr. Theo Dingermann Institut für Pharmazeutische Biologie JWG-Universität Frankfurt.

Biologicals Innovationen der besonderen Art. Prof. Dr. Theo Dingermann Institut für Pharmazeutische Biologie JWG-Universität Frankfurt. Biologicals Innovationen der besonderen Art Prof. Dr. Theo Dingermann Institut für Pharmazeutische Biologie JWG-Universität Frankfurt Arzneimittel sind Stoffe oder Stoffgemische unterschiedlicher chemischer

Mehr

Matthias Birnstiel. Diabetes. Modul. Medizinisch wissenschaftlicher Lehrgang CHRISANA. Wissenschaftliche Lehrmittel, Medien, Aus- und Weiterbildung

Matthias Birnstiel. Diabetes. Modul. Medizinisch wissenschaftlicher Lehrgang CHRISANA. Wissenschaftliche Lehrmittel, Medien, Aus- und Weiterbildung Matthias Birnstiel Modul Diabetes Medizinisch wissenschaftlicher Lehrgang CHRISANA Wissenschaftliche Lehrmittel, Medien, Aus- und Weiterbildung Inhaltsverzeichnis des Moduls Diabetes Anatomie des Knochengewebes

Mehr

Praktische Diabetologie. BOT orale Therapie mit basaler Insulin-Unterstützung: Wer, wann, was?

Praktische Diabetologie. BOT orale Therapie mit basaler Insulin-Unterstützung: Wer, wann, was? Praktische Diabetologie BOT orale Therapie mit basaler Insulin-Unterstützung: Wer, wann, was? N. Tiling www.stoffwechsel-centrum.de Fallbeispiel 1 72 jähriger Patient + 8 kg / Jahr 89 kg, 1,65 cm, BMI

Mehr

Diabetestherapie Neues und Bewährtes

Diabetestherapie Neues und Bewährtes Diagnose des Diabetes mellitus Diabetestherapie Neues und Bewährtes Dr. med. Vojtech Pavlicek 10. Thurgauer Symposium Innere Medizin Weinfelden 3. September 2015 Test Beurteilung Nüchtern Blutzucker (Plsamaglukose)

Mehr

Honigsüßer Durchfluss

Honigsüßer Durchfluss Honigsüßer Durchfluss Gliederung 1. Volkskrankheit Diabetes 2. Insulin: Türöffner für den Blutzucker 3. Formen des Diabetes mellitus 3.1 Typ-1-Diabetes 3.2 Typ-2-Diabetes 3.3 Gestationsdiabetes 4. Symptomatik

Mehr

Facharbeit LK Biologie der Freiherr-vom-Stein-Schule, Hessisch-Lichtenau. zum Thema:

Facharbeit LK Biologie der Freiherr-vom-Stein-Schule, Hessisch-Lichtenau. zum Thema: Facharbeit LK Biologie der Freiherr-vom-Stein-Schule, Hessisch-Lichtenau zum Thema: Diabetes mellitus: Welche Vor- und Nachteile hat eine Insulintherapie für den Typ 2 Diabetes? von Anna Christina Lohr

Mehr

Behandlung und Therapieformen

Behandlung und Therapieformen Behandlung und Therapieformen In diesem Kapitel möchten wir Sie über den aktuellen Stand der Behandlungsmöglichkeiten informieren. Insulinbehandlung allgemein Insulinbehandlung allgemein Wie bereits beschrieben,

Mehr

WAS IST DIABETES? 1. Zucker - Kraftstoff des Menschen

WAS IST DIABETES? 1. Zucker - Kraftstoff des Menschen WAS IST DIABETES? 1. Zucker - Kraftstoff des Menschen Traubenzucker liefert Energie Bei jedem Menschen ist ständig eine geringe Menge Traubenzucker (Glukose) im Blut gelöst. Dieser Blutzucker ist der Kraftstoff

Mehr

Human Insulin in der Ph.Eur.

Human Insulin in der Ph.Eur. Human Insulin in der Ph.Eur. Das europäische Arzneibuch enthält insgesamt 11 Monographien zum Thema Insuline: Lösliches Insulin als Injektionslösung (6.0/0834) Insulin human (6.0/0838) Insulin vom Rind

Mehr

Süßes Blut Diabetes mellitus Typ 2

Süßes Blut Diabetes mellitus Typ 2 Süßes Blut Diabetes mellitus Typ 2 [ von Dr. Ute Koch ] In Deutschland gibt es acht Millionen Diabetiker, hinzu kommt eine hohe Dunkelziffer. Hauptverantwortlich für diese dramatische Zahl ist der Typ-2-Diabetes:

Mehr

Hausärztliche Fortbildung Referententandem aus Hausarzt und Diabetologe

Hausärztliche Fortbildung Referententandem aus Hausarzt und Diabetologe Hausärztliche Fortbildung Referententandem aus Hausarzt und Diabetologe Insulintherapie bei Typ-2-Diabetes Michael Jecht GK und MVZ Havelhöhe Diabetologie Kladower Damm 221, 14089 Berlin mjecht@t-online.de

Mehr

Moderne Diabetestherapie evidence based medicine oder managed care? Martin Pfohl

Moderne Diabetestherapie evidence based medicine oder managed care? Martin Pfohl Moderne Diabetestherapie evidence based medicine oder managed care? Martin Pfohl Med. Klinik I EVK Bethesda GmbH Duisburg Evidence based medicine Medizinische Entscheidungen aufgrund von evidence ärztlicher

Mehr

Diagnose: Nicht insulinpflichtiger Diabetes Typ 2 mit erhöhten Blutfettwerten (Hypertriglyzeridämie)

Diagnose: Nicht insulinpflichtiger Diabetes Typ 2 mit erhöhten Blutfettwerten (Hypertriglyzeridämie) Diagnose: Nicht insulinpflichtiger Diabetes Typ 2 mit erhöhten Blutfettwerten (Hypertriglyzeridämie) Warum die Stoffwechseloptimierung im Hinblick auf Zucker und Fett so wichtig ist. Information für Patienten

Mehr

Diabetes mellitus. Juliane Briest, Anne Röhrs, Dorota Niezgodka

Diabetes mellitus. Juliane Briest, Anne Röhrs, Dorota Niezgodka Diabetes mellitus Juliane Briest, Anne Röhrs, Dorota Niezgodka Regulation des Blutzuckers Für die Sicherstellung der Versorgung der Körperzellen mit Glukose wird der Blutzuckerspiegel in einem Organismus

Mehr

Einfluss des DMP auf die Antidiabetikaverordnungen

Einfluss des DMP auf die Antidiabetikaverordnungen Einfluss des DMP auf die Antidiabetikaverordnungen Dr. Andrea Wienecke AOK Westfalen Lippe Dr. Gholamreza Pirasteh Dr. Birgit Grave Ute Kirchhof Andreas Heeke 12. Jahrestagung der GAA, 30. Nov. bis 1.Dez.

Mehr

Einsatz neuer Medikamente: GLP1-Analoga & DPP4-Hemmer

Einsatz neuer Medikamente: GLP1-Analoga & DPP4-Hemmer 16. Welt Diabetes Tag an der Charité Einsatz neuer Medikamente: GLP1-Analoga & DPP4-Hemmer Lenka Bosanska Was bedeutet: GLP-1 DPP-4 Hormone des Glucosestoffwechsels Pankreas (Bauchspeicheldrüse) Insulin

Mehr

Foliensatz; Arbeitsblatt; Internet. Je nach chemischem Wissen können die Proteine noch detaillierter besprochen werden.

Foliensatz; Arbeitsblatt; Internet. Je nach chemischem Wissen können die Proteine noch detaillierter besprochen werden. 03 Arbeitsauftrag Arbeitsauftrag Ziel: Anhand des Foliensatzes soll die Bildung und der Aufbau des Proteinhormons Insulin erklärt werden. Danach soll kurz erklärt werden, wie man künstlich Insulin herstellt.

Mehr

Bewährte Medikamente neu betrachtet

Bewährte Medikamente neu betrachtet Bewährte Medikamente neu betrachtet Prim. Univ.-Prof. Dr. Bernhard Ludvik 1.Medizinische Abteilung mit Diabetologie, Endokrinologie und Department für Nephrologie Krankenanstalt Rudolfstiftung Zur Diabetes

Mehr

Management von Diabetes mellitus

Management von Diabetes mellitus Management von Diabetes mellitus Dr. Petra Sandow 1 2 3 4 Management von Diabetes Mellitus TdA Berlin 6.09.14 1 5 6 2014? 7 8 Management von Diabetes Mellitus TdA Berlin 6.09.14 2 Prävalenz des Metabolischen

Mehr

Appetit... Essen... sich wohler fühlen. Diabetes mellitus. Ein paar grundlegende Gedanken. Was ist Diabetes mellitus? Was ist die Ursache?

Appetit... Essen... sich wohler fühlen. Diabetes mellitus. Ein paar grundlegende Gedanken. Was ist Diabetes mellitus? Was ist die Ursache? Diabetes mellitus Appetit... Essen... sich wohler fühlen Diabetes mellitus Ein paar grundlegende Gedanken Das Wort Diabetes mellitus kommt aus dem Griechischen und bedeutet honigsüßer Durchfluss. Das heißt,

Mehr

Identifizierung und Bestimmung von Humaninsulin, synthetischen. Insulinanalogen, Humanplasma zu Dopingkontrollzwecken

Identifizierung und Bestimmung von Humaninsulin, synthetischen. Insulinanalogen, Humanplasma zu Dopingkontrollzwecken Identifizierung und Bestimmung von Humaninsulin, synthetischen Insulinanalogen, deren Abbauprodukten und C-Peptid in Humanurin und Humanplasma zu Dopingkontrollzwecken mittels Flüssigkeitschromatographie

Mehr

Diagnostik und Therapie des Diabetes mellitus Typ 2

Diagnostik und Therapie des Diabetes mellitus Typ 2 S. Fischer, K. Schmidt-Göhrich, M. Verlohren, J. Schulze Diagnostik und Therapie des Diabetes mellitus Typ 2 TU Dresden Medizinische Fakultät III. Medizinische Klinik Zusammenfassung In den nächsten Jahren

Mehr

Diabetes Mellitus - Zuckerkrankheit Ihre Gesundheit - Unser Thema ist ein Service Ihrer niedergelassenen Ärzte und Psychotherapeuten in Bayern

Diabetes Mellitus - Zuckerkrankheit Ihre Gesundheit - Unser Thema ist ein Service Ihrer niedergelassenen Ärzte und Psychotherapeuten in Bayern Patienteninformation Diabetes Mellitus - Zuckerkrankheit Ihre Gesundheit - Unser Thema ist ein Service Ihrer niedergelassenen Ärzte und Psychotherapeuten in Bayern Mehr als sechs Millionen Menschen leiden

Mehr

Insulin aus den Langerhansschen Inseln

Insulin aus den Langerhansschen Inseln Insulin Themen Insulinproduktion Insulinsekretion Insulinsorten Wirkprofile Lagerung und Anwendung von Insulinen Insulintherapieformen Pause und praktische Übung Insulindosisanpassung (BE, BE-Faktor, 30

Mehr

MOL.504 Analyse von DNA- und Proteinsequenzen

MOL.504 Analyse von DNA- und Proteinsequenzen MOL.504 Analyse von DNA- und Proteinsequenzen Kurs 1 Monika Oberer, Karl Gruber MOL.504 Modul-Übersicht Einführung, Datenbanken BLAST-Suche, Sequenzalignment Proteinstrukturen Virtuelles Klonieren Abschlusstest

Mehr

Diabetes (Zuckerkrankheit)

Diabetes (Zuckerkrankheit) arztpraxis limmatplatz Definition... 2 Häufigkeit... 2 Krankheitsursachen... 2 Typ-I- und Typ-II-Diabetes... 2 Typ-I-Diabetes (= IDDM Insulin dependent diabetes mellitus)... 2 Typ-II-Diabetes (NIDDM =

Mehr

Neue Therapiemöglichkeit: Hemmung der Zuckerwiederaufnahme im Urin

Neue Therapiemöglichkeit: Hemmung der Zuckerwiederaufnahme im Urin Neue Therapiemöglichkeit: Hemmung der Zuckerwiederaufnahme im Urin Uta Berndt November 2014 Welt-Diabetes-Tag Berlin 1 Krankheitsmechanismus Diabetes mellitus Typ 2 verminderte Insulinwirkung am Insulinrezeptor

Mehr

Pharmakotherapie des Diabetes mellitus Typ 2 SS 2010

Pharmakotherapie des Diabetes mellitus Typ 2 SS 2010 Pharmakotherapie des Diabetes mellitus Typ 2 SS 2010 Diabetes mellitus Typ 1 (juvenil) absoluter Insulinmangel infolge Zerstörung pankreatischer B- Zellen Katabole Stoffwechsellage, autoimmune Pathogenese

Mehr

Pharmakologie der Blutzuckerregulation Insulin 1.) Chemie >

Pharmakologie der Blutzuckerregulation Insulin 1.) Chemie > Pharmakologie der Blutzuckerregulation Autor: C. Nanoff Institut für Pharmakologie, Medizinische Universität Wien (siehe Freissmuth, Offermanns, Böhm, Pharmakologie & Toxikologie Kapitel 54, S. 602-622)

Mehr

Diabetes kompakt für die Hausarztpraxis

Diabetes kompakt für die Hausarztpraxis Diabetes kompakt für die Hausarztpraxis Deutscher Diabetes Kongress, Berlin, 16. Mai 2015 In Kooperation von Start mit Insulin Wann starte ich mit Insulin? Wie starte ich mit Insulin? Welches Insulin sollte

Mehr

3.7 Diabetesmittel (orale Antidiabetika)

3.7 Diabetesmittel (orale Antidiabetika) 60 3.7 Diabetesmittel (orale Antidiabetika) Volkskrankheit Diabetes: die größte Belastung unseres Gesundheitssystems Weltweit hat die Zahl der Diabetes-Erkrankungen in den letzten Jahren in alarmierender

Mehr

Diabetes mellitus Typ 2 - update. Christoph Henzen

Diabetes mellitus Typ 2 - update. Christoph Henzen Diabetes mellitus Typ 2 - update Christoph Henzen 1. Epidemiologie des Typ 2 Diabetes 2. Pathophysiologische Grundlagen 3. Therapie des Typ 2 Diabetes 3a) Lifestyle - Adipositas 3b) alte Antidiabetika

Mehr

Zucker macht das Leben sauer

Zucker macht das Leben sauer Diabetes Zucker macht das Leben sauer Stefanie Döhr Foto: van den Heuvel Fast vier Millionen Menschen in Deutschland leiden an Diabetes. Die Volkskrankheit bringt nicht nur drastische Einschränkungen für

Mehr

Ein besseres Leben mit Diabetes Typ 2

Ein besseres Leben mit Diabetes Typ 2 Ein besseres Leben mit Diabetes Typ 2 Informationsmaterial für Menschen mit Diabetes Typ 2 31-MAR-2012 Jan-2009-BE-2041-BT Was ist Diabetes Typ 2 - Zuckerkrankheit? Bei Diabetes Typ 2 ist zu viel Glukose

Mehr

Therapie des Metabolischen Syndroms und des Typ-2 Diabetes

Therapie des Metabolischen Syndroms und des Typ-2 Diabetes Therapie des Metabolischen Syndroms und des Typ-2 Diabetes Pathogenese des Diabetes Typ 2 Therapieformen Insulinotrop: Glinide, Insulin, Sufonylharnstoffe, Glp-1 Agonisten, DPP-4 Hemmer Nicht-insulinotrop

Mehr

Fallvorstellung. Station A5 Ost

Fallvorstellung. Station A5 Ost Fallvorstellung Station A5 Ost P.W., 0 Jahre alt Männlich Größe 180cm, Gewicht 87 kg, BMI,9 kg/m Symptome: häufiges Wasserlassen sowie Polydipsie, Leistungsminderung, Schwäche und eine Gewichtsabnahme

Mehr

Der Diabetes mellitus Typ 2 ist eine

Der Diabetes mellitus Typ 2 ist eine Nationale Versorgungsleitlinien Neue Aspekte zur Therapie des Typ 2 Diabetes mellitus Von Axel Haupt, Hans-Ulrich Häring und Stephan Matthaei Die Therapieoptionen beim Typ 2 Diabetes sind in den letzten

Mehr

Diabetologie für Dummies. Cora Kube Ärztin f. Allgemeinmedizin, Diabetologie u. Notfallmedizin

Diabetologie für Dummies. Cora Kube Ärztin f. Allgemeinmedizin, Diabetologie u. Notfallmedizin Diabetologie für Dummies Cora Kube Ärztin f. Allgemeinmedizin, Diabetologie u. Notfallmedizin Themen Wie diagnostiziere ich einen Diabetes mellitus? Therapiebeginn beim Diabetes mellitus Typ 2 Therapieziele

Mehr

Besondere Aspekte in der Behandlung dialysepflichtiger Diabetespatienten Dr. Josef Zimmermann Fulda, 29.10.2006

Besondere Aspekte in der Behandlung dialysepflichtiger Diabetespatienten Dr. Josef Zimmermann Fulda, 29.10.2006 Besondere Aspekte in der Behandlung dialysepflichtiger Diabetespatienten Dr. Josef Zimmermann Fulda, 29.10.2006 Epidemiologie Komorbiditätbei terminal niereninsuffizienten Diabetespatienten Diabetestherapie

Mehr

CAMPUS INNENSTADT Diabetes Zentrum Diabetes bei Herzpatienten Gibt es therapeutische Besonderheiten? Jochen Seißler Ludwig-Maximilians-Universität München Pathophysiologie des metabolischen Syndroms Koagulopathie

Mehr

Aminosäurebestimmung im Kochschinken

Aminosäurebestimmung im Kochschinken 1. Gegenstand der Untersuchung Es wurden 4 verschiedene Kochschinken eines Discounters hinsichtlich deren Gehalt an freien und NPN-gebundenen sowie möglichen Zusätzen untersucht. Darüber hinaus dienen

Mehr

Diabetes mellitus. Risikofaktor

Diabetes mellitus. Risikofaktor Rotenburg, den 25.05.2011 3. Kardio-diabetologisches Gespräch im HKZ Rotenburg/Fulda Diabetes mellitus = Kardiovaskulärer Risikofaktor Klaus Edel Herz- und Kreislaufzentrum 36199 Rotenburg a. d. Fulda

Mehr

25.04.2013. Was muss man bei Typ 1 Diabetes ersetzen? Diabetes mellitus Typ 1 Behandlung aus Sicht des Diabetologen. Insulinsekretion in der Betazelle

25.04.2013. Was muss man bei Typ 1 Diabetes ersetzen? Diabetes mellitus Typ 1 Behandlung aus Sicht des Diabetologen. Insulinsekretion in der Betazelle 2. Ernährungssymposium: Klinische Ernährung 25. April, Universitätsspital Zürich Was muss man bei Typ 1 Diabetes ersetzen? Diabetes mellitus Typ 1 Behandlung aus Sicht des Diabetologen Roger Lehmann Klinik

Mehr

INFORMATIONEN FÜR TYP-2-DIABETIKER. Warum der HbA 1c -Wert für Sie als Typ-2-Diabetiker so wichtig ist!

INFORMATIONEN FÜR TYP-2-DIABETIKER. Warum der HbA 1c -Wert für Sie als Typ-2-Diabetiker so wichtig ist! INFORMATIONEN FÜR TYP-2-DIABETIKER Warum der HbA 1c -Wert für Sie als Typ-2-Diabetiker so wichtig ist! Liebe Leserin, lieber Leser, Wer kennt das nicht: Kurz vor dem nächsten Arztbesuch hält man sich besonders

Mehr

BAnz AT 11.11.2014 B1. Beschluss

BAnz AT 11.11.2014 B1. Beschluss Beschluss des Gemeinsamen Bundesausschusses über eine Änderung der Arzneimittel-Richtlinie (AM-RL): Anlage XII - Beschlüsse über die Nutzenbewertung von Arzneimitteln mit neuen Wirkstoffen nach 35a SGB

Mehr

Schulungsprogramm für Typ 2-Diabetiker, die nicht Insulin spritzen

Schulungsprogramm für Typ 2-Diabetiker, die nicht Insulin spritzen Anlage 12: Schulungsprogramme Diabetes Typ 2 zu dem Vertrag nach 73a SGB V über ein strukturiertes Behandlungsprogramm (DMP) zur Verbesserung der Qualität der Versorgung von Typ 2 Diabetikern zwischen

Mehr

Basiswissen Skript 2013

Basiswissen Skript 2013 Leitliniengerechte Behandlung am Beispiel des Metabolischen Syndroms Basiswissen Skript 2013 von Dr. Hans-Jörg Hellmuth Inhalt Definition EBM evidence based medicine mit Beispiel Bewertung oraler Antidiabetika

Mehr

Zürcher Unterländer Symposium Diabetes mellitus: Fallbeispiele. Dr. A. Bühler Leitende Aerztin Endokrinologie/Diabetologie Spital Bülach

Zürcher Unterländer Symposium Diabetes mellitus: Fallbeispiele. Dr. A. Bühler Leitende Aerztin Endokrinologie/Diabetologie Spital Bülach Zürcher Unterländer Symposium Diabetes mellitus: Fallbeispiele Dr. A. Bühler Leitende Aerztin Endokrinologie/Diabetologie Spital Bülach Fall 1 52-jähriger Patient mit Diabetes mellitus Typ 2, ED 2007 Status:

Mehr

Insulin. biologische, physiologische und medizinische Grundlagen. Diabetes mellitus. Adrian Schuster

Insulin. biologische, physiologische und medizinische Grundlagen. Diabetes mellitus. Adrian Schuster Insulin biologische, physiologische und medizinische Grundlagen Diabetes mellitus Adrian Schuster Inhaltsübersicht Allgemeines - Geschichte - Insulinproduktion - chemischer Aufbau - Insulinrezeptor - Wirkmechanismen

Mehr

Diabetes mellitus - Zuckerkrankheit

Diabetes mellitus - Zuckerkrankheit Diabetes mellitus - Zuckerkrankheit Definition: Diabetes ist eine chronisch verlaufende Stoffwechselkrankheit, bei der ein absoluter oder relativer Insulinmangel besteht, der zu einer dauerhaften Erhöhung

Mehr

Diabetes nach Pankreatektomie

Diabetes nach Pankreatektomie Diabetes nach Pankreatektomie Jahrestagung Arbeitskreis der Pankreaktektomierten in Nürnberg am 18.09.2004 Dr. med. Ingrid Riedner-Walter, Praxis für Endokrinologie, Karolinenstr. 1, 90402 Nürnberg Der

Mehr

Diabetes. an Magnesiummangel denken!

Diabetes. an Magnesiummangel denken! Diabetes an Magnesiummangel denken! Etwa 8 Millionen Menschen in Deutschland sind Diabetiker. Neben einer erblichen Veranlagung sind einige Schlüsselfaktoren für die Entstehung des Diabetes mellitus Typ

Mehr

Diabetes mellitus Eine praktische Betrachtung

Diabetes mellitus Eine praktische Betrachtung Diabetes mellitus Eine praktische Betrachtung Dr. med. Daniel Beutler Praxisgemeinschaft am Mühlebach Bahnhofstrasse 50 3127 Mühlethurnen dan.beutler@hin.ch Diabetes mellitus Woher kommt der Name? der

Mehr

Diabetes mellitus Typ 2 und Sport am Beispiel Nordic Walking. Teil 1 - Grundlagen

Diabetes mellitus Typ 2 und Sport am Beispiel Nordic Walking. Teil 1 - Grundlagen Diabetes mellitus Typ 2 und Sport am Beispiel Nordic Walking Teil 1 - Grundlagen Fachliche Bearbeitung: A. Bachmann, Diabetes Zentrum Klinikum Innenstadt, München A. Wörle, DSV Bundeslehrteam Nordic Diabetes

Mehr

Orale Therapie Alternativen und deren Indikationen aus Sicht der DDG

Orale Therapie Alternativen und deren Indikationen aus Sicht der DDG Orale Therapie Alternativen und deren Indikationen aus Sicht der DDG Hans Martin Reuter,Jena Diabetes kompakt für die Hausarztpraxis Deutscher Diabetes Kongress, Berlin, 16. Mai 2015 In Kooperation von

Mehr

T A B E L L E I C T PAT_NR AUF_DAT NAME PATIENTENIDENTIFIKATIONSNUMMER UNTERSUCHUNGSDATUMDES PATIENTEN NACHNAME DES PATIENTEN. DPV ict Version: 5.

T A B E L L E I C T PAT_NR AUF_DAT NAME PATIENTENIDENTIFIKATIONSNUMMER UNTERSUCHUNGSDATUMDES PATIENTEN NACHNAME DES PATIENTEN. DPV ict Version: 5. T A B E L L E I C T PAT_NR Beispiel: 1 51 125 PATIENTENIDENTIFIKATIONSNUMMER Die Zuweisung des Wertes erfolgt durch das Programm. Datentyp: numerisch keine Nachkommastellen Fremdschlüssel! AUF_DAT Beispiel:

Mehr

Geschichte der Diabetologie

Geschichte der Diabetologie Geschichte der Diabetologie Zum besseren VerstÄndnis wird die Geschichte tabellarisch dargestellt. Die Geschichte des Insulins und der InsulinprÄparate ist ein wichtiger Teil der Medizingeschichte, nicht

Mehr

Labortests für Ihre Gesundheit. Volkskrankheit Diabetes 32

Labortests für Ihre Gesundheit. Volkskrankheit Diabetes 32 Labortests für Ihre Gesundheit Volkskrankheit Diabetes 32 01IPF Labortests für Ihre Gesundheit Volkskrankheit Diabetes Das sollten Sie wissen Sechs Millionen Menschen in Deutschland haben Diabetes Tendenz

Mehr

Woher «wissen» Hormonen, wo und wie sie wirken müssen?

Woher «wissen» Hormonen, wo und wie sie wirken müssen? MATERIAL 1 Woher «wissen» Hormonen, wo und wie sie wirken müssen? Finde heraus, woher Hormone «wissen», wo und wie sie wirken sollen. Benutze dazu die Abbildungen und den Text. Diskutiere die Ergebnisse

Mehr

CME - Fortbildung. Insulintherapie bei älteren Menschen - Therapiestrategien & Fallbeispiele. Dr. med. Michael Eckhard. Dr. med.

CME - Fortbildung. Insulintherapie bei älteren Menschen - Therapiestrategien & Fallbeispiele. Dr. med. Michael Eckhard. Dr. med. CME - Fortbildung Insulintherapie bei älteren Menschen - Therapiestrategien & Fallbeispiele Dr. med. Jörn Kuntsche CA der Klinik für Geriatrie Bürgerhospital Friedberg und Diabeteszentrum Mittelhessen

Mehr

Diabetes. Katharina Schumacher 15.11.2000

Diabetes. Katharina Schumacher 15.11.2000 Diabetes Katharina Schumacher 15.11.2000 Inhaltsverzeichnis 1 Was ist Diabetes? 2 1.1 Wie bekomme ich Diabetes?........................... 2 1.2 Wie kann man Diabetes erkennen?........................

Mehr

Kann man dem Diabetes davonlaufen?

Kann man dem Diabetes davonlaufen? Kann man dem Diabetes davonlaufen? Dr. med. A. Witzel Internist/Kardiologe/Diabetologe(DDG) Med. Reha-Einrichtungen der Stadt Radolfzell Mettnau-Kur - Diabetes mellitus Es gibt eine Vielzahl verschiedener

Mehr

Antihyperglykämische Therapie des TYP 2 DIABETES

Antihyperglykämische Therapie des TYP 2 DIABETES Antihyperglykämische Therapie des TYP 2 DIABETES f.stradner 26.06.2014 Übersicht 1) Diabetes mellitus Typ 2 2) Antidiabetisches Repertoire 3) Empfehlungen zur antihyperglykämischen Therapie des T2DM Diabetes

Mehr

Workshop Diabetes: Tipps für die Praxis

Workshop Diabetes: Tipps für die Praxis Workshop Diabetes: Tipps für die Praxis Peter Diem Endokrinologie, Diabetologie und Klin. Ernährung Inselspital - Bern Steroide und Diabetes 1. Vor Steroidtherapie kein DM 2. DM 2 mit OAD 3. DM 2 mit Insulin

Mehr

Diabetes und Ernährung von A Z. Wissenswertes auf den Punkt gebracht

Diabetes und Ernährung von A Z. Wissenswertes auf den Punkt gebracht Diabetes und Ernährung von A Z Wissenswertes auf den Punkt gebracht Anschrift der Verfasserin: Gabi Weigl Med. Ernährungsberaterin, Diabetesberaterin DDG Krankenhaus Altdorf Diabetesberatung Neumarkter

Mehr

F a c h a r b e i t. Celtis-Gymnasium Kollegstufe 2003/2005. Diabetes Behandlungsmöglichkeiten früher und heute im Vergleich

F a c h a r b e i t. Celtis-Gymnasium Kollegstufe 2003/2005. Diabetes Behandlungsmöglichkeiten früher und heute im Vergleich 1 Celtis-Gymnasium Kollegstufe 2003/2005 Schweinfurt Leistungskurs: Biologie F a c h a r b e i t Diabetes Behandlungsmöglichkeiten früher und heute im Vergleich Verfasserin: Lisa Mohr Tag der Ablieferung:

Mehr

DIABETES NEUE THERAPIEMÖGLICHKEITEN

DIABETES NEUE THERAPIEMÖGLICHKEITEN DIABETES NEUE THERAPIEMÖGLICHKEITEN PROF. DR. BERND SCHULTES eswiss Medical & Surgical Center, St. Gallen DIABETES MELLITUS Dr. med. C. Strey Prof. Dr. med. B. Schultes Typ 1 Typ 2 Defekt Insulinausschüttung

Mehr

WAS ES IST UND WIE ES VERWENDET WIRD

WAS ES IST UND WIE ES VERWENDET WIRD Insulin-ABC WAS ES IST UND WIE ES VERWENDET WIRD L ABC dell insulina Lilly Warum muss ich Insulin spritzen? In den meisten Fällen wird Typ-2-Diabetes neben einer richtigen Ernährung und sportlicher Betätigung

Mehr

1. Allgemeine Grundlagen. Impressum. Diese Schulungsfolien wurden in Kooperation von folgenden Personen erstellt: 1.1. Was ist Diabetes?

1. Allgemeine Grundlagen. Impressum. Diese Schulungsfolien wurden in Kooperation von folgenden Personen erstellt: 1.1. Was ist Diabetes? Impressum Diese Schulungsfolien wurden in Kooperation von folgenden Personen erstellt: Anita Gräll, Diätologin Hanusch Krankenhaus, Elisabeth Zirnwald, Diätologin GZ Wien Mitte Christoph Feichtinger, Diabetesberater

Mehr

Bei Patienten mit Diabetes mellitus

Bei Patienten mit Diabetes mellitus MMW-Fortschritte der Medizin Originalien Nr. III/26 (148. Jg.), S. 133 137 Zusätzliche Gabe eines schnell wirksamen Insulinanalogons Übergang von einer basal unterstützten oralen Therapie (BOT) zur intensivierten

Mehr

Kurzlehrbuch Pharmakologie und Toxikologie

Kurzlehrbuch Pharmakologie und Toxikologie KURZLEHRBUCH Kurzlehrbuch Pharmakologie und Toxikologie von Thomas Herdegen, Ruwen Böhm, Nuray Cimin-Bredée, Juraj Culman 1. Auflage Kurzlehrbuch Pharmakologie und Toxikologie Herdegen / Böhm / Cimin-Bredée

Mehr

Adipositas (Fettsucht)

Adipositas (Fettsucht) Adipositas (Fettsucht) Die Adipositas wurde lange Zeit nicht als Krankheit anerkannt. Heute ist erwiesen, dass dem so ist und dass die Vererbung eine wichtige Rolle spielt. Das Ausmass des Übergewichts

Mehr

Klaus Badenhoop. M. Addison und Diabetes mellitus

Klaus Badenhoop. M. Addison und Diabetes mellitus Klaus Badenhoop M. Addison und Diabetes mellitus Substitution mit Insulin und Hydrocortison (HC) Interaktion von Insulin and Cortisol: 100mg HC (A) vs. Placebo (B) HC erhöht den Blutzucker durch Hemmung

Mehr

1. Zusatznutzen des Arzneimittels im Verhältnis zur zweckmäßigen Vergleichstherapie

1. Zusatznutzen des Arzneimittels im Verhältnis zur zweckmäßigen Vergleichstherapie Beschluss des Gemeinsamen Bundesausschusses über eine Änderung der Arzneimittel-Richtlinie (AM-RL): Anlage XII - Beschlüsse über die Nutzenbewertung von Arzneimitteln mit neuen Wirkstoffen nach 35a SGB

Mehr

Insulin und Diabetes mellitus Typ 2

Insulin und Diabetes mellitus Typ 2 2009 by Verlag Hans Huber, Hogrefe AG, Bern Therapeutische Umschau 2009; DOI 10.1024/0040-5930.66.10.685 685 1Universitätspoliklinik für Endokrinologie, Diabetologie und Klinische Ernährung, Inselspital,

Mehr

Galaktose-Wirkung bei der Zuckerkrankheit (Diabetes mellitus Typ 2)

Galaktose-Wirkung bei der Zuckerkrankheit (Diabetes mellitus Typ 2) Galaktose-Wirkung bei der Zuckerkrankheit (Diabetes mellitus Typ 2) Es gibt vier verschiedene Arten von Zuckerkrankheiten: 1. Diabetes mellitus Typ 1: Zerstörung der ß-Zellen des Pankreas, daher keine

Mehr

Diabetes Mellitus. Diabetes Mellitus. Chronisches Nierenversagen. Chronic kidney disease chapter 4

Diabetes Mellitus. Diabetes Mellitus. Chronisches Nierenversagen. Chronic kidney disease chapter 4 Chronisches Nierenversagen Chronic kidney disease chapter 4 (Zuckerkrankheit) ist eine Gruppe von Stoffwechselstörungen, die verschiedene Organe und Gewebe schädigen. Dafür typisch ist ein erhöhter Spiegel

Mehr

Diabetes mellitus: Frühes Eingreifen verhindert Folgeerkrankungen

Diabetes mellitus: Frühes Eingreifen verhindert Folgeerkrankungen Diabetes Diabetes mellitus: Frühes Eingreifen verhindert Folgeerkrankungen 60 Arg Lys Gln Pro Pro C-Peptid Ile Val H 2 N Gln Val Asn Gln His er Val er Gln Asn Asn 50 Pro Thr 30 Pro 40 Lys Val Gln Pro Val

Mehr

Christian Ciardi Univ. Klinik für Innere Medizin I Gastroenterologie, Endokrinologie und Stoffwechsel Innsbruck

Christian Ciardi Univ. Klinik für Innere Medizin I Gastroenterologie, Endokrinologie und Stoffwechsel Innsbruck Arataeus von Kappadokien 100 n Christus Honigsüßer Diabetes διαβήτης mellitus Durchfluss Christian Ciardi Univ. Klinik für Innere Medizin I Gastroenterologie, Endokrinologie und Stoffwechsel Innsbruck

Mehr

Diabetes nach Transplantation: Was jeder Patient wissen sollte

Diabetes nach Transplantation: Was jeder Patient wissen sollte Diabetes nach Transplantation: Was jeder Patient wissen sollte Was ist Diabetes mellitus? Diabetes mellitus ist eine Erkrankung, welche auf die Produktion und Verstoffwechslung des Hormons Insulin Einfluss

Mehr

Insulin - ab wann und wie soll begonnen werden? Gibt es Unterschiede? Ingrid Schütz-Fuhrmann, KH-Hietzing, 3. Medizinische Abteilung

Insulin - ab wann und wie soll begonnen werden? Gibt es Unterschiede? Ingrid Schütz-Fuhrmann, KH-Hietzing, 3. Medizinische Abteilung Insulin - ab wann und wie soll begonnen werden? Gibt es Unterschiede? Ingrid Schütz-Fuhrmann, KH-Hietzing, 3. Medizinische Abteilung OFFENLEGUNG Von folgenden Pharmafirmen erhielt ich Forschungsunterstützungen,

Mehr

DIABETES MELLITUS 24.01.2009. Dr.med. Benno Weissenberger

DIABETES MELLITUS 24.01.2009. Dr.med. Benno Weissenberger 1 DIABETES MELLITUS Dr.med. Benno Weissenberger 2 DIABETES MELLITUS 1. Grundlagen 2. Klinische Bilder 3. Folgekrankheiten 4. Therapie 5. Rehabilitationsprogramm 3 Asklepios Eine Ziege zog den Gott auf

Mehr

ACCORD-STUDIE: Neue Erkenntnisse zur Herz-Kreislauf-Prävention

ACCORD-STUDIE: Neue Erkenntnisse zur Herz-Kreislauf-Prävention ACCORD-STUDIE: Neue Erkenntnisse zur Herz-Kreislauf-Prävention Durch die weltweite Zunahme des Diabetes mellitus (Typ 2) gewinnt auch die Prävention von kardiovaskulären Erkrankungen bei den Betroffenen

Mehr

Die prandiale Insulintherapie

Die prandiale Insulintherapie Kurzwirksame Insuline in der Therapie des Diabetes mellitus Typ-2 ILDUNG CME-FORTBILDUNG CME-FO FORTBILD ZERTIFIZIERTE WEITERBILDUNG ZERT R IF 3 CME-Punkte FIZIERT Modul 1 R E WEITERBIL LDUNG 2 7 13 19

Mehr

Orale Antidiabetika zur Behandlung des Typ-2-Diabetes

Orale Antidiabetika zur Behandlung des Typ-2-Diabetes Orale Antidiabetika zur Behandlung des Typ-2-Diabetes PD Dr. med. habil. Rainer Lundershausen Diabetologische Schwerpunktpraxis Erfurt Median Ilmtalklinik Bad Berka VNR: 2760909004828340019 Gültigkeitsdauer:

Mehr

Bericht über den Workshop der Paul-Martini-Stiftung (PMS) am 9. April 2014 in Berlin

Bericht über den Workshop der Paul-Martini-Stiftung (PMS) am 9. April 2014 in Berlin Bericht über den Workshop der Paul-Martini-Stiftung (PMS) am 9. April 2014 in Berlin Medikamentöse Diabetes Typ 2-Therapie in Deutschland quo vadis? Prof. Dr. Torsten Strohmeyer, Sprecher des Vorstandes

Mehr

Der normale Blutzuckerwert liegt zwischen 80 und 120 mg%

Der normale Blutzuckerwert liegt zwischen 80 und 120 mg% Monika Graspeuntner Diabetes mellitus (= Zuckerkrankheit) Anatomie: Die Bauchspeicheldrüse = Pankreas Die Bauchspeicheldrüse liegt in Höhe des 1. + 2. Lendenwirbels hinter dem Bauchfell (retroperitoneal).

Mehr

Insulin. Der Weg zum ersten rekombinanten Wirkstoff. Deutsche Version. ELLS European Learning Laboratory for the Life Sciences

Insulin. Der Weg zum ersten rekombinanten Wirkstoff. Deutsche Version. ELLS European Learning Laboratory for the Life Sciences Der Weg zum ersten rekombinanten Wirkstoff Rossana De Lorenzi Christina Gritti Insulin Deutsche Version ELLS European Learning Laboratory for the Life Sciences Rossana De Lorenzi und Christina Gritti Der

Mehr

Diabetes und Herzsport. Bettina Klöpper

Diabetes und Herzsport. Bettina Klöpper Diabetes und Herzsport Bettina Klöpper März 2015 Ziele des Sports bei Diabetes mellitus Typ 2 - Steigerung des Wohlbefindens - Steigerung der positiven Selbstwahrnehmung - Verbesserte soziale Integration

Mehr

Bedeutung von Zellkulturen für f die industrielle Biotechnologie. Dr. Christine Rascher-Bang 06. Dezember 2011

Bedeutung von Zellkulturen für f die industrielle Biotechnologie. Dr. Christine Rascher-Bang 06. Dezember 2011 Bedeutung von Zellkulturen für f die industrielle Biotechnologie Der ABAS im Dialog mit der industriellen Biotechnologie Dr. Christine Rascher-Bang 06. Dezember 2011 Zellkulturen. sind in den letzten Jahrzehnten

Mehr

Aktuelle Versorgungsstrukturen bei Diabetes mellitus

Aktuelle Versorgungsstrukturen bei Diabetes mellitus Zentralinstitut für die Kassenärztliche Versorgung in Deutschland Aktuelle Versorgungsstrukturen bei Diabetes mellitus Befunde aus dem DMP Diabetes mellitus Typ 2 in der Region Nordrhein Bernd Hagen DMP-Projektbüro

Mehr