Institut für Forstzoologie und Waldschutz Universität Göttingen, Deutschland

Größe: px
Ab Seite anzeigen:

Download "Institut für Forstzoologie und Waldschutz Universität Göttingen, Deutschland"

Transkript

1 Institut für Forstzoologie und Waldschutz Universität Göttingen, Deutschland Bozen, Geruchssinn der Insekten: von ökologischen Interaktionen zu molekularen Aspekten Dr. Sergio Angeli Trompete (Ger.), trumpet (Eng.), tromba (It), = from ld High Germanic Trumba Wasser (Ger.), water (Eng.), acqua (It) Aqua dest - Destilliertes Wasser Kneipe (Ger.), pub (Eng.), bar (It.) Kneipe = from Latin cauponula (= capanna, It) Prost (Ger.), cheers (Eng.), evviva (It.) Prost = from Latin prosit (= for your benefit) 1

2 Kartoffel (Ger.), Potato (Eng.), Patata (It.) wild types till 1960 In 1565: potatoes were sent to the Spanish King Italy: tartufolo (It.) (Trüffel, truffle) Germany first: Tartuffel Germany later: Kartoffel today Wechselwirkung Pflanze-Pathogen Pathogen Talking Trees und Crying for help Warum Insektengeruchssinn? Duftkodierung der Insekten Insekten: Perirezeptor-Ereignisse und Zentrale Prozesse dorant Binding Proteins (BPs) und Chemosensory Proteins (CSPs) Insektenantennen als Biosensoren 2

3 Pflanzen ChemoÖkologische Antworten Schadinsekten Prädatoren /Parasitoide Talking Trees (Sprechende Bäume) Crying for help (Hilferufe) Talking Trees Baldwins Experiment Verletzte Pflanzen Versuchspflanzen VCs Luft Kontrollpflanzen Phenole erhöht in verletzten Pflanzen und Kontrollpflanzen. Populus und Acer zeigen den gleichen Effekt. Baldwin I.T. and. Schultz. J.C Rapid changes in tree leaf chemistry induced by damage: evidence for communication between plants. Science 221:

4 Planzliche Signale Lokal Systemisch Talking Trees Planzliche Reaktion auf Befall mit Pathogenen und Schädlingen Verletzte Tomatenblätter synthetisieren PRSYSTEMIN (200 aa) Prosystemin wird verarbeitet zu SYSTEMIN (= 18 aa) Systemin wird im verletzten Blatt freigesetzt und durch das Pholem transportiert. In Zielzellen bindet Systemin vermutlich an Stellen der Plasmamembran und bewirkt die Biosynthese von JASMNSÄURE (=C12) Ruiz-Medrano et al., 2001, Cur pi Plant Biol 4, ; Scheer et al., 2002, PNAS, 99,

5 Jasmonsäure Hat eine zentrale Rolle in der Regulierung der systemischen Pflanzenabwehr bei nahezu allen Pflanzenarten It is an elicitor-inducer, entsteht über Abbau von C18- Fettsäuren (Linolensäure und Linolsäure) in: - C6-Verbindungen wie Grünblattgerüche (VCs), z.b. (Z)-3-Hexenal, Hexanal, (Z)-3-Hexenol, (Z)-3-Hexenylacetat -eine C12-Verbindung, genannt Traumatin oder Wundhormon, das interne Abwehrfunktionen aktiviert Zheng et al Plant Physiology 41(4): ; Engelberth et al., 2004 PNAS 101(6): Crying for help Bei Befall durch herbivore Insekten emittieren Pflanzen Düfte, die Parasitoide oder Prädators anlocken. Diese Chemikalien werden induzierte Synomone genannt. Tabakpflanzen emittieren bei Nacht Duftstoffe, die nachtaktive Falter auf der Suche nach Eiablageplätzen abschrecken. Ryan C.A Nature, 410 (29):

6 !!"#$ Diabrotica virgifera 6

7 β-caryop. Untergrund-lfaktometer Here we report the first identification of an insect-induced belowground plant signal, (E)-β-caryophyllene, which strongly attracts an entomopathogenic nematode. Turlings group, 2005 «Recruitment of entomopathogenic nematodes by insect-damaged maize roots» Nature 434: von Schwerdtfeger F.,

8 %& '### # ( ) $ *!! " # $ %& ' (! 8

9 Warum Insektengeruchssinn? Geruchssinn ist der älteste Sinn der Lebewesen Hauptaufgabe des olfaktorischen Systems ist die Detektion tausender Duftmoleküle Gerüche sind multidimensional, werden aber als Einheit wahrgenommen. Einige generelle Fragen Wie löst das olfaktorische System das komplizierte Problem der Mustererkennung? Nutzt der Geruchssinn viele spezifische Rezeptoren oder wenige, die auf viele Duftstoffe reagieren? Welche Moleküle detektieren die Duftstoffe? Chemosensorische Wahrnehmung bei Säugetieren Nasenhöhle olfaktorische Wahrnehmung (Geruchssinn) bei Insekten farnesene Mundhöhle Gustatorische Wahrnehmung (Geschmackssinn) Coccinellin H H N + CH 3 H (S)-(-) α pinene 9

10 Duftmoleküle +, - C H 3 H 2 C H C H 2 N S 1-octen-3-ol benzaldehyde allyl Isothiocyanate Zahl der Insekten und Evolution 2 mil Homo sapiens 195 mil ältestes Säugetier Collembola 400 mil (älteste landlebende Tiere) 80% aller Spezies sind Insekten 10

11 Der Seidenspinner, Bombyx mori )* +, # ( & -. / 0 % 1 2 ' 3 4 C H 3 H )! 11

12 . / (E,Z)-6,11-esadecadienil acetato Antherea polyphemus (E,Z)-6,11-esadecadienale Antherea polyphemus H (E,Z)-10,12-esadecadienolo Bombyx mori H (E,Z)-10,12-esadecadienale Bombyx mori, Manduca sexta H (E,E,Z)-10,12,14-esadecatrienale Manduca sexta H (7R,8S)-7,8-epossi-2-metil octadecano Lymantria dispar (Z)-11-esadecenale Heliothis virescens H esadecanale Heliothis virescens H (Z)-6-eneicosen-11-one rgia pseudosugata (Z)-13-esadecen-11-inil acetato Thaumetopoea pityocampa (Z)-11-esadecenil acetato Mamestra brassicae (Z)-9- esadecenil acetato Mamestra brassicae (Z)-5-decenil acetato Agrotis segetum (Z)-7-dodecenil acetato Agrotis segetum (Z)-9-tetradecenilacetato Agrotis segetum Wenn ein Schmetterling einen Elefanten liebt! Kelly, Chem. Bio.,

13 ElektroAntennoGraphie (EAG) (Schneider, 1959) Dietrich Schneider, 30/7/ /5/2008 von Franke W. Gaschromatographie Massenspektroskopie und Elektroantennographische Detektion (GC-MS/EAD) aus Weissbecker B. et al

14 Gaschromatographie Massenspektroskopie und Elektroantennographische Detektion (GC-MS/EAD) Antenne von Cis boleti (Coleoptera) Antenne von Suillia mikii (Diptera) 1 1 Antennenreaktion von Cis boleti auf Pilzdüfte GC-MS/EAG EAD 0.05 mv CH 3 H 2 C H GC Thakeow et al., 2008 Chemical Senses Time (min.) 14

15 from Franke W. 15

16 Chemoperzeption von Insekten Struktur eines Insekten-Sensillums Wirbeltier Neuron Neuron Sensillenlymphe Auxillarzellen Steinbrecht et al. 1995; Rogers et al

17 Sensillentypen in der Antenne von S. gregaria Sensillentypen in der Antenne von S. gregaria s. trichodeum s. basiconicum s. s. chaeticum s. coeloconicum lfactorische Signaltransduktion bei Insekten 1) Perirezeptor-Ereignisse Antennallobus 2) Zentrale Prozesse Keller A, Vosshall L.B (2003) Decoding lfaction in Drosophila Curr. pin. Neurobiol. 17

18 Antennallobus von D. melanogaster Antennallobus von Drosophila beinhaltet ~43 Glomeruli Aus der The Hing s Lab: laboratory of olfaction development Internetseite Richard Axel Linda Buck From R. Axel, Nobel Prize (www.nobelprize.org) 18

19 Antennallobus von Apis mellifera Verarbeitung olfaktorischer Reize im Antennallobus der Honigbiene H 1- ctanol octanol Heptanal heptanal 2- heptanone Heptanon H From G. Galizia, Koeln Univ. 19

20 Geruchskodierung Lösliche Globular-Proteine Membran-Proteine -Niedriges Molekulargewicht (14-20 (14-20 kda) kda) --Sauer Sauer (pi (pi = 4-5) 44-5) --Hoch Hochkonzentriert in in der der Sensillenlymphe (10 (10mM )) lfactory Receptors (Rs) 1) 1) dorant-binding Proteins (BP) --6 Cysteine in in konservierter Position 2) 2) Chemosensory Proteins (CSP) --Bindungskapazität wurde wurdegemessen --in in der derlymphe olf. olf. Sensillen lokalisiert --4 Unterklassen: : PBP, PBP, GBP1, GBP2 GBP2 und und ABPX ABPX --dreidimensionale Struktur wurde wurdevor vor kurzem kurzemerforscht --4 Cysteine in in konservierter Position --Bindungungskapazität nur nurin in einem einemfall gemessen --lokalisiert in in der derlymphe of of gustatorischer und und olfaktorischer Sensillen --weniger wenigergut gut charakterisiert Zellaußenraum Duft-Signaltransduktion Sensillen-Cuticula dorant Binding Protein (BP) Sensillenlymphe Phospholipase C Rezeptor 1 Rezeptor 2 Chemosenosry Protein (CSP) Adenylat-Cyclase PIP 3 PLC R1 R2 AC IP 3 α α β γ γ β α α camp IP 3 Cytosol G-Protein-Komplex camp APT IP 3 IC 1 IC 2 IC 3 camp Anregungskanal (depolarisierend) Inhibitorischer Kanal (hyperpolarisierend) Schematische Darstellung biochemischer Aspekte der Geruchs-Signaltransduktion von Arthropoden: Parallele Anregungs- (IP 3 ) und inhibitorische (camp) Kanäle. camp cyclic-3,5 -adenosyl-monophosphate, DAG diacyl glycerol, G-protein complex, IP 3 inositol trisphosphate and PIP 2 phosphatidylinositol-4,5-sphosphate (von Vogt, 1995; modifiziert). 20

21 BPs von Bombyx mori PBP = Pheromone Binding Proteins GBP = General dorant Binding Proteins PBP-1 MSIQGQIALALMVNMAVGSVDASQEVMKNLSLNFGKALDECKKEMTLTDAINEDF GBP-1 MWKLVVVLTVNLLQGALTDVYVMKDVTLGFGQALEQCREESQLTEEKMEEF PBP-1 YNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQ GBP-1 FHFWNDDFKFEHRELGCAIQCMSRHFNLLTDSSRMHHENTDKFIKSFPNGEILSQ PBP-1 QLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWAPSMDVAVGEILAEV GBP-1 KMIDMIHTCEKTFDSEPDHCWRILRVAECFKDACNKSGLAPSMELILAEFIMESEADK Strukturanalyse von zwei Bombyx mori BPs NH 2 CH Scaloni A., Monti M., Angeli S. and Pelosi P. (1999) Structural analysis and disulfide-bridge pairing of tow odorant-binding proteins from Bombyx mori. Biochemical and Biophysical Research Communication 266,

22 3-D Struktur von Bombyx mori PBP 3-D Struktur von Bombyx mori PBP Sandler B.H., Nikonova L., Leal W.S. and Clardy J. (2000) Sexual attraction in the silkworm moth: structure of the pheromone-binding-protein-bombykol complex. Chem. Biol. 7(2): B-form, X-ray N N C ph 4.5 C C Horst et al., PNAS USA 98, (2001), Leal et al., A-form, NMR N Bombyx PBP 22

23 Arbeit mit BPs/CSPs: Der Anfang.. Muster löslicher Proteine von Schistocerca gregaria Männchen Weibchen SDS-PAGE 66 kda 45 kda 29 kda 20 kda 14 kda Native-PAGE H T A W L An Mo H T A W L An Mo 23

24 Biochemische Characterisierung des löslichen Proteins p14 SDS-PAGE Native-PAGE 66 kda 45 kda 29 kda 20 kda 14 kda IEF 14 kda pi 5.1 3,5 µg/antenne N-terminale Aminosäuresequenz (34 aa) NH 2 -EEKYTTKYDNVNLDEILANDRLLNKYVQQLLEXD Klonierung von Schistocerca gregaria p14 RT-PCR: based on on proteins N-terminal sequences we we have have designed degenerate primers and and amplified specific cdna sequences Degenerierter Primer gargaraartayacnac Proteinsequenz NH NH 2 -E D- 2 -E E K Y T T K Y D N V N L D- CSP-sg1 CSP-sg1 EEKYTTKYDNVNLDEILANDRLLNNYVKCLLEDGEANCTVDGKELKKAVPDALSNECAKCNDKQKEGTKKVLK EEKYTTKYDNVNLDEILANDRLLNNYVKCLLEDGEANCTVDGKELKKAVPDALSNECAKCNDKQKEGTKKVLK CSP-sg2 CSP-sg2 EEKYTTMFDNVNLDEILANDRLLNNYVKCLLEDGEANCTADGKELKKAVPDALSNECAKCNDKQKEGTKKVLK EEKYTTMFDNVNLDEILANDRLLNNYVKCLLEDGEANCTADGKELKKAVPDALSNECAKCNDKQKEGTKKVLK CSP-sg3 CSP-sg3 EEKYTTKYDNVNLDEIIANDRLLNKYAQCLLENDDTNCTDDGKELKSVIPDALSNECAKCNEKQKEGTKKVLK EEKYTTKYDNVNLDEIIANDRLLNKYAQCLLENDDTNCTDDGKELKSVIPDALSNECAKCNEKQKEGTKKVLK CSP-sg4 CSP-sg4 EEKYTTKYDNVNLDEILANDRLLNKYVQCLLEDDESNCTADGKELKSVIPDALSNECAKCNEKQKEGTKKVLK EEKYTTKYDNVNLDEILANDRLLNKYVQCLLEDDESNCTADGKELKSVIPDALSNECAKCNEKQKEGTKKVLK CSP-sg5 CSP-sg5 EEKYTTKYDNVNLDEILANDRLLNKYVQCLLEDDESNCTADGKELKKDIPDALSNECAKCNEKQKEGTKKVLK EEKYTTKYDNVNLDEILANDRLLNKYVQCLLEDDESNCTADGKELKKDIPDALSNECAKCNEKQKEGTKKVLK * * * * CSP-sg1 CSP-sg1 HLINHKPDIWAQLKAKYDPDGTYSKKYEDKEKELHE HLINHKPDIWAQLKAKYDPDGTYSKKYEDKEKELHE CSP-sg2 CSP-sg2 HLINHKPDIWAQLKAKYDPDGTYSKKYEDKEKELHE HLINHKPDIWAQLKAKYDPDGTYSKKYEDKEKELHE full mature sequence CSP-sg3 CSP-sg3 HLINHKPDIWAQLKAKYDPDGTYSKKYEDREKELHQ HLINHKPDIWAQLKAKYDPDGTYSKKYEDREKELHQ 109 aminoacids, CSP-sg4 CSP-sg4 HLINHKPDVWAQLKAKYDPDGTYSKKYEDREKELHQ HLINHKPDVWAQLKAKYDPDGTYSKKYEDREKELHQ 4 cysteins in conserved positions CSP-sg5 CSP-sg5 HLINHKPDVWAQLKAKYDPDGTYSKKYEDREKELHQ HLINHKPDVWAQLKAKYDPDGTYSKKYEDREKELHQ 24

25 Polyklonale Polyklonale Antikörper Antikörper gegen gegen Sgre-CSP, Sgre-CSP, Ecar-CSP Ecar-CSP and and CmorCSP CmorCSP Western Blot SDS - PAGE anti -S Western blot anti -E anti -C 66 kda 45 kda 29 kda 20 kda 14 kda M S S : Schistocerca gregaria ( tarsi ) E C S E C E : Eurycantha calcarata ( tarsi ) S E C S E C C : Carausius morosus ( tarsi ) Immunozytochemische Immunozytochemische Lokalisierung Lokalisierung von von Sgre-CSP Sgre-CSP Immunofärbung von Sensillen an Antennen (A), Maxillarpalpen (P) und Tarsen (T) mit polyklonalem Antiserum gegen CSP-sg4. Kontakt-Sensillen sind stark gefärbt, lfaktorische Sensillen nicht (nicht gezeigt). Angeli S, Ceron F, Scaloni A, Monti M, Monteforti G, Minnocci A, Petacchi R, Pelosi P (1999) Purification, structural characterization, cloning and immunocytochemical localization of chemoreception proteins from Schistocerca gregaria Eur. J. Biochem. Jun;262(3):

26 Chemosensory Proteins von Eurychanta calcarata (Phasmida) Marchese S, Angeli S, Andolfo A, Scaloni A, Brandazza A, Mazza M, Picimbon J, Leal WS, Pelosi P. (2000) Soluble proteins from chemosensory organs of Eurycantha calcarata. Insect Biochem Mol Biol. 30: Chemosensory Proteins von Carausius morosus (Phasmida) Monteforti G, Angeli S, Petacchi R, Minnocci A. (2002) Ultrastructural characterization of antennal sensilla and immunocytochemical localization of a chemosensory protein in Carausius morosus Brünner (Phasmida: Phasmatidae) Arthropod Structure and Development 30 (3), Identifizierung, Aufreinigung und Klonierung zweier CSPs von Bombyx mori GBP-2 CSP-1 PBP B. B. mori moricsp-1 DDKYTDKYDKINLQEILENKRLLESYMDCVLGKGKCTPEGKELKDHLQEALETGCEKCTEAQEK GAETSIDYLIKNELEIWKELTAHFDPDGKWRKKYEDRAKAKGIVIPE B. B. mori moricsp-2 QDKYEPIDDSFDASEVLSNERLLKSYTKCLLNQGPCTAELKKIKDKIPEALETHCAKCTDKQKQ MAKQLAQGIKKTHPELWDEFITFYDPQGKYQTSFKDFLES Picimbon JF, Dietrich K, Angeli S, Scaloni A, Krieger J, Breer H, Pelosi P. (2000) Purification and molecular cloning of chemosensory proteins from Bombyx mori. Arch Ins. Biochem Physiol. 44:

27 Tribolium castaneum: das erste Genome eines Coleopteren Grün fluoreszierende Protein (GFP) eingefügt ins Tribolium-Genome mrna cdna RT-PCR Insgesamt 47 BPs und 19 CSPs von Tribolium wurden identifiziert : 2008:..., Robertson H.M., Angeli S., Forêt S.,... (2008) The genome of the developmental model beetle and pest Tribolium castaneum, Nature, 452(7190): Zukünftige Ziele RNA-Interferenz EAG, GC-MS-EAD 27

28 $ Danke für Ihre Aufmerksamkeit " $ '7 -,, 7' 28

Partielle Sequenzinformation

Partielle Sequenzinformation Analyse der Sequenz Traditionell: Bestimmung einer Teilsequenz, Herstellung einer DNA-Sonde, Klonierung des Gens oder der cdna, Sequenzierung der DNA Keine Information zu PTM Limitiert: Isoformen Heute:

Mehr

Drexler G.A. 1, Derer A 1, Dirks W.G. 2, Hable V. 3, Greubel C. 3, Burgdorfer C. 3, Dollinger G. 3, Du G. 4, Friedl A.A. 1

Drexler G.A. 1, Derer A 1, Dirks W.G. 2, Hable V. 3, Greubel C. 3, Burgdorfer C. 3, Dollinger G. 3, Du G. 4, Friedl A.A. 1 Nutzung von bi-cistronischen Vektoren für die Beobachtung der Rekrutierung von Signal- und Reparaturproteinen an DNA-Schäden nach Ionen- Mikrobestrahlung durch Live-Cell Imaging Drexler G.A. 1, Derer A

Mehr

Dissertation. von Daniel Heiko Niemiiller aus Osterholz-Scharmbeck

Dissertation. von Daniel Heiko Niemiiller aus Osterholz-Scharmbeck Vergleichende Lokalisation der Homospermidin-Synthase, Eingangsenzym der Pyrrolizidin-Alkaloid-Biosynthese, in verschiedenen Vertretern der Boraginaceae Von der Fakultat fur Lebenswissenschaften der Technischen

Mehr

Spektrale Farbtrennung in der konfokalen Laser Scanning Mikroskopie

Spektrale Farbtrennung in der konfokalen Laser Scanning Mikroskopie 1. Jenaer Workshop Spektralsensorik Spektrale Farbtrennung in der konfokalen Laser Scanning Mikroskopie Dr. Monika Marx Training, Application and Support Center TASC, Carl Zeiss MicroImaging GmbH Carl

Mehr

Die Funktion flüchtiger Signalstoffe bei der Verteidigung von Pflanzen gegen Schädlinge

Die Funktion flüchtiger Signalstoffe bei der Verteidigung von Pflanzen gegen Schädlinge Degenhardt, Jörg Die Funktion flüchtiger Signalstoffe bei der Verteidigung... Tätigkeitsbericht 2006 Mikrobiologie/Ökologie Pflanzenforschung Die Funktion flüchtiger Signalstoffe bei der Verteidigung von

Mehr

Abkürzungsverzeichnis... 7. Inhaltsverzeichnis... 11. Abbildungsverzeichnis... 17. 1 Einleitung... 21 1.1 Proteomik... 21 1.1.1 Proteom...

Abkürzungsverzeichnis... 7. Inhaltsverzeichnis... 11. Abbildungsverzeichnis... 17. 1 Einleitung... 21 1.1 Proteomik... 21 1.1.1 Proteom... Inhaltsverzeichnis Abkürzungsverzeichnis... 7 Inhaltsverzeichnis... 11 Abbildungsverzeichnis... 17 1 Einleitung... 21 1.1 Proteomik... 21 1.1.1 Proteom... 21 1.1.2 Protein-Protein Interaktionen allgemein...

Mehr

Kapitel 4. Das HMO-Modell

Kapitel 4. Das HMO-Modell Kapitel 4 4. HMO-Theorie:!-Elektronensysteme 4.. Die Annahmen der HMO-Theorie, Strukturmatrix 4.2. Butadien als Beispiel 4.3. Analytische Lösung für lineare Ketten UV-vis-Absorption: HMO und Freies Elektronen

Mehr

Erschließung des mikrobiellen Synthesepotenzials für die Meisterung der Materialwende

Erschließung des mikrobiellen Synthesepotenzials für die Meisterung der Materialwende Erschließung des mikrobiellen Synthesepotenzials für die Meisterung der Materialwende Prof. Dr. J.M. Köhler Dr. Alexander Groß Instiute for Micro- and Nanotechnology Instiute for Chemistry and Biotechnology

Mehr

Neue DNA Sequenzierungstechnologien im Überblick

Neue DNA Sequenzierungstechnologien im Überblick Neue DNA Sequenzierungstechnologien im Überblick Dr. Bernd Timmermann Next Generation Sequencing Core Facility Max Planck Institute for Molecular Genetics Berlin, Germany Max-Planck-Gesellschaft 80 Institute

Mehr

Modul biol113 Zellbiologie - Nachweis von mitochondrialem Import

Modul biol113 Zellbiologie - Nachweis von mitochondrialem Import Modul biol113 Zellbiologie - Nachweis von mitochondrialem Import Einführung Ein grundlegendes Problem der Zellbiologie ist es, die korrekte zelluläre Lokalisation eines Peptides zu bestimmen. Durch den

Mehr

Expressionskontrolle in Eukaryonten

Expressionskontrolle in Eukaryonten Expressionskontrolle in Eukaryonten Warum muss Genexpression kontrolliert werden? 1. Gewebsspezifische Kontrolle - nicht jedes Genprodukt ist in allen Zellen erforderlich - manche Genprodukte werden ausschliesslich

Mehr

Übungsfragen Biochemie 1. Erklären Sie die Begriffe

Übungsfragen Biochemie 1. Erklären Sie die Begriffe Übungsfragen Biochemie 1 Erklären Sie die Begriffe Adsorption Diffusion Dialyse Enantiomere Diastereomere Verseifung Fett Lipid essentielle Fettsäure essentielle Aminosäure Kohlenhydrat Disaccharid Peptid

Mehr

Design-to-Target: Optimierte Innovationsvorhaben im Oberflächenbereich.! Your specialist for surface modifications and characterization!

Design-to-Target: Optimierte Innovationsvorhaben im Oberflächenbereich.! Your specialist for surface modifications and characterization! Design-to-Target: Optimierte Innovationsvorhaben im Oberflächenbereich.! Your specialist for surface modifications and characterization! Agenda! Vorstellung Referenten! Vorstellung SuSoS und Xirrus! Innovationsvorhaben!

Mehr

Movie dendritic cell migration_iv_8_2. Komponenten und Aufbau des Immunsystems Initiation von Immunantworten. lymphatische Organe

Movie dendritic cell migration_iv_8_2. Komponenten und Aufbau des Immunsystems Initiation von Immunantworten. lymphatische Organe Komponenten und Aufbau des Immunsystems Initiation von Immunantworten lymphatische Organe Erkennungsmechanismen Lymphozytenentwicklung Entstehung und Verlauf adaptiver Immunantworten T-Zellen gelangen

Mehr

Transgene Tiere: Genmodifikation in der Maus

Transgene Tiere: Genmodifikation in der Maus Transgene Tiere: Genmodifikation in der Maus Gentechnik und Genomics WiSe 2007/2008 Kristian M. Müller Institut für Biologie III Albert-Ludwigs-Universität Freiburg Nobelpreis Physiologie und Medizin 2007

Mehr

Controlling the Surface Properties of Nanoparticles Bioorganically modified Nanoparticles for Cell Signaling (NANOCYTES)

Controlling the Surface Properties of Nanoparticles Bioorganically modified Nanoparticles for Cell Signaling (NANOCYTES) Surfaces and Interfaces NANCYTES Engineering at the Nanoscale, DECHEMA, 9. März 2005 Controlling the Surface Properties of Nanoparticles Bioorganically modified Nanoparticles for Cell Signaling (NANCYTES)

Mehr

Natur und Technik. Lernstandserhebung zu den Schwerpunkten Biologie, Naturwissenschaftliches Arbeiten, Informatik. Datum:

Natur und Technik. Lernstandserhebung zu den Schwerpunkten Biologie, Naturwissenschaftliches Arbeiten, Informatik. Datum: Name: Natur und Technik Lernstandserhebung zu den Schwerpunkten Biologie, Naturwissenschaftliches Arbeiten, Informatik Datum: Klasse: 1 Das entscheidende Kennzeichen aller Lebewesen ist ihr Aufbau aus

Mehr

oocroa OFNA1URALSCIENCES

oocroa OFNA1URALSCIENCES DISS. ETH NO.9966 CONTACTIN/Fll IS A NEURONAL RECEPTOR OF TENASCIN A DISSERTATION SUBMITTED TO THE SWISS FEDERAL INSTITUTE OF TECHNOLOGY FüR THE DEGREE OF oocroa OFNA1URALSCIENCES PRESEN1ED BY ANDREAS

Mehr

Entwicklungsbiologie Master-Module. (bzw. 9 + 3)

Entwicklungsbiologie Master-Module. (bzw. 9 + 3) Entwicklungsbiologie Master-Module (bzw. 9 + 3) Entwicklungsbiologie Master-Module Block 3 Ebio I Evolution von Musterbildung und Gametogenese Mikroinjektion von Tribolium-Embryonen zur Proteinlokalisierung

Mehr

MOL.504 Analyse von DNA- und Proteinsequenzen

MOL.504 Analyse von DNA- und Proteinsequenzen MOL.504 Analyse von DNA- und Proteinsequenzen Kurs 1 Monika Oberer, Karl Gruber MOL.504 Modul-Übersicht Einführung, Datenbanken BLAST-Suche, Sequenzalignment Proteinstrukturen Virtuelles Klonieren Abschlusstest

Mehr

Wissenschaftliche Angestellte, Laborleitung Geburtsdatum, Nationalität: 28.04.1973, deutsch

Wissenschaftliche Angestellte, Laborleitung Geburtsdatum, Nationalität: 28.04.1973, deutsch Forschungsbericht über das Projekt Einfluss der TLR3-Aktivierung des retinalen Pigmentepithels auf das Verhalten von Makrophagen, gefördert durch die DOG im Rahmen der Forschungsförderung innovativer wissenschaftlicher

Mehr

Phylogenetisches Praktikum im ITZ 08.02.2010-19.02.2010

Phylogenetisches Praktikum im ITZ 08.02.2010-19.02.2010 Phylogenetisches Praktikum im ITZ 08.02.2010-19.02.2010 Zellzyklus- und neuronale Gene in Trichoplax adhaerens S. Sagasser Praktikanten: Patrick Reinke und Jan Kleveman Betreuerin: Karolin von der Chevallerie

Mehr

Why you should care. by Thomas Krimmer. Thomas Krimmer @ACS Slide 1

Why you should care. by Thomas Krimmer. Thomas Krimmer @ACS Slide 1 Why you should care. by Thomas Krimmer Thomas Krimmer @ACS Slide 1 CAS Publication Record Abstracts (Millions) 1.5 papers per minute Source: CAS helpdesk, Statistical Summary 1907-2007, 02/10/2009 Thomas

Mehr

Was ist die GBM? Gesellschaft für Biochemie und Molekularbiologie e.v. 1947 gegründet

Was ist die GBM? Gesellschaft für Biochemie und Molekularbiologie e.v. 1947 gegründet Was ist die GBM? Gesellschaft für Biochemie und Molekularbiologie e.v. 1947 gegründet mit rund 5300 Mitgliedern Deutschlands führende Fachgesellschaft für die Biowissenschaften Die GBM arbeitet gemeinnützig

Mehr

Alternative Lösungsmittel für mögliches extraterrestrisches Leben

Alternative Lösungsmittel für mögliches extraterrestrisches Leben Alternative Lösungsmittel für mögliches extraterrestrisches Leben Vertiefungsmodul Astrobiologie: Spezielle Aspekte der Astrobiologie WS 11/12 Matthias Kühtreiber Überblick Physikalische/chemische Eigenschaften

Mehr

Evidence of strobilurine resistant isolates of A. solani and A. alternata in Germany

Evidence of strobilurine resistant isolates of A. solani and A. alternata in Germany Technische Universität München Evidence of strobilurine resistant isolates of A. solani and A. alternata in Germany H. Hausladen, B. Adolf and J. Leiminger outline introduction material and methods results

Mehr

AVANTEK. Indoor HDTV Antenna DVB-T Zimmerantenne. Instruction Manual Bedienungsanleitung

AVANTEK. Indoor HDTV Antenna DVB-T Zimmerantenne. Instruction Manual Bedienungsanleitung AVANTEK Indoor HDTV Antenna DVB-T Zimmerantenne Instruction Manual Bedienungsanleitung EN 1 Illustration AC Adapter Connecting Box EN 2 Product Introduction This indoor antenna brings you access to free

Mehr

Apoptose 69. 1. Einleitung 2. Extrinsischer Weg 3. Intrinsischer Weg

Apoptose 69. 1. Einleitung 2. Extrinsischer Weg 3. Intrinsischer Weg Teil III. Signalweg des Zelltodes im Herzen Apoptose 69. 1. Einleitung 2. Extrinsischer Weg 3. Intrinsischer Weg >50% der Neuronen Während der Entwicklung 70. Kontraktionsband Nekrose Retina DNA Abbau

Mehr

Numerical analysis of the influence of turbulence on the exchange processes between porous-medium and free flow

Numerical analysis of the influence of turbulence on the exchange processes between porous-medium and free flow Numerical analysis of the influence of turbulence on the exchange processes between porous-medium and free flow T. Fetzer Institut für Wasser- und Umweltsystemmodellierung Universität Stuttgart January

Mehr

Bioinformatik I (Einführung)

Bioinformatik I (Einführung) Kay Diederichs, Sommersemester 2015 Bioinformatik I (Einführung) Algorithmen Sequenzen Strukturen PDFs unter http://strucbio.biologie.unikonstanz.de/~dikay/bioinformatik/ Klausur: Fr 17.7. 10:00-11:00

Mehr

Astrobiologie Sommersemester 2015

Astrobiologie Sommersemester 2015 Astrobiologie Sommersemester 2015 Teil 1: Astrobiologie aus der Sicht der Einzeldisziplinen Es ist kein Zufall, dass es 2015 eine Astrobiologie-Vorlesung an der Uni Hamburg gibt Die Zeit ist reif für

Mehr

VL Algorithmische BioInformatik (19710) WS2013/2014 Woche 16 - Mittwoch. Annkatrin Bressin Freie Universität Berlin

VL Algorithmische BioInformatik (19710) WS2013/2014 Woche 16 - Mittwoch. Annkatrin Bressin Freie Universität Berlin VL Algorithmische BioInformatik (19710) WS2013/2014 Woche 16 - Mittwoch Annkatrin Bressin Freie Universität Berlin Vorlesungsthemen Part 1: Background Basics (4) 1. The Nucleic Acid World 2. Protein Structure

Mehr

What you should have learned so far

What you should have learned so far Finding the right scale...mittels Regressionsanalysen (siehe Übung)...mittels theoretischer Überlegungen...mittels Modellen, die an empirischen Daten getestet werden...mittels räumlichen Autokorrelationsanalysen

Mehr

Protein Expression. Purification. Tag-nology

Protein Expression. Purification. Tag-nology Protein Expression Purification Tag-nology Expression, homolog oder heterolog? Heterologe Expression in anderem Host Kompartment Codon usage Posttranslationale Modifikationen Kofaktoren Chaperone Non-leaky

Mehr

4. Quantitative Analyse der Ligand-Bindungsstudien

4. Quantitative Analyse der Ligand-Bindungsstudien 4. Quantitative Analyse der Ligand-Bindungsstudien Im folgenden apitel sollen die grundlegenden analytischen Methoden zur Interpretation der experimentell gewonnenen Bindungsdaten vorgestellt werden. ie

Mehr

DAS METABOLOM: ERNÄHRUNGSSTATUS, METABOLISMUS, METABOLITEN

DAS METABOLOM: ERNÄHRUNGSSTATUS, METABOLISMUS, METABOLITEN DAS METABOLOM: ERNÄHRUNGSSTATUS, METABOLISMUS, METABOLITEN Das Metabolom Extrinsiche Faktoren Ernährung (Nährstoffe und nicht nutritive Lebensmittelinhaltsstoffe) Arzneimittel Physische Aktivität Darmflora

Mehr

Praktikum Biochemie Biotechnologie (Molekularbiologie & Biochemie) Bettina Siebers

Praktikum Biochemie Biotechnologie (Molekularbiologie & Biochemie) Bettina Siebers Praktikum Biochemie Biotechnologie (Molekularbiologie & Biochemie) Bettina Siebers Protein Expression Genomische DNA PCR Vektormolekül (Plasmid) Escherichia coli Reinigung Protein (1) Plasmidpräparation

Mehr

Gefahren durch Epidemien?

Gefahren durch Epidemien? Gefahren durch Epidemien? Dr. Bernd Wührer 1, Dr. Olaf Zimmermann 1, Regina Burger 2 und Dr. Hubert Sprich 3 1 AMW Nützlinge GmbH; 2 fenaco UFA-Samen Nützlinge; 3 ZG Raiffeisen eg Gefahren durch Epidemien?

Mehr

Lern- und Gedächtnisprozesse im Gehirn: Die Biene als Modellorganismus

Lern- und Gedächtnisprozesse im Gehirn: Die Biene als Modellorganismus Lern- und Gedächtnisprozesse im Gehirn: Die Biene als Modellorganismus PD Dr. Ricarda Scheiner Technische Universität Berlin Institut für Ökologie Franklinstr. 28/29, FR 1-1 10587 Berlin E-mail: Ricarda.Scheiner-Pietsch@TU-Berlin.de

Mehr

Regulation der Genexpression: regulierbare Promotoren, Proteine und sirna

Regulation der Genexpression: regulierbare Promotoren, Proteine und sirna Regulation der Genexpression: regulierbare Promotoren, Proteine und sirna Biochemie Praktikum Christian Brendel, AG Grez Ebenen der Genregulation in Eukaryoten Cytoplasma DNA Zellkern Introns Exons Chromatin

Mehr

Technical Support Information No. 123 Revision 2 June 2008

Technical Support Information No. 123 Revision 2 June 2008 I IA Sensors and Communication - Process Analytics - Karlsruhe, Germany Page 6 of 10 Out Baking Of The MicroSAM Analytical Modules Preparatory Works The pre-adjustments and the following operations are

Mehr

Der Kunde im Mittelpunkt. Auf dem Weg zu einem kundenzentriert denkenden und handelnden Unternehmen

Der Kunde im Mittelpunkt. Auf dem Weg zu einem kundenzentriert denkenden und handelnden Unternehmen Der Kunde im Mittelpunkt Auf dem Weg zu einem kundenzentriert denkenden und handelnden Unternehmen Viel hat sich seit 2006 bei Dell verändert 2 Wir sind alle Pioniere und durch Social verändern sich unsere

Mehr

Menschen an der BOKU. Eva Stöger

Menschen an der BOKU. Eva Stöger Menschen an der BOKU Eva Stöger Blindtext Interview 2008 S usw 01 02 S 01 02 Das neue VIBT motiviert uns sehr. Ich freue mich schon über das neue Gebäude und die Aufbruchsstimmung. Was Zellen alles können

Mehr

THE CAENORHABDITIS ELEGANS MODEL

THE CAENORHABDITIS ELEGANS MODEL THE CAENORHABDITIS ELEGANS MODEL C. elegans Der Name Caenorhabditis elegans stammt aus einer Mischung von griechischen und lateinischen Wörtern. Caeno (griechisch kaeno): neu, ungewöhnlich Rhabdos (griechisch):

Mehr

Transferpuffer und allgemeine Tipps für Blotting-Ansätze

Transferpuffer und allgemeine Tipps für Blotting-Ansätze Transferpuffer und allgemeine Tipps für Blotting-Ansätze Transferpuffer für Semi-Dry-Blotting Im Semi-Dry-Blotting-System kann man sowohl ein kontinuierliches Puffersystem (identischer Puffer an Anode

Mehr

Exercise (Part XI) Anastasia Mochalova, Lehrstuhl für ABWL und Wirtschaftsinformatik, Kath. Universität Eichstätt-Ingolstadt 1

Exercise (Part XI) Anastasia Mochalova, Lehrstuhl für ABWL und Wirtschaftsinformatik, Kath. Universität Eichstätt-Ingolstadt 1 Exercise (Part XI) Notes: The exercise is based on Microsoft Dynamics CRM Online. For all screenshots: Copyright Microsoft Corporation. The sign ## is you personal number to be used in all exercises. All

Mehr

HOCHLEISTUNGSQUETSCHVENTILE TYP RV HIGH PERFORMANCE PINCH VALVES TYPE RV

HOCHLEISTUNGSQUETSCHVENTILE TYP RV HIGH PERFORMANCE PINCH VALVES TYPE RV HOCHLEISTUNGSQUETSCHVENTILE TYP RV HIGH PERFORMANCE PINCH VALVES TYPE RV EIGENSCHAFTEN Nennweite: DN - 1 mm Baulänge: DIN, ASME, ISO Betriebsdrücke: 1 - bar Auf/Zu-Ventile Regelventile (elektrisch/ elektro-pneumatisch)

Mehr

Diagnostische Verfahren in der Mikrobiologie: Realität oder Science-Fiction?

Diagnostische Verfahren in der Mikrobiologie: Realität oder Science-Fiction? Diagnostische Verfahren in der Mikrobiologie: Realität oder Science-Fiction? Dr. med. vet. Vladimira Hinić Klinische Mikrobiologie Universitätspital Basel 1 1. Automation in der klinischen Mikrobiologie

Mehr

Genomsequenzierung für Anfänger

Genomsequenzierung für Anfänger Genomsequenzierung für Anfänger Philipp Pagel 8. November 2005 1 DNA Sequenzierung Heute wird DNA üblicherweise mit der sogenannten Sanger (oder chain-terminationoder Didesoxy-) Methode sequenziert dessen

Mehr

Übungsblatt: Protein interaction networks. Ulf Leser and Samira Jaeger

Übungsblatt: Protein interaction networks. Ulf Leser and Samira Jaeger Übungsblatt: Protein interaction networks Ulf Leser and Samira Jaeger Aufgabe 1 Netzwerkzentralität (6P) In der Vorlesung haben Degree Centrality besprochen. Finde drei weitere etablierte Zentralitätsmaße

Mehr

Klonierung bzw. Generierung von Genen für die Genexpression. Gene, die für Proteine kodieren

Klonierung bzw. Generierung von Genen für die Genexpression. Gene, die für Proteine kodieren 62 Klonierung bzw. Generierung von Genen für die Genexpression Inhaltsvorschau Für die Produktion biopharmazeutischer Produkte werden deren Gene benötigt. In diesem Kapitel wird erläutert, wie die Gene,

Mehr

Vorlesung Einführung in die Bioinformatik

Vorlesung Einführung in die Bioinformatik Vorlesung Einführung in die Bioinformatik Organisatorische Hinweise Dr. Uwe Scholz 07.04.2014 Informationen Uwe Scholz: scholz@ipk-gatersleben.de Lothar Altschmied: lothar@ipk-gatersleben.de Christian

Mehr

Highlights versiondog 3.1

Highlights versiondog 3.1 Highlights versiondog 3.1 Release June 2014 Smart Import for supplier Wizard for receiving supplier in the versiondog system Tool for automated import, versioning and Check-In of files edited externally

Mehr

Praktikum Entwicklung Mediensysteme (für Master)

Praktikum Entwicklung Mediensysteme (für Master) Praktikum Entwicklung Mediensysteme (für Master) Organisatorisches Today Schedule Organizational Stuff Introduction to Android Exercise 1 2 Schedule Phase 1 Individual Phase: Introduction to basics about

Mehr

The German professional Education System for the Timber Industry. The University of Applied Sciences between vocational School and University

The German professional Education System for the Timber Industry. The University of Applied Sciences between vocational School and University Hochschule Rosenheim 1 P. Prof. H. Köster / Mai 2013 The German professional Education System for the Timber Industry The University of Applied Sciences between vocational School and University Prof. Heinrich

Mehr

Gruppenarbeit physikalische und chemische Eigenschaften von Alkansäuren

Gruppenarbeit physikalische und chemische Eigenschaften von Alkansäuren Gruppenarbeit Gruppe 1: Siedetemperaturen von Alkansäuren Löst die gestellten Aufgaben in eurer Gruppe. Ihr habt dafür 20 Minuten Zeit. Tragt die Ergebnisse in die Folie ein. Wählt eine Gruppensprecherin

Mehr

Accreditation of Prior Learning in Austria

Accreditation of Prior Learning in Austria Accreditation of Prior Learning in Austria Birgit Lenger ibw Institut für Bildungsforschung der Wirtschaft Institute for Research on Qualifications and Training of the Austrian Economy October, 2009 TOPICS

Mehr

Sichere Digitale Soziale Netzwerke

Sichere Digitale Soziale Netzwerke Sichere Digitale Soziale Netzwerke Eine Chance für E-Learning? LifeSocial - www.lifesocial.org E-Learning QuaP2P Improving the Quality of P2P Systems DFG research group 733 Dr.Ing. Kalman Graffi Kalman.Graffi@KOM.tu-darmstadt.de

Mehr

Die Auswirkung physikalischen Stresses auf monoklonale Antikörper in der Formulierungsentwicklung

Die Auswirkung physikalischen Stresses auf monoklonale Antikörper in der Formulierungsentwicklung Die Auswirkung physikalischen Stresses auf monoklonale Antikörper in der Formulierungsentwicklung Von der Fakultät für Wissenschaften der Technischen Universität Carolo-Wilhelmina zu Braunschweig zur Erlangung

Mehr

Praktikum Biochemie Einführung in die Molekularbiologie. Bettina Siebers

Praktikum Biochemie Einführung in die Molekularbiologie. Bettina Siebers Praktikum Biochemie Einführung in die Molekularbiologie Bettina Siebers (4) Rekombinante Expression einer Esterase aus Pseudomonas aeruginosa in E. coli Proteinreinigung Techniken & Methoden der Proteinreinigung

Mehr

Regenerative Energiesysteme und Speicher

Regenerative Energiesysteme und Speicher Regenerative Energiesysteme und Speicher Wie lösen wir das Speicherproblem? Robert Schlögl Fritz-Haber-Institut der MPG www.fhi-berlin.mpg.de 1 Einige Grundlagen www.fhi-berlin.mpg.de Atomausstieg ist

Mehr

Physikalisch-Chemisches Grundpraktikum

Physikalisch-Chemisches Grundpraktikum Physikalisch-Cheisches Grundpraktiku Versuch Nuer G3: Bestiung der Oberflächen- spannung it der Blasenethode Gliederung: I. Aufgabenbeschreibung II. Theoretischer Hintergrund III. Versuchsanordnung IV.

Mehr

The German Gas Network Development Plan A contribution towards the effective implementation of the German Energiewende

The German Gas Network Development Plan A contribution towards the effective implementation of the German Energiewende The German Gas Network Development Plan A contribution towards the effective implementation of the German Energiewende Seite 1 Agenda Schedules of the German NDPs for Gas Development of German natural

Mehr

Dissoziation, ph-wert und Puffer

Dissoziation, ph-wert und Puffer Dissoziation, ph-wert und Puffer Die Stoffmengenkonzentration (molare Konzentration) c einer Substanz wird in diesem Text in eckigen Klammern dargestellt, z. B. [CH 3 COOH] anstelle von c CH3COOH oder

Mehr

Michelle Kammel David Speck

Michelle Kammel David Speck Michelle Kammel David Speck 10.07.2013 Was ist bisher bekannt? Zentrum des Signalwegs ist der Ubiquitin Ligase SCF TIR1 Komplex Gray et al. (2001) Abbau der Aux/IAA aktiviert Transkriptionsfaktoren (ARFs)

Mehr

ACT/CVS neueste gendiagnostische Verfahren. 20. THÜRINGER ULTRASCHALLTAGUNG für Frauenärzte 09. Bis 10. November Erfurt K. R. Held

ACT/CVS neueste gendiagnostische Verfahren. 20. THÜRINGER ULTRASCHALLTAGUNG für Frauenärzte 09. Bis 10. November Erfurt K. R. Held ACT/CVS neueste gendiagnostische Verfahren 20. THÜRINGER ULTRASCHALLTAGUNG für Frauenärzte 09. Bis 10. November Erfurt K. R. Held DNA, Gene, Chromosomen DNA besteht aus den Basenpaaren Adenin - Thymin

Mehr

Beispiele zur Multiple-Choice Prüfung in OC

Beispiele zur Multiple-Choice Prüfung in OC 1 Beispiele zur Multiple-Choice Prüfung in C 10 Fragen Typ A Einfachauswahl Bezeichnen Sie nur eine Wahlantwort durch Umkreisen des betreffenden Buchstabens: - bei positiver Formulierung die einzig richtige

Mehr

Molekulare Maschinen bei der Arbeit: Untersuchungen von Proteindynamik mit Einzelmolekül-FRET

Molekulare Maschinen bei der Arbeit: Untersuchungen von Proteindynamik mit Einzelmolekül-FRET Molekulare Maschinen bei der Arbeit: Untersuchungen von Proteindynamik mit Einzelmolekül-FRET Dagmar Klostermeier Biophysikalische Chemie Biozentrum, Uni Basel 10.12.2008 Outline 1. Fluorescence, FRET,

Mehr

Warum man nicht schon in der SDS- Page eine Immunfärbung machen kann. Warum bei A-Tailingzyklus die A s nich immer mehr werden

Warum man nicht schon in der SDS- Page eine Immunfärbung machen kann. Warum bei A-Tailingzyklus die A s nich immer mehr werden Molbi Nachklausur 2009 Hier mal so die Fragen die mir noch so einfallen. Also es war gefragt: Warum man nicht schon in der SDS- Page eine Immunfärbung machen kann. Warum bei A-Tailingzyklus die A s nich

Mehr

Austria Regional Kick-off

Austria Regional Kick-off Austria Regional Kick-off Andreas Dippelhofer Anwendungszentrum GmbH Oberpfaffenhofen (AZO) AZO Main Initiatives Andreas Dippelhofer 2 The Competition SPOT THE SPACE RELATION IN YOUR BUSINESS 3 Global

Mehr

ANALYTISCHE CHEMIE I Trennmethoden 6. Elektrophorese-Methoden Kapillarelektrophorese / Gelelektrophorese WS 2007/2008

ANALYTISCHE CHEMIE I Trennmethoden 6. Elektrophorese-Methoden Kapillarelektrophorese / Gelelektrophorese WS 2007/2008 ANALYTISCHE CHEMIE I Trennmethoden 6. Elektrophorese-Methoden Kapillarelektrophorese / Gelelektrophorese WS 2007/2008 Definition Elektrophorese bezeichnet die Wanderung elektrisch geladener Teilchen durch

Mehr

Erkennung von Protein-kodierenden Genen/Genstruktur

Erkennung von Protein-kodierenden Genen/Genstruktur Erkennung von Protein-kodierenden Genen/Genstruktur Prokaryonten: Konsekutiv (keine Introns- Exons), Suche nach langen ORFs, Operons, Codon-Präferenzen Eurkaryonten: Intron-Exon Struktur Using slides and

Mehr

Untersuchungen zu Struktur-Geruchsbeziehungen von Lactonen

Untersuchungen zu Struktur-Geruchsbeziehungen von Lactonen Untersuchungen zu Struktur-Geruchsbeziehungen von Lactonen vom Fachbereich C (Mathematik und Naturwissenschaften) der Bergischen Universität Wuppertal zur Erlangung des Grades eines Doktors der Naturwissenschaften

Mehr

October 2, 2013 INTRODUCTION TO... presented by CHRISTOPH HERWIG GUENTER ALLMAIER IRINA DRUZHININA

October 2, 2013 INTRODUCTION TO... presented by CHRISTOPH HERWIG GUENTER ALLMAIER IRINA DRUZHININA October 2, 2013 INTRODUCTION TO... presented by CHRISTOPH HERWIG GUENTER ALLMAIER IRINA DRUZHININA 1 Master-Studienplan Technische Chemie Fakultät für Technische Chemie Biochemie II (166.163) Gentechnik

Mehr

Master Biologie Würzburg

Master Biologie Würzburg Master Biologie Würzburg Die nachfolgende Zusammenfassung soll Ihnen helfen, sich kurz über das Bewerbungsverfahren zum Studium Master Biologie an der JMU in Würzburg zu informieren. For further information

Mehr

Einblicke ins Hirn Bildgebende Verfahren in Forschung und Medizin

Einblicke ins Hirn Bildgebende Verfahren in Forschung und Medizin Fortbildungsveranstaltung im Rahmen des Programms Neurowissenschaften in der gymnasialen Oberstufe der Neurowissenschaftlichen Gesellschaft e.v. zum Thema Einblicke ins Hirn Bildgebende Verfahren in Forschung

Mehr

CD30. 2015_FJT_OEGPath 05.03.2015. Bedeutung für Diagnostik und Therapie. Die diagnostische Bedeutung von CD30 Was ist CD30? CD30

CD30. 2015_FJT_OEGPath 05.03.2015. Bedeutung für Diagnostik und Therapie. Die diagnostische Bedeutung von CD30 Was ist CD30? CD30 Bedeutung für Diagnostik und Therapie Bedeutung für Diagnostik und Therapie Was ist Diagnostische Bedeutung von Detektion von als therapeutisches Target Die diagnostische Bedeutung von Was ist? Transmembran

Mehr

Welcome to your success laboratory. BesucherInformationen KLINISCHE DIAGNOSTIK und labormedizin

Welcome to your success laboratory. BesucherInformationen KLINISCHE DIAGNOSTIK und labormedizin Connecting Global Competence BesucherInformationen KLINISCHE DIAGNOSTIK und labormedizin Welcome to your success laboratory. 24. Internationale Leitmesse für Labortechnik, Analytik, Biotechnologie und

Mehr

Komponenten und Aufbau des Immunsystems Initiation von Immunantworten. lymphatische Organe. Erkennungsmechanismen. Lymphozytenentwicklung

Komponenten und Aufbau des Immunsystems Initiation von Immunantworten. lymphatische Organe. Erkennungsmechanismen. Lymphozytenentwicklung Komponenten und Aufbau des Immunsystems Initiation von Immunantworten lymphatische Organe Erkennungsmechanismen Lymphozytenentwicklung Entstehung und Verlauf adaptiver Immunantworten 196 Dendritische Zellen

Mehr

Frequently asked Questions for Kaercher Citrix (apps.kaercher.com)

Frequently asked Questions for Kaercher Citrix (apps.kaercher.com) Frequently asked Questions for Kaercher Citrix (apps.kaercher.com) Inhalt Content Citrix-Anmeldung Login to Citrix Was bedeutet PIN und Token (bei Anmeldungen aus dem Internet)? What does PIN and Token

Mehr

Maschinelles Lernen und Data Mining: Methoden und Anwendungen

Maschinelles Lernen und Data Mining: Methoden und Anwendungen Maschinelles Lernen und Data Mining: Methoden und Anwendungen Eyke Hüllermeier Knowledge Engineering & Bioinformatics Fachbereich Mathematik und Informatik GFFT-Jahrestagung, Wesel, 17. Januar 2008 Knowledge

Mehr

H.Schwab Genetik. Überblick

H.Schwab Genetik. Überblick Überblick Einleitung: Historisches Klassische - Mendel DNA, Aufbau, übergeordnete Strukturen, Konfigurationen, zelluläre Organisation Chromatin, Chromosomenaufbau, Genome Extrachromosomale Elemente, mobile

Mehr

Near Field Communication Security

Near Field Communication Security Near Field Communication Security Michael Roland 28. Mai 2014 Mobile Marketing Innovation Day Wien This work is part of the project High Speed RFID within the EU program Regionale Wettbewerbsfähigkeit

Mehr

The life cycle of caveolae - from assembly to disassembly

The life cycle of caveolae - from assembly to disassembly DISS. ETH NO. 18354 The life cycle of caveolae - from assembly to disassembly A dissertation submitted to ETH ZURICH for the degree of Doctor of Sciences presented by ARNOLD LUDWIG HAYER Dipl. Biotech.,

Mehr

Station 5: Die Mundwerkzeuge der Insekten

Station 5: Die Mundwerkzeuge der Insekten Station 5: Die Mundwerkzeuge der Insekten Was erfährst du an dieser Station? Wie viele Zähne haben eigentlich Insekten? Oder haben sie etwa gar keine? Antworten auf diese und andere Fragen rund um die

Mehr

University of Tirana

University of Tirana University of Tirana Address: Sheshi Nënë Tereza ; www.unitir.edu.al Tel: 04228402; Fax: 04223981 H.-D. Wenzel, Lehrstuhl Finanzwissenschaft, OFU Bamberg 1 University of Tirana The University of Tirana

Mehr

Beschreibungsproblematik von Tagebauen für eine E-PRTR-Bilanzierung

Beschreibungsproblematik von Tagebauen für eine E-PRTR-Bilanzierung Fachbereich D Sicherheitstechnik / Umweltschutz Beschreibungsproblematik von Tagebauen für eine E-PRTR-Bilanzierung MSc. Kai Vaupel 23.10.2014 1. Einführung E-PRTR: Europäisches Schadstofffreisetzungs-

Mehr

Integrale Sanierungsentscheidungen - gemeinsame Betrachtung der Straße und aller Leitungsträger -

Integrale Sanierungsentscheidungen - gemeinsame Betrachtung der Straße und aller Leitungsträger - Göttingen, 25. Februar 2014 Integrale Sanierungsentscheidungen - gemeinsame Betrachtung der Straße und aller Leitungsträger - Bert Bosseler (Prof. Dr.-Ing.) - Wissenschaftlicher Leiter - IKT Institut für

Mehr

Titelbild1 ANSYS. Customer Portal LogIn

Titelbild1 ANSYS. Customer Portal LogIn Titelbild1 ANSYS Customer Portal LogIn 1 Neuanmeldung Neuanmeldung: Bitte Not yet a member anklicken Adressen-Check Adressdaten eintragen Customer No. ist hier bereits erforderlich HERE - Button Hier nochmal

Mehr

Zwischen den Stühlen! Von elearning 1.0 zu elearning 2.0. PD Dr. Christoph Igel Universität des Saarlandes

Zwischen den Stühlen! Von elearning 1.0 zu elearning 2.0. PD Dr. Christoph Igel Universität des Saarlandes Zwischen den Stühlen! Von zu PD Dr. Christoph Igel Universität des Saarlandes Evolution von elearning Bildungspolitik Hochschule Technologie Nutzungsverhalten (Kleimann & Wannemacher, 2004; Downes, 2005;

Mehr

Accounting course program for master students. Institute of Accounting and Auditing http://www.wiwi.hu-berlin.de/rewe

Accounting course program for master students. Institute of Accounting and Auditing http://www.wiwi.hu-berlin.de/rewe Accounting course program for master students Institute of Accounting and Auditing http://www.wiwi.hu-berlin.de/rewe 2 Accounting requires institutional knowledge... 3...but it pays: Lehman Bros. Inc.,

Mehr

Understanding and Improving Collaboration in Distributed Software Development

Understanding and Improving Collaboration in Distributed Software Development Diss. ETH No. 22473 Understanding and Improving Collaboration in Distributed Software Development A thesis submitted to attain the degree of DOCTOR OF SCIENCES of ETH ZURICH (Dr. sc. ETH Zurich) presented

Mehr

Maiswurzelbohrer: Ein Schädling verändert die steirische Landwirtschaft

Maiswurzelbohrer: Ein Schädling verändert die steirische Landwirtschaft Maiswurzelbohrer: Ein Schädling verändert die steirische Landwirtschaft DI Peter Klug und DI Harald Fragner Pflanzenschutzreferat Österreichische Pflanzenschutztage Ossiach, 28. November 2013 Intensive

Mehr

History of Mobility. Sprachniveau: Ca. A2-B2. Stationen im Verkehrshaus

History of Mobility. Sprachniveau: Ca. A2-B2. Stationen im Verkehrshaus History of Mobility Kurzbeschrieb Die zweigeschossige Halle mit einer Ausstellungsfläche von rund 2000 m² beinhaltet ein Schaulager, ein interaktives Autotheater, verschiedenste individuell gestaltete

Mehr

Christ Water Technology Group

Christ Water Technology Group Christ Water Technology Group 1 / 10.10.2002 / Schmitt G. THREE DIVISIONS OF BWT GROUP BWT AG Christ Water Technology Group Aqua Ecolife Technologies FuMA-Tech (Industrial & Municipal Division) (Household

Mehr

Applied Bioinformatics. maria.fischer@i-med.ac.at http://icbi.at/courses/bioinformatics_ex

Applied Bioinformatics. maria.fischer@i-med.ac.at http://icbi.at/courses/bioinformatics_ex Applied Bioinformatics SS 2013 maria.fischer@i-med.ac.at http://icbi.at/courses/bioinformatics_ex Organisatorisches Termine Mo 18.03.2013 RR19 9:00 Di 19.03.2013 RR19 9:00 Mi 20.03.2013 RR19 9:00 Übungsziele

Mehr

Neue diagnostische Verfahren in der Pathologie

Neue diagnostische Verfahren in der Pathologie athologie Bochum Neue diagnostische Verfahren in der athologie Andrea Tannapfel Institut für athologie Ruhr Universität Bochum www.pathologie-bochum.de 32.000 Genes Alternative Splicing mrna Instability

Mehr

SanStore: Kurzanleitung / SanStore: Quick reference guide

SanStore: Kurzanleitung / SanStore: Quick reference guide SanStore Rekorder der Serie MM, MMX, HM und HMX Datenwiedergabe und Backup Datenwiedergabe 1. Drücken Sie die Time Search-Taste auf der Fernbedienung. Hinweis: Falls Sie nach einem Administrator-Passwort

Mehr

Next Generation Service Desk Trends und Entwicklungen, die Ihren Service Desk verändern

Next Generation Service Desk Trends und Entwicklungen, die Ihren Service Desk verändern Next Generation Service Desk Trends und Entwicklungen, die Ihren Service Desk verändern USU World 2015 Peter Stanjeck & Manfred Heinz, USU AG USU AG Forrester proklamiert das Zeitalter des Kunden als langjährigen

Mehr

GESCHÄFTSZAHLEN SCHMACKHAFT ZUBEREITET Franke Kitchen Systems erhöht mit IBM Cognos die Flexibilität bei der Analyse von SAP-Daten

GESCHÄFTSZAHLEN SCHMACKHAFT ZUBEREITET Franke Kitchen Systems erhöht mit IBM Cognos die Flexibilität bei der Analyse von SAP-Daten GESCHÄFTSZAHLEN SCHMACKHAFT ZUBEREITET Franke Kitchen Systems erhöht mit IBM Cognos die Flexibilität bei der Analyse von SAP-Daten Thomas Ehret, Franke Kitchen Systems Group (Aarburg, Schweiz), email:

Mehr