Institut für Forstzoologie und Waldschutz Universität Göttingen, Deutschland

Größe: px
Ab Seite anzeigen:

Download "Institut für Forstzoologie und Waldschutz Universität Göttingen, Deutschland"


1 Institut für Forstzoologie und Waldschutz Universität Göttingen, Deutschland Bozen, Geruchssinn der Insekten: von ökologischen Interaktionen zu molekularen Aspekten Dr. Sergio Angeli Trompete (Ger.), trumpet (Eng.), tromba (It), = from ld High Germanic Trumba Wasser (Ger.), water (Eng.), acqua (It) Aqua dest - Destilliertes Wasser Kneipe (Ger.), pub (Eng.), bar (It.) Kneipe = from Latin cauponula (= capanna, It) Prost (Ger.), cheers (Eng.), evviva (It.) Prost = from Latin prosit (= for your benefit) 1

2 Kartoffel (Ger.), Potato (Eng.), Patata (It.) wild types till 1960 In 1565: potatoes were sent to the Spanish King Italy: tartufolo (It.) (Trüffel, truffle) Germany first: Tartuffel Germany later: Kartoffel today Wechselwirkung Pflanze-Pathogen Pathogen Talking Trees und Crying for help Warum Insektengeruchssinn? Duftkodierung der Insekten Insekten: Perirezeptor-Ereignisse und Zentrale Prozesse dorant Binding Proteins (BPs) und Chemosensory Proteins (CSPs) Insektenantennen als Biosensoren 2

3 Pflanzen ChemoÖkologische Antworten Schadinsekten Prädatoren /Parasitoide Talking Trees (Sprechende Bäume) Crying for help (Hilferufe) Talking Trees Baldwins Experiment Verletzte Pflanzen Versuchspflanzen VCs Luft Kontrollpflanzen Phenole erhöht in verletzten Pflanzen und Kontrollpflanzen. Populus und Acer zeigen den gleichen Effekt. Baldwin I.T. and. Schultz. J.C Rapid changes in tree leaf chemistry induced by damage: evidence for communication between plants. Science 221:

4 Planzliche Signale Lokal Systemisch Talking Trees Planzliche Reaktion auf Befall mit Pathogenen und Schädlingen Verletzte Tomatenblätter synthetisieren PRSYSTEMIN (200 aa) Prosystemin wird verarbeitet zu SYSTEMIN (= 18 aa) Systemin wird im verletzten Blatt freigesetzt und durch das Pholem transportiert. In Zielzellen bindet Systemin vermutlich an Stellen der Plasmamembran und bewirkt die Biosynthese von JASMNSÄURE (=C12) Ruiz-Medrano et al., 2001, Cur pi Plant Biol 4, ; Scheer et al., 2002, PNAS, 99,

5 Jasmonsäure Hat eine zentrale Rolle in der Regulierung der systemischen Pflanzenabwehr bei nahezu allen Pflanzenarten It is an elicitor-inducer, entsteht über Abbau von C18- Fettsäuren (Linolensäure und Linolsäure) in: - C6-Verbindungen wie Grünblattgerüche (VCs), z.b. (Z)-3-Hexenal, Hexanal, (Z)-3-Hexenol, (Z)-3-Hexenylacetat -eine C12-Verbindung, genannt Traumatin oder Wundhormon, das interne Abwehrfunktionen aktiviert Zheng et al Plant Physiology 41(4): ; Engelberth et al., 2004 PNAS 101(6): Crying for help Bei Befall durch herbivore Insekten emittieren Pflanzen Düfte, die Parasitoide oder Prädators anlocken. Diese Chemikalien werden induzierte Synomone genannt. Tabakpflanzen emittieren bei Nacht Duftstoffe, die nachtaktive Falter auf der Suche nach Eiablageplätzen abschrecken. Ryan C.A Nature, 410 (29):

6 !!"#$ Diabrotica virgifera 6

7 β-caryop. Untergrund-lfaktometer Here we report the first identification of an insect-induced belowground plant signal, (E)-β-caryophyllene, which strongly attracts an entomopathogenic nematode. Turlings group, 2005 «Recruitment of entomopathogenic nematodes by insect-damaged maize roots» Nature 434: von Schwerdtfeger F.,

8 %& '### # ( ) $ *!! " # $ %& ' (! 8

9 Warum Insektengeruchssinn? Geruchssinn ist der älteste Sinn der Lebewesen Hauptaufgabe des olfaktorischen Systems ist die Detektion tausender Duftmoleküle Gerüche sind multidimensional, werden aber als Einheit wahrgenommen. Einige generelle Fragen Wie löst das olfaktorische System das komplizierte Problem der Mustererkennung? Nutzt der Geruchssinn viele spezifische Rezeptoren oder wenige, die auf viele Duftstoffe reagieren? Welche Moleküle detektieren die Duftstoffe? Chemosensorische Wahrnehmung bei Säugetieren Nasenhöhle olfaktorische Wahrnehmung (Geruchssinn) bei Insekten farnesene Mundhöhle Gustatorische Wahrnehmung (Geschmackssinn) Coccinellin H H N + CH 3 H (S)-(-) α pinene 9

10 Duftmoleküle +, - C H 3 H 2 C H C H 2 N S 1-octen-3-ol benzaldehyde allyl Isothiocyanate Zahl der Insekten und Evolution 2 mil Homo sapiens 195 mil ältestes Säugetier Collembola 400 mil (älteste landlebende Tiere) 80% aller Spezies sind Insekten 10

11 Der Seidenspinner, Bombyx mori )* +, # ( & -. / 0 % 1 2 ' 3 4 C H 3 H )! 11

12 . / (E,Z)-6,11-esadecadienil acetato Antherea polyphemus (E,Z)-6,11-esadecadienale Antherea polyphemus H (E,Z)-10,12-esadecadienolo Bombyx mori H (E,Z)-10,12-esadecadienale Bombyx mori, Manduca sexta H (E,E,Z)-10,12,14-esadecatrienale Manduca sexta H (7R,8S)-7,8-epossi-2-metil octadecano Lymantria dispar (Z)-11-esadecenale Heliothis virescens H esadecanale Heliothis virescens H (Z)-6-eneicosen-11-one rgia pseudosugata (Z)-13-esadecen-11-inil acetato Thaumetopoea pityocampa (Z)-11-esadecenil acetato Mamestra brassicae (Z)-9- esadecenil acetato Mamestra brassicae (Z)-5-decenil acetato Agrotis segetum (Z)-7-dodecenil acetato Agrotis segetum (Z)-9-tetradecenilacetato Agrotis segetum Wenn ein Schmetterling einen Elefanten liebt! Kelly, Chem. Bio.,

13 ElektroAntennoGraphie (EAG) (Schneider, 1959) Dietrich Schneider, 30/7/ /5/2008 von Franke W. Gaschromatographie Massenspektroskopie und Elektroantennographische Detektion (GC-MS/EAD) aus Weissbecker B. et al

14 Gaschromatographie Massenspektroskopie und Elektroantennographische Detektion (GC-MS/EAD) Antenne von Cis boleti (Coleoptera) Antenne von Suillia mikii (Diptera) 1 1 Antennenreaktion von Cis boleti auf Pilzdüfte GC-MS/EAG EAD 0.05 mv CH 3 H 2 C H GC Thakeow et al., 2008 Chemical Senses Time (min.) 14

15 from Franke W. 15

16 Chemoperzeption von Insekten Struktur eines Insekten-Sensillums Wirbeltier Neuron Neuron Sensillenlymphe Auxillarzellen Steinbrecht et al. 1995; Rogers et al

17 Sensillentypen in der Antenne von S. gregaria Sensillentypen in der Antenne von S. gregaria s. trichodeum s. basiconicum s. s. chaeticum s. coeloconicum lfactorische Signaltransduktion bei Insekten 1) Perirezeptor-Ereignisse Antennallobus 2) Zentrale Prozesse Keller A, Vosshall L.B (2003) Decoding lfaction in Drosophila Curr. pin. Neurobiol. 17

18 Antennallobus von D. melanogaster Antennallobus von Drosophila beinhaltet ~43 Glomeruli Aus der The Hing s Lab: laboratory of olfaction development Internetseite Richard Axel Linda Buck From R. Axel, Nobel Prize ( 18

19 Antennallobus von Apis mellifera Verarbeitung olfaktorischer Reize im Antennallobus der Honigbiene H 1- ctanol octanol Heptanal heptanal 2- heptanone Heptanon H From G. Galizia, Koeln Univ. 19

20 Geruchskodierung Lösliche Globular-Proteine Membran-Proteine -Niedriges Molekulargewicht (14-20 (14-20 kda) kda) --Sauer Sauer (pi (pi = 4-5) 44-5) --Hoch Hochkonzentriert in in der der Sensillenlymphe (10 (10mM )) lfactory Receptors (Rs) 1) 1) dorant-binding Proteins (BP) --6 Cysteine in in konservierter Position 2) 2) Chemosensory Proteins (CSP) --Bindungskapazität wurde wurdegemessen --in in der derlymphe olf. olf. Sensillen lokalisiert --4 Unterklassen: : PBP, PBP, GBP1, GBP2 GBP2 und und ABPX ABPX --dreidimensionale Struktur wurde wurdevor vor kurzem kurzemerforscht --4 Cysteine in in konservierter Position --Bindungungskapazität nur nurin in einem einemfall gemessen --lokalisiert in in der derlymphe of of gustatorischer und und olfaktorischer Sensillen --weniger wenigergut gut charakterisiert Zellaußenraum Duft-Signaltransduktion Sensillen-Cuticula dorant Binding Protein (BP) Sensillenlymphe Phospholipase C Rezeptor 1 Rezeptor 2 Chemosenosry Protein (CSP) Adenylat-Cyclase PIP 3 PLC R1 R2 AC IP 3 α α β γ γ β α α camp IP 3 Cytosol G-Protein-Komplex camp APT IP 3 IC 1 IC 2 IC 3 camp Anregungskanal (depolarisierend) Inhibitorischer Kanal (hyperpolarisierend) Schematische Darstellung biochemischer Aspekte der Geruchs-Signaltransduktion von Arthropoden: Parallele Anregungs- (IP 3 ) und inhibitorische (camp) Kanäle. camp cyclic-3,5 -adenosyl-monophosphate, DAG diacyl glycerol, G-protein complex, IP 3 inositol trisphosphate and PIP 2 phosphatidylinositol-4,5-sphosphate (von Vogt, 1995; modifiziert). 20


22 3-D Struktur von Bombyx mori PBP 3-D Struktur von Bombyx mori PBP Sandler B.H., Nikonova L., Leal W.S. and Clardy J. (2000) Sexual attraction in the silkworm moth: structure of the pheromone-binding-protein-bombykol complex. Chem. Biol. 7(2): B-form, X-ray N N C ph 4.5 C C Horst et al., PNAS USA 98, (2001), Leal et al., A-form, NMR N Bombyx PBP 22

23 Arbeit mit BPs/CSPs: Der Anfang.. Muster löslicher Proteine von Schistocerca gregaria Männchen Weibchen SDS-PAGE 66 kda 45 kda 29 kda 20 kda 14 kda Native-PAGE H T A W L An Mo H T A W L An Mo 23


25 Polyklonale Polyklonale Antikörper Antikörper gegen gegen Sgre-CSP, Sgre-CSP, Ecar-CSP Ecar-CSP and and CmorCSP CmorCSP Western Blot SDS - PAGE anti -S Western blot anti -E anti -C 66 kda 45 kda 29 kda 20 kda 14 kda M S S : Schistocerca gregaria ( tarsi ) E C S E C E : Eurycantha calcarata ( tarsi ) S E C S E C C : Carausius morosus ( tarsi ) Immunozytochemische Immunozytochemische Lokalisierung Lokalisierung von von Sgre-CSP Sgre-CSP Immunofärbung von Sensillen an Antennen (A), Maxillarpalpen (P) und Tarsen (T) mit polyklonalem Antiserum gegen CSP-sg4. Kontakt-Sensillen sind stark gefärbt, lfaktorische Sensillen nicht (nicht gezeigt). Angeli S, Ceron F, Scaloni A, Monti M, Monteforti G, Minnocci A, Petacchi R, Pelosi P (1999) Purification, structural characterization, cloning and immunocytochemical localization of chemoreception proteins from Schistocerca gregaria Eur. J. Biochem. Jun;262(3):

26 Chemosensory Proteins von Eurychanta calcarata (Phasmida) Marchese S, Angeli S, Andolfo A, Scaloni A, Brandazza A, Mazza M, Picimbon J, Leal WS, Pelosi P. (2000) Soluble proteins from chemosensory organs of Eurycantha calcarata. Insect Biochem Mol Biol. 30: Chemosensory Proteins von Carausius morosus (Phasmida) Monteforti G, Angeli S, Petacchi R, Minnocci A. (2002) Ultrastructural characterization of antennal sensilla and immunocytochemical localization of a chemosensory protein in Carausius morosus Brünner (Phasmida: Phasmatidae) Arthropod Structure and Development 30 (3), Identifizierung, Aufreinigung und Klonierung zweier CSPs von Bombyx mori GBP-2 CSP-1 PBP B. B. mori moricsp-1 DDKYTDKYDKINLQEILENKRLLESYMDCVLGKGKCTPEGKELKDHLQEALETGCEKCTEAQEK GAETSIDYLIKNELEIWKELTAHFDPDGKWRKKYEDRAKAKGIVIPE B. B. mori moricsp-2 QDKYEPIDDSFDASEVLSNERLLKSYTKCLLNQGPCTAELKKIKDKIPEALETHCAKCTDKQKQ MAKQLAQGIKKTHPELWDEFITFYDPQGKYQTSFKDFLES Picimbon JF, Dietrich K, Angeli S, Scaloni A, Krieger J, Breer H, Pelosi P. (2000) Purification and molecular cloning of chemosensory proteins from Bombyx mori. Arch Ins. Biochem Physiol. 44:

27 Tribolium castaneum: das erste Genome eines Coleopteren Grün fluoreszierende Protein (GFP) eingefügt ins Tribolium-Genome mrna cdna RT-PCR Insgesamt 47 BPs und 19 CSPs von Tribolium wurden identifiziert : 2008:..., Robertson H.M., Angeli S., Forêt S.,... (2008) The genome of the developmental model beetle and pest Tribolium castaneum, Nature, 452(7190): Zukünftige Ziele RNA-Interferenz EAG, GC-MS-EAD 27

28 $ Danke für Ihre Aufmerksamkeit " $ '7 -,, 7' 28

Lebenslauf Oktober, 2008

Lebenslauf Oktober, 2008 Lebenslauf Oktober, 2008 Dr. Sergio Angeli Abteilung Forstzoologie und Waldschutz Georg-August-Universität Göttingen Rathausplatz 2 Büsgenweg 3 37120 Bovenden 37077 Göttingen, Deutschland Deutschland Tel.:


Olfaktion. Olfaktion

Olfaktion. Olfaktion Olfaktion Emotionen und Verhalten Erinnerung Sozialverhalten Aroma Kontrolle der Nahrung Reviermarkierung Partnerwahl Orientierung in der Umwelt Duftstoffwahrnehmung Axel, R. Spektrum der Wissenschaft,


Chemische Ökologie. Prof. Dr. Georg Pohnert. Lessingstr. 8 Raum 214 Was ist Chemische Ökologie

Chemische Ökologie. Prof. Dr. Georg Pohnert. Lessingstr. 8 Raum 214 Was ist Chemische Ökologie Chemische Ökologie Prof. Dr. Georg Pohnert Lehrstuhl hl für Instrumentelle t Analytik Lessingstr. 8 Raum 214 Was ist Chemische Ökologie Chemical ecology ogy came to be recognized


Kommunikation in Grün

Kommunikation in Grün 5. Internationale Fachtage Ökologische Pflege Kommunikation in Grün Pflanzen und ihre Wechselwirkungen mit der belebten und unbelebten Umwelt Axel Mithöfer MPI für Chemische Ökologie Abtl. Bioorganische


Johannes Gutenberg-Universität Mainz Fachbereich Biologie, Institut für Zoologie Leitung: Prof. Dr. Wolfrum Datum: 15. April 2005

Johannes Gutenberg-Universität Mainz Fachbereich Biologie, Institut für Zoologie Leitung: Prof. Dr. Wolfrum Datum: 15. April 2005 Johannes Gutenberg-Universität Mainz Fachbereich Biologie, Institut für Zoologie Leitung: Prof. Dr. Wolfrum Datum: 15. April 2005 F1 Molekulare Zoologie Teil II: Expressionsanalyse Proteinexpressionsanalyse


Riechen. 1. Die Analyse der Luft in der Nase

Riechen. 1. Die Analyse der Luft in der Nase Riechen 1. Die Analyse der Luft in der Nase Was ist Riechen? Analyse Arom a Entscheidung Erinnerung Sozialverhalten Zwei Riechsysteme: eins für Duftstoffe, eins für Pheromone Quelle: Michael Meredith,


MOL.504 Analyse von DNA- und Proteinsequenzen. Übungsaufgaben Datenbanken und Informationssysteme

MOL.504 Analyse von DNA- und Proteinsequenzen. Übungsaufgaben Datenbanken und Informationssysteme MOL.504 Analyse von DNA- und Proteinsequenzen Übungsaufgaben Datenbanken und Informationssysteme Ü1 Tutorial für NCBI NCBI Nucleotide: Suche nach cellobiose dehydrogenase fungi Ü1 Tutorial für NCBI NCBI


1. Der Geruchssinn Mensch 10 000 Gerüche unterscheiden

1. Der Geruchssinn Mensch 10 000 Gerüche unterscheiden 1. Der Geruchssinn Das Organ des Geruchssinnes ist die mit Geruchsnerven (olfaktorischen Nerven) ausgestattete Riechschleimhaut der Nase. Die Geruchsnerven wirken auch bei der Wahrnehmung verschiedener


G-Protein gekoppelte Rezeptoren

G-Protein gekoppelte Rezeptoren G-Protein gekoppelte Rezeptoren Bedeutung, Funktionen, Liganden Prinzipielle Funktionsmechanismen Klassifizierung und Eigenschaften von G-Proteinen Desensitivierung Beispiele G-Protein gekoppelte Rezeptoren


Allgemeine Pharmakologie

Allgemeine Pharmakologie Allgemeine Pharmakologie Pharmakologie Arzneistoff: Wirkstoff, der zur Vorbeugung, Linderung, Heilung oder Erkennung von Erkrankungen dient Pharmakon: biologisch Wirksame Substanz Lehre von den Wirkungen


Das Paper von heute. Samuel Grimm & Jan Kemna

Das Paper von heute. Samuel Grimm & Jan Kemna Das Paper von heute Samuel Grimm & Jan Kemna Bisheriges Modell Was bereits bekannt war - TIR1 ist an Auxinantwort (Zellteilung, Elongation, Differenzierung) beteiligt, im selben Signalweg wie AXR1 - TIR1


Molekulare Mechanismen der Signaltransduktion

Molekulare Mechanismen der Signaltransduktion Molekulare Mechanismen der Signaltransduktion 07 - Identifizierung von ARF1 + Hinweise für Vorträge Folien: neues Modell


Partielle Sequenzinformation

Partielle Sequenzinformation Analyse der Sequenz Traditionell: Bestimmung einer Teilsequenz, Herstellung einer DNA-Sonde, Klonierung des Gens oder der cdna, Sequenzierung der DNA Keine Information zu PTM Limitiert: Isoformen Heute:



Abbildungsverzeichnis I INHALTSVERZEICHNIS Abkürzungen VI Abbildungsverzeichnis VIII I. Einleitung 1. Neurone und Axonwachstum 1 2. Oligodendrozyten und Myelin 3 3. Das Proteolipid Protein (PLP) 6 4. Mutationen im PLP-Gen und


Dissertation. von Daniel Heiko Niemiiller aus Osterholz-Scharmbeck

Dissertation. von Daniel Heiko Niemiiller aus Osterholz-Scharmbeck Vergleichende Lokalisation der Homospermidin-Synthase, Eingangsenzym der Pyrrolizidin-Alkaloid-Biosynthese, in verschiedenen Vertretern der Boraginaceae Von der Fakultat fur Lebenswissenschaften der Technischen


Drexler G.A. 1, Derer A 1, Dirks W.G. 2, Hable V. 3, Greubel C. 3, Burgdorfer C. 3, Dollinger G. 3, Du G. 4, Friedl A.A. 1

Drexler G.A. 1, Derer A 1, Dirks W.G. 2, Hable V. 3, Greubel C. 3, Burgdorfer C. 3, Dollinger G. 3, Du G. 4, Friedl A.A. 1 Nutzung von bi-cistronischen Vektoren für die Beobachtung der Rekrutierung von Signal- und Reparaturproteinen an DNA-Schäden nach Ionen- Mikrobestrahlung durch Live-Cell Imaging Drexler G.A. 1, Derer A


Trennungsverfahren Techniken (in der Biologie)

Trennungsverfahren Techniken (in der Biologie) Trennungsverfahren Techniken (in der Biologie)? Biomoleküle können getrennt werden aufgrund ihrer - chemischen Eigenschaften: Ladung, Löslichkeit, Wechselwirkung mit spezifischen Reagenzen, Molmasse -


Medienbegleitheft zur DVD 14175. IM BANN DER DÜFTE Parfüm Geschichte und Wirkung

Medienbegleitheft zur DVD 14175. IM BANN DER DÜFTE Parfüm Geschichte und Wirkung Medienbegleitheft zur DVD 14175 IM BANN DER DÜFTE Parfüm Geschichte und Wirkung Medienbegleitheft zur DVD 14175 38 Minuten, Produktionsjahr 2014 Inhaltsverzeichnis 1. Lückentext Funktionen des Geruchssinns...


Zweigbibliothek Medizin

Zweigbibliothek Medizin Sächsische Landesbibliothek - Staats- und Universitätsbibliothek Dresden (SLUB) Zweigbibliothek Medizin Diese Hochschulschrift finden Sie original in Printform zur Ausleihe in der Zweigbibliothek Medizin


Kapitel 4. Das HMO-Modell

Kapitel 4. Das HMO-Modell Kapitel 4 4. HMO-Theorie:!-Elektronensysteme 4.. Die Annahmen der HMO-Theorie, Strukturmatrix 4.2. Butadien als Beispiel 4.3. Analytische Lösung für lineare Ketten UV-vis-Absorption: HMO und Freies Elektronen


Zellbiologie: BSc Arbeiten 15/16

Zellbiologie: BSc Arbeiten 15/16 Zellbiologie: BSc Arbeiten 15/16 Lehrstuhl Zellbiologie: Arbeitsgruppen Prof. Benedikt Kost Prof. Georg Kreimer PD Michael Lebert Slot Zeitraum Anzahl Plätze Semester 1 24.08.15 09.10.15 4 Ferien 2 09.11.15


Genisolierung in 2 Stunden : Die Polymerase-Ketten-Reaktion (PCR)

Genisolierung in 2 Stunden : Die Polymerase-Ketten-Reaktion (PCR) PCR Genisolierung in 2 Stunden : Die Polymerase-Ketten-Reaktion (PCR) von Kary B. Mullis entwickelt (1985) eigentlich im Mai 1983 bei einer nächtlichen Autofahrt erstes erfolgreiches Experiment am 16.12.1983


Spektrale Farbtrennung in der konfokalen Laser Scanning Mikroskopie

Spektrale Farbtrennung in der konfokalen Laser Scanning Mikroskopie 1. Jenaer Workshop Spektralsensorik Spektrale Farbtrennung in der konfokalen Laser Scanning Mikroskopie Dr. Monika Marx Training, Application and Support Center TASC, Carl Zeiss MicroImaging GmbH Carl


Die Funktion flüchtiger Signalstoffe bei der Verteidigung von Pflanzen gegen Schädlinge

Die Funktion flüchtiger Signalstoffe bei der Verteidigung von Pflanzen gegen Schädlinge Degenhardt, Jörg Die Funktion flüchtiger Signalstoffe bei der Verteidigung... Tätigkeitsbericht 2006 Mikrobiologie/Ökologie Pflanzenforschung Die Funktion flüchtiger Signalstoffe bei der Verteidigung von


Allgemeine Psychologie: Sinnesphysiologie. Sommersemester 2008. Thomas Schmidt

Allgemeine Psychologie: Sinnesphysiologie. Sommersemester 2008. Thomas Schmidt Allgemeine Psychologie: Sinnesphysiologie Sommersemester 2008 Thomas Schmidt Folien: Literatur Rosenzweig et al. (2005), Ch. 8-10 Sinnesphysiologie Prinzipien


carbohydrate binding site on laminin responsible for the L2/HNK-1 carbohydrate mediated neural cell adhesion

carbohydrate binding site on laminin responsible for the L2/HNK-1 carbohydrate mediated neural cell adhesion Diss. ETH Nr. 10368 Identification and characterization of the L2/HNK-1 carbohydrate binding site on laminin responsible for the L2/HNK-1 carbohydrate mediated neural cell adhesion ABHANDLUNG Zur Erlangung


Abkürzungsverzeichnis... 7. Inhaltsverzeichnis... 11. Abbildungsverzeichnis... 17. 1 Einleitung... 21 1.1 Proteomik... 21 1.1.1 Proteom...

Abkürzungsverzeichnis... 7. Inhaltsverzeichnis... 11. Abbildungsverzeichnis... 17. 1 Einleitung... 21 1.1 Proteomik... 21 1.1.1 Proteom... Inhaltsverzeichnis Abkürzungsverzeichnis... 7 Inhaltsverzeichnis... 11 Abbildungsverzeichnis... 17 1 Einleitung... 21 1.1 Proteomik... 21 1.1.1 Proteom... 21 1.1.2 Protein-Protein Interaktionen allgemein...


Transcriptomics: Analysis of Microarrays

Transcriptomics: Analysis of Microarrays Transcriptomics: Analysis of Microarrays Dion Whitehead Division of Bioinformatics, Westfälische Wilhelms Universität Münster Microarrays Vorlesungsüberblick : 1. Überblick von Microarray


Ein neues stärke-relevantes Enzym in Arabidopsis thaliana: Die Phosphoglukan-Wasser-Dikinase

Ein neues stärke-relevantes Enzym in Arabidopsis thaliana: Die Phosphoglukan-Wasser-Dikinase Ein neues stärke-relevantes Enzym in Arabidopsis thaliana: Die Phosphoglukan-Wasser-Dikinase RHOMBOS-VERLAG Bibliografische Information Der Deutschen Bibliothek Die Deutsche Bibliothek verzeichnet diese


Die Rolle des NLRP3- Inflammasom in der Pathogenese der idiopathischen pulmonalen Fibrose und Sarkoidose

Die Rolle des NLRP3- Inflammasom in der Pathogenese der idiopathischen pulmonalen Fibrose und Sarkoidose Aus der Medizinischen Universitätsklinik und Poliklinik Abteilung für Pneumologie der Albert-Ludwigs-Universität Freiburg im Breisgau Die Rolle des NLRP3- Inflammasom in der Pathogenese der idiopathischen


Neue DNA Sequenzierungstechnologien im Überblick

Neue DNA Sequenzierungstechnologien im Überblick Neue DNA Sequenzierungstechnologien im Überblick Dr. Bernd Timmermann Next Generation Sequencing Core Facility Max Planck Institute for Molecular Genetics Berlin, Germany Max-Planck-Gesellschaft 80 Institute


Peptide und Membranen

Peptide und Membranen OC 9 Struktur, Eigenschaften und Reaktivität organischer Moleküle Peptide und Membranen Keimbildung, Elongation, Stabilität Armin Geyer Fachbereich Chemie Philipps-Universität Marburg SS 2012


Bioinformatik an der FH Bingen

Bioinformatik an der FH Bingen Bioinformatik an der FH Bingen Prof. Dr. Antje Krause 05.11.2010 Wie alles begann... 1955 erste Proteinsequenz (nach 12 Jahren Arbeit) veröffentlicht (Insulin vom Rind) Frederick Sanger MALWTRLRPLLALLALWPPPPA


Interaktionen von Pu-Signaltransduktionsproteinen im Stickstoffmetabolismus der Organismen Bacillus subtilis und Synechococcus elongatus

Interaktionen von Pu-Signaltransduktionsproteinen im Stickstoffmetabolismus der Organismen Bacillus subtilis und Synechococcus elongatus Interaktionen von Pu-Signaltransduktionsproteinen im Stickstoffmetabolismus der Organismen Bacillus subtilis und Synechococcus elongatus Inaugural-Dissertation zur Erlangung des Doktorsgrades der Naturwissenschaften


Stand von letzter Woche

Stand von letzter Woche RUB ECR1 AXR1 Stand von letzter Woche E2 U? E1-like AXR1 Repressor ARF1 Proteasom AuxRE Repressor wird sehr schnell abgebaut notwendig für Auxinantwort evtl. Substrat für SCF Identifikation des SCF-Ubiquitin



Genexpressionsregulation Genexpressionsregulation Genexpressionsregulation Different tissue types 1 2 3 4 5 6 7 8 Taken from Caron et al., 2001 Verschiedene Ebenen der Genexpressionsregulation Epigenetic mechanisms Transkriptionskontrolle


4.1. Herstellung, Aufreinigung und Nachweis eines CD33-spezifischen IgM-Antikörpers

4.1. Herstellung, Aufreinigung und Nachweis eines CD33-spezifischen IgM-Antikörpers ERGEBNISSE 30 4. Ergebnisse 4.1. Herstellung, Aufreinigung und Nachweis eines CD33-spezifischen IgM-Antikörpers 4.1.1. Herstellung und Aufreinigung des Antikörpers CD33-spezifische IgM-Antikörper wurden


Expressionskontrolle in Eukaryonten

Expressionskontrolle in Eukaryonten Expressionskontrolle in Eukaryonten Warum muss Genexpression kontrolliert werden? 1. Gewebsspezifische Kontrolle - nicht jedes Genprodukt ist in allen Zellen erforderlich - manche Genprodukte werden ausschliesslich


Sequenzanalysen in der Molekularpathologie: Grundlagen des Sequenzierens

Sequenzanalysen in der Molekularpathologie: Grundlagen des Sequenzierens Sequenzanalysen in der Molekularpathologie: Grundlagen des Sequenzierens Wolfgang Hulla KFJ-Sital / SMZ-Süd, Wien Grundlagen Historischer Ausgangspunkt Anwendungen und klinische Relevanz Methodik Auswertung


Assimilierbarer organischer Kohlenstoff Analytik, Bildung und Abbau in Multibarrierensystemen. Urs von Gunten

Assimilierbarer organischer Kohlenstoff Analytik, Bildung und Abbau in Multibarrierensystemen. Urs von Gunten Assimilierbarer organischer Kohlenstoff Analytik, Bildung und Abbau in Multibarrierensystemen Urs von Gunten Fraktionen des organischen Kohlenstoffs Gesamter organischer Kohlenstoff (TC) Gelöster organischer


Heinrich-Heine Universität Düsseldorf. Andreas Möglich. Biophysikalische Chemie Humboldt-Universität zu Berlin

Heinrich-Heine Universität Düsseldorf. Andreas Möglich. Biophysikalische Chemie Humboldt-Universität zu Berlin Heinrich-Heine Universität Düsseldorf 24. März 2014 Andreas Möglich Biophysikalische Chemie Humboldt-Universität zu Berlin 1 Synthetische Biologie 2 Hierarchie biologischer Systeme: 2 Synthetische Biologie


BA63 Zeichensätze/ Character sets

BA63 Zeichensätze/ Character sets BA63 Zeichensätze/ Character sets Anhang/ Appendix We would like to know your opinion on this publication. Ihre Meinung/ Your opinion: Please send us a copy of this page if you have any contructive criticism.


Center for Biotechnology, Bielefeld

Center for Biotechnology, Bielefeld Andreas Albersmeier CeBiTec Bielefeld 3. Life Science Conference Analytik Jena Jena 14.05.2014 Center for Biotechnology, Bielefeld Genomik Transkriptomik Proteomics Metabolomics Genom


Experimentelles Design funktioneller Bildgebungsstudien

Experimentelles Design funktioneller Bildgebungsstudien Experimentelles Design funktioneller Bildgebungsstudien Matthias Gamer Institut für Systemische Neurowissenschaften Universitätsklinikum Hamburg-Eppendorf Übersicht Design funktioneller Aktivierungsstudien


Übung 11 Genregulation bei Prokaryoten

Übung 11 Genregulation bei Prokaryoten Übung 11 Genregulation bei Prokaryoten Konzepte: Differentielle Genexpression Positive Genregulation Negative Genregulation cis-/trans-regulation 1. Auf welchen Ebenen kann Genregulation stattfinden? Definition


Klassische und real-time RT-PCR-Teste

Klassische und real-time RT-PCR-Teste F L I Klassische und real-time RT-PCR-Teste - molekulare Diagnostik aviärer Influenzavirusinfektionen -! "!"#$ % &!'(!!'(! #"#)* +,!"#$!!'(!!'(!-.( /0 * /" * #!$ % & '(!-.(2314415 /'(!2314415 /6'(!2678.5


Ziele und Projektkonzeption

Ziele und Projektkonzeption Molekulare, physiko-chemische und zelluläre Mechanismen der sensorischen (rezeptorvermittelten) Wahrnehmung von Lipiden und Lipoiden sowie deren Einfluss auf die Sättigungsregulation Erkenntnisbasierter


Movie dendritic cell migration_iv_8_2. Komponenten und Aufbau des Immunsystems Initiation von Immunantworten. lymphatische Organe

Movie dendritic cell migration_iv_8_2. Komponenten und Aufbau des Immunsystems Initiation von Immunantworten. lymphatische Organe Komponenten und Aufbau des Immunsystems Initiation von Immunantworten lymphatische Organe Erkennungsmechanismen Lymphozytenentwicklung Entstehung und Verlauf adaptiver Immunantworten T-Zellen gelangen


Klaus Hentrich (Autor) BKAP, ein neu entdecktes Protein, das mit dem C-Terminus des calcium-und spannungsabhängigen Kaliumkanals der Ratte interagiert

Klaus Hentrich (Autor) BKAP, ein neu entdecktes Protein, das mit dem C-Terminus des calcium-und spannungsabhängigen Kaliumkanals der Ratte interagiert Klaus Hentrich (Autor) BKAP, ein neu entdecktes Protein, das mit dem C-Terminus des calcium-und spannungsabhängigen Kaliumkanals der Ratte interagiert Copyright:


HAFAS Booklet Table PDF-Output Frankfurt (Main) Airport - Gießen Bahnhof. Outward. valid from 13.01.2010 to 11.12.2010

HAFAS Booklet Table PDF-Output Frankfurt (Main) Airport - Gießen Bahnhof. Outward. valid from 13.01.2010 to 11.12.2010 PDF-Output Frankfurt (Main) Airport - Gießen Bahnhof valid from 13.01.2010 to 11.12.2010 Outward Traffic notes* Su V101 Mo - Sa V102 Mo - Fr V103 Sa V104 Mo - Fr V103 Mo - Sa V105 Mo - Fr V103 Su V101


Proteinstrukturklassen α-helikale Proteine

Proteinstrukturklassen α-helikale Proteine Proteinstrukturklassen α-helikale Proteine Wintersemester 2011/12 Peter Güntert Domäne Modul Faltung Domäne (domain): Polypeptidkette (oder Teil davon), die unabhängig in eine stabile, kompakte Tertiärstruktur


Quantitative Massenspektrometrie: Anwendungsbeispiele

Quantitative Massenspektrometrie: Anwendungsbeispiele Quantitative Massenspektrometrie: Anwendungsbeispiele 1. Anwendung der Tandem-Massenspektometrie (MS/MS) für die Früherkennung der Phenylketonurie (PKU) im Rahmen des Neonatal- Screening Warum MS/MS zum


Biomembranen Transportmechanismen

Biomembranen Transportmechanismen Transportmechanismen Barrierewirkung der Membran: freie Diffusion von Stoffen wird unterbunden durch Lipidbilayer selektiver Stofftransport über spezielle Membranproteine = Translokatoren Semipermeabilität


Ambrosia in Deutschland -lässt sich die Invasion aufhalten?- Julius Kühn-Institut, Berlin-Dahlem 10.-12.09.2013

Ambrosia in Deutschland -lässt sich die Invasion aufhalten?- Julius Kühn-Institut, Berlin-Dahlem 10.-12.09.2013 Ambrosia in Deutschland -lässt sich die Invasion aufhalten?- Julius Kühn-Institut, Berlin-Dahlem 10.-12.09.2013 Ambrosia artemisiifolia Transkriptom-und Protein-Analysen von Pollen nach erhöhten Ozon-Konzentrationen


Molekulare Mechanismen der Signaltransduktion. 06 - Kartierung des AXR1 Gens + early auxin-induced genes Folien: http://tinyurl.

Molekulare Mechanismen der Signaltransduktion. 06 - Kartierung des AXR1 Gens + early auxin-induced genes Folien: http://tinyurl. Molekulare Mechanismen der Signaltransduktion 06 - Kartierung des AXR1 Gens + early auxin-induced genes Folien: bisheriges Modell auxin auxin AXR1 auxin response AXR1 potentieller


Erschließung des mikrobiellen Synthesepotenzials für die Meisterung der Materialwende

Erschließung des mikrobiellen Synthesepotenzials für die Meisterung der Materialwende Erschließung des mikrobiellen Synthesepotenzials für die Meisterung der Materialwende Prof. Dr. J.M. Köhler Dr. Alexander Groß Instiute for Micro- and Nanotechnology Instiute for Chemistry and Biotechnology


Direct Measurement of Distances and Angles in Biomolecules by NMR in a Dilute Liquid Crystalline Medium [1]

Direct Measurement of Distances and Angles in Biomolecules by NMR in a Dilute Liquid Crystalline Medium [1] Direct Measurement of Distances and Angles in Biomolecules by NMR in a Dilute Liquid Crystalline Medium [1] Nico Tjandra, Ad Bax [1] Science 1997 (278), 1111-1114 National Institutes of Health (NIH) Bethesda,


Evolution & Genetik (Beispiel Hämoglobin) Prof. Dr. Antje Krause FH Bingen 06721 / 409 253

Evolution & Genetik (Beispiel Hämoglobin) Prof. Dr. Antje Krause FH Bingen 06721 / 409 253 Evolution & Genetik (Beispiel Hämoglobin) Prof. Dr. Antje Krause FH Bingen 06721 / 409 253 DNA (Desoxyribonukleinsäure) 5 3 CGATGTACATCG GCTACATGTAGC 3 5 Doppelhelix Basen: Adenin,


Why you should care. by Thomas Krimmer. Thomas Krimmer @ACS Slide 1

Why you should care. by Thomas Krimmer. Thomas Krimmer @ACS Slide 1 Why you should care. by Thomas Krimmer Thomas Krimmer @ACS Slide 1 CAS Publication Record Abstracts (Millions) 1.5 papers per minute Source: CAS helpdesk, Statistical Summary 1907-2007, 02/10/2009 Thomas


Inhalt 1 Modellorganismen

Inhalt 1 Modellorganismen Inhalt 1 Modellorganismen....................................... 1 1.1 Escherichia coli....................................... 1 1.1.1 Historisches...................................... 3 1.1.2 Lebenszyklus.....................................


Western Blot. Zuerst wird ein Proteingemisch mit Hilfe einer Gel-Elektrophorese aufgetrennt.

Western Blot. Zuerst wird ein Proteingemisch mit Hilfe einer Gel-Elektrophorese aufgetrennt. Western Blot Der Western Blot ist eine analytische Methode zum Nachweis bestimmter Proteine in einer Probe. Der Nachweis erfolgt mit spezifischen Antikörpern, die das gesuchte Protein erkennen und daran


Transgene Tiere: Genmodifikation in der Maus

Transgene Tiere: Genmodifikation in der Maus Transgene Tiere: Genmodifikation in der Maus Gentechnik und Genomics WiSe 2007/2008 Kristian M. Müller Institut für Biologie III Albert-Ludwigs-Universität Freiburg Nobelpreis Physiologie und Medizin 2007


Spektroskopische Methoden

Spektroskopische Methoden Spektroskopische Methoden OCIfolie367 MS - Massenspektroskopie (Bestimmung von Molekulargewichten, charakteristischen Fragmentierungen von Molekülen) Absorptionsspektroskopische Methoden (Absorption =


Evidence of strobilurine resistant isolates of A. solani and A. alternata in Germany

Evidence of strobilurine resistant isolates of A. solani and A. alternata in Germany Technische Universität München Evidence of strobilurine resistant isolates of A. solani and A. alternata in Germany H. Hausladen, B. Adolf and J. Leiminger outline introduction material and methods results


DNA Isolierung. Praktikum Dr. László Kredics

DNA Isolierung. Praktikum Dr. László Kredics Isolierung Praktikum Dr. László Kredics Aufgabe: Isolierung von Plasmid aus Bakterienzellen Plasmid : pbluescript Vektor, Gröβe: 2960 Bps 1. 1,5 ml Bakterienkultur in Eppendorf-Röhrchen pipettieren, 2


Modul biol113 Zellbiologie - Nachweis von mitochondrialem Import

Modul biol113 Zellbiologie - Nachweis von mitochondrialem Import Modul biol113 Zellbiologie - Nachweis von mitochondrialem Import Einführung Ein grundlegendes Problem der Zellbiologie ist es, die korrekte zelluläre Lokalisation eines Peptides zu bestimmen. Durch den


Type of Course/ Art der Lehrveranstaltung

Type of Course/ Art der Lehrveranstaltung Courses until the first state examination (term 1 to 4)/Grundstudium Titel der Chemistry for pharmacists (I) Chemie für Pharmazeuten (I) Chemistry for pharmacists (II) Chemie für Pharmazeuten (II) Pharmaceutical


Immunologische Methoden und Enzymassays

Immunologische Methoden und Enzymassays Immunologische Methoden und Enzymassays 1. Antikörper (Ak) Aufbau, Struktur monoklonale und polyklonale Ak 2. Immunpräzipitation 3. Affinitätschromatographie 4. Immundetektion 5. Immunblot 6. Immunhistochemie


Entwicklungsbiologie Master-Module. (bzw. 9 + 3)

Entwicklungsbiologie Master-Module. (bzw. 9 + 3) Entwicklungsbiologie Master-Module (bzw. 9 + 3) Entwicklungsbiologie Master-Module Block 3 Ebio I Evolution von Musterbildung und Gametogenese Mikroinjektion von Tribolium-Embryonen zur Proteinlokalisierung


Q1 B1 KW 49. Genregulation

Q1 B1 KW 49. Genregulation Q1 B1 KW 49 Genregulation Transkription Posttranskription elle Modifikation Genregulation bei Eukaryoten Transkriptionsfaktoren (an TATA- Box) oder Silencer (verringert Transkription) und Enhancer (erhöht


Was ist Wirkstoffdesign?

Was ist Wirkstoffdesign? Was ist Wirkstoffdesign? Eine Einführung für Nicht-Fachleute Arzneimittel hat vermutlich schon jeder von uns eingenommen. Vielleicht hat sich der eine oder andere dabei gefragt, was passiert eigentlich


Die Abwehr von Fressfeinden: Selbstverteidigung im Pflanzenreich

Die Abwehr von Fressfeinden: Selbstverteidigung im Pflanzenreich Vierteljahrsschrift der Naturforschenden Gesellschaft in Zürich (2002) 147/4: 141 150 Die Abwehr von Fressfeinden: Selbstverteidigung im Pflanzenreich Andreas Schaller, Zürich Zusammenfassung Das Antlitz


Standardisierung der serologischen Immundiagnostik. Möglichkeiten, Grenzen, Perspektiven

Standardisierung der serologischen Immundiagnostik. Möglichkeiten, Grenzen, Perspektiven Standardisierung der serologischen Immundiagnostik Möglichkeiten, Grenzen, Perspektiven Grundproblem Vielfalt der Antikörper Vielfalt der Antigene Problem: Messung von Antigenspezifischen Antikörpern Antikörper


BMP / TGF-ß Receptor. Prof. Dr. Albert Duschl

BMP / TGF-ß Receptor. Prof. Dr. Albert Duschl BMP / TGF-ß Receptor Prof. Dr. Albert Duschl Biologische Regelsysteme Behalten Sie bitte im Gedächtnis, daß biologische Systeme immer wieder vor vergleichbaren Aufgaben stehen, bei denen es darum geht,


Nachweis von Antikörpern gegen porzine Influenza A Viren Ergebnisse eines Ringtests Untersuchungen von Feldproben. V. Herwig, C. Laue, R.

Nachweis von Antikörpern gegen porzine Influenza A Viren Ergebnisse eines Ringtests Untersuchungen von Feldproben. V. Herwig, C. Laue, R. Nachweis von Antikörpern gegen porzine Influenza A Viren Ergebnisse eines Ringtests Untersuchungen von Feldproben V. Herwig, C. Laue, R. Dürrwald Haemagglutinationshemmungstest Nachweis von Antikörpern


550 Jahre Albert-Ludwigs-Universität Freiburg

550 Jahre Albert-Ludwigs-Universität Freiburg 550 Jahre Albert-Ludwigs-Universität Freiburg Band 4 Wegweisende naturwissenschaftliche und medizinische Forschung VERLAG KARL ALBER A 36 Lockstoff-Fallen für das Borkenkäfer-Management Jean-Pierre Vit


Identifizierung von Bindungspartnern der Acyl-Protein-Thioesterase 1 (APT 1) unter Verwendung eines anti-hapt 1 Antikörpers

Identifizierung von Bindungspartnern der Acyl-Protein-Thioesterase 1 (APT 1) unter Verwendung eines anti-hapt 1 Antikörpers Präsentation zur Bachelorarbeit Identifizierung von Bindungspartnern der Acyl-Protein-Thioesterase 1 (APT 1) unter Verwendung eines anti-hapt 1 Antikörpers Michael Thomas Reinartz 28.3.2008 Übersicht Einführung


Role of CXCR4 and Gab1 in the development of muscle precursor cells

Role of CXCR4 and Gab1 in the development of muscle precursor cells Role of CXCR4 and Gab1 in the development of muscle precursor cells Dissertation zur Erlangung des akademischen Grades des Doktors der Naturwissenschaften (Dr. rer. nat.) eingereicht im Fachbereich Biologie,


Milenia Hybridetect. Detection of DNA and Protein

Milenia Hybridetect. Detection of DNA and Protein Milenia Hybridetect Detection of DNA and Protein Firmenprofil und Produkte Milenia Biotec GmbH ist im Jahr 2000 gegründet worden. Die Firma entwickelt, produziert, vermarktet und verkauft diagnostische


Inhaltsverzeichnis. 1 Einleitung... 1

Inhaltsverzeichnis. 1 Einleitung... 1 Inhaltsverzeichnis 1 Einleitung... 1 1.1 G-Protein-gekoppelte Rezeptoren... 3 1.1.1 Klassifizierung und Struktur von G-Protein-gekoppelten Rezeptoren... 6 1.1.2 Purinerge Rezeptoren... 12 1.1.3 Pharmazeutische


Controlling the Surface Properties of Nanoparticles Bioorganically modified Nanoparticles for Cell Signaling (NANOCYTES)

Controlling the Surface Properties of Nanoparticles Bioorganically modified Nanoparticles for Cell Signaling (NANOCYTES) Surfaces and Interfaces NANCYTES Engineering at the Nanoscale, DECHEMA, 9. März 2005 Controlling the Surface Properties of Nanoparticles Bioorganically modified Nanoparticles for Cell Signaling (NANCYTES)


AVANTEK. Indoor HDTV Antenna DVB-T Zimmerantenne. Instruction Manual Bedienungsanleitung

AVANTEK. Indoor HDTV Antenna DVB-T Zimmerantenne. Instruction Manual Bedienungsanleitung AVANTEK Indoor HDTV Antenna DVB-T Zimmerantenne Instruction Manual Bedienungsanleitung EN 1 Illustration AC Adapter Connecting Box EN 2 Product Introduction This indoor antenna brings you access to free


Psoriasin is a major Escherichia coli-cidal factor of the female genital tract

Psoriasin is a major Escherichia coli-cidal factor of the female genital tract Psoriasin is a major Escherichia coli-cidal factor of the female genital tract Mildner M, Stichenwirth M, Abtin A, Eckhart L, Sam C, Gläser R, Schröder JM, Gmeiner R, Mlitz V, Pammer J, Geusau A, Tschachler


Exercise (Part XI) Anastasia Mochalova, Lehrstuhl für ABWL und Wirtschaftsinformatik, Kath. Universität Eichstätt-Ingolstadt 1

Exercise (Part XI) Anastasia Mochalova, Lehrstuhl für ABWL und Wirtschaftsinformatik, Kath. Universität Eichstätt-Ingolstadt 1 Exercise (Part XI) Notes: The exercise is based on Microsoft Dynamics CRM Online. For all screenshots: Copyright Microsoft Corporation. The sign ## is you personal number to be used in all exercises. All


Design-to-Target: Optimierte Innovationsvorhaben im Oberflächenbereich.! Your specialist for surface modifications and characterization!

Design-to-Target: Optimierte Innovationsvorhaben im Oberflächenbereich.! Your specialist for surface modifications and characterization! Design-to-Target: Optimierte Innovationsvorhaben im Oberflächenbereich.! Your specialist for surface modifications and characterization! Agenda! Vorstellung Referenten! Vorstellung SuSoS und Xirrus! Innovationsvorhaben!


How-To-Do. Communication to Siemens OPC Server via Ethernet

How-To-Do. Communication to Siemens OPC Server via Ethernet How-To-Do Communication to Siemens OPC Server via Content 1 General... 2 1.1 Information... 2 1.2 Reference... 2 2 Configuration of the PC Station... 3 2.1 Create a new Project... 3 2.2 Insert the PC Station...


Fächerverbindender/ 23.03.2010. Studienseminar für Gymnasien Heppenheim Fachseminar Chemie Examenssemester 2010

Fächerverbindender/ 23.03.2010. Studienseminar für Gymnasien Heppenheim Fachseminar Chemie Examenssemester 2010 Duftstoffe 23.03.2010 Fächerverbindender/ Fachübergreifender Unterricht Studienseminar für Gymnasien Heppenheim Fachseminar Chemie Examenssemester 2010 Seminarleitung: Referenten: Herr Dr. Gräber Anske


1. Einleitung S. 1 1.1. Zelladhäsionsmoleküle S. 1 1.2. Die Immunglobulin-Superfamilie S. 2. 1.2.1. Das neurale Zelladhäsionsmolekül NCAM S.

1. Einleitung S. 1 1.1. Zelladhäsionsmoleküle S. 1 1.2. Die Immunglobulin-Superfamilie S. 2. 1.2.1. Das neurale Zelladhäsionsmolekül NCAM S. Inhaltsverzeichnis 1. Einleitung S. 1 1.1. Zelladhäsionsmoleküle S. 1 1.2. Die Immunglobulin-Superfamilie S. 2 1.2.1. Das neurale Zelladhäsionsmolekül NCAM S. 4 Molekulare Struktur von NCAM S.


Geballte Kompetenz im Life Science Bereich: SERVA & OMNILAB starten Vertriebskooperation. Flexibel. Verlässlich. Persönlich.

Geballte Kompetenz im Life Science Bereich: SERVA & OMNILAB starten Vertriebskooperation. Flexibel. Verlässlich. Persönlich. K O M P E T E N Z I M L A B O R Jetzt bestellen und Vorteil sichern! Geballte Kompetenz im Life Science Bereich: SERVA & OMNILAB starten Vertriebskooperation Flexibel. Verlässlich. Persönlich. Ab sofort


Übungsfragen Biochemie 1. Erklären Sie die Begriffe

Übungsfragen Biochemie 1. Erklären Sie die Begriffe Übungsfragen Biochemie 1 Erklären Sie die Begriffe Adsorption Diffusion Dialyse Enantiomere Diastereomere Verseifung Fett Lipid essentielle Fettsäure essentielle Aminosäure Kohlenhydrat Disaccharid Peptid


Mach-mit-Labor. Biochemie Prof. Rita Bernhardt

Mach-mit-Labor. Biochemie Prof. Rita Bernhardt Mach-mit-Labor Biochemie Prof. Rita Bernhardt Das Mach-mit-Labor Das Mach-mit-Labor (Betreiberin Prof. Dr. R. Bernhardt) bietet seit 2002 naturwissenschaftlich interessierten SchülerInnen die Möglichkeit,


Numerical analysis of the influence of turbulence on the exchange processes between porous-medium and free flow

Numerical analysis of the influence of turbulence on the exchange processes between porous-medium and free flow Numerical analysis of the influence of turbulence on the exchange processes between porous-medium and free flow T. Fetzer Institut für Wasser- und Umweltsystemmodellierung Universität Stuttgart January


Schlussbericht zur Studienwoche Biologie und Medizin vom 17. 23. März 2013

Schlussbericht zur Studienwoche Biologie und Medizin vom 17. 23. März 2013 Schlussbericht zur Studienwoche Biologie und Medizin vom 17. 23. März 2013 Projekt: Zellbiologie: Expression und Reinigung der onkogenen Kinase Abl an der Ecole Polytechnique Fédérale de Lausanne, EPFL


Antigen Receptors and Accessory Molecules of T Lymphocytes

Antigen Receptors and Accessory Molecules of T Lymphocytes Immunologie II Antigen Receptors and Accessory Molecules of T Lymphocytes Chapter 7 - Cellular and Molecular Immunology, Abbas-Lichtman-Pillai 6th edition Leslie Saurer Institut für Pathologie (Prof. Christoph


Herstellung monoklonaler und polyklonaler Antikörper gegen 1,4-Benzodiazepine zum empfindlichen Nachweis in biologischem Probenmaterial

Herstellung monoklonaler und polyklonaler Antikörper gegen 1,4-Benzodiazepine zum empfindlichen Nachweis in biologischem Probenmaterial Herstellung monoklonaler und polyklonaler Antikörper gegen 1,4-Benzodiazepine zum empfindlichen Nachweis in biologischem Probenmaterial Den naturwissenschaftlichen Fakultäten der Friedrich-Alexander-Universität


G-Protein gekoppelte Rezeptoren. Genomische Datenanalyse 3. Kapitel

G-Protein gekoppelte Rezeptoren. Genomische Datenanalyse 3. Kapitel G-Protein gekoppelte Rezeptoren Genomische Datenanalyse 3. Kapitel Proteinsequenzen: Eine andere Form genomischer Daten MEEPGAQCAPPPPAGSETWVPQANL SSAPSQNCSAKDYIYQDSISLPWKV LLVMLLALITLATTLSNAFVIATVY RTRKLHTPANYLIASLAVTDLLVSI






DAS METABOLOM: ERNÄHRUNGSSTATUS, METABOLISMUS, METABOLITEN DAS METABOLOM: ERNÄHRUNGSSTATUS, METABOLISMUS, METABOLITEN Das Metabolom Extrinsiche Faktoren Ernährung (Nährstoffe und nicht nutritive Lebensmittelinhaltsstoffe) Arzneimittel Physische Aktivität Darmflora


2 Grundlagen der Photochemie

2 Grundlagen der Photochemie folie191 2 Grundlagen der Photochemie 2.1 UV-Vis-Absorptionsspektren in organischen Verbindungen; Jablonski-Diagramm, Franck-Condon-Prinzip, Emissionsspektren (Fluoreszens, Phosphoreszens, Stokes-Verschiebung)


Wissenschaftliche Angestellte, Laborleitung Geburtsdatum, Nationalität: 28.04.1973, deutsch

Wissenschaftliche Angestellte, Laborleitung Geburtsdatum, Nationalität: 28.04.1973, deutsch Forschungsbericht über das Projekt Einfluss der TLR3-Aktivierung des retinalen Pigmentepithels auf das Verhalten von Makrophagen, gefördert durch die DOG im Rahmen der Forschungsförderung innovativer wissenschaftlicher
