Struktur, Funktion und Interaktion von Membranproteinkomponenten des cyanobakteriellen Elektronentransportes in Thermosynechococcus elongatus BP-1

Save this PDF as:
 WORD  PNG  TXT  JPG

Größe: px
Ab Seite anzeigen:

Download "Struktur, Funktion und Interaktion von Membranproteinkomponenten des cyanobakteriellen Elektronentransportes in Thermosynechococcus elongatus BP-1"

Transkript

1 Struktur, Funktion und Interaktion von Membranproteinkomponenten des cyanobakteriellen Elektronentransportes in Thermosynechococcus elongatus BP-1 Dissertation zur Erlangung des Grades eines Doktors der Naturwissenschaften der Fakultät für Biologie der Ruhr-Universität Bochum angefertigt am Lehrstuhl für Biochemie der Pflanzen vorgelegt von Meike Gendrullis aus Hattingen Bochum 2008

2 meiner Oma Immi gewidmet

3 Inhaltsverzeichnis I 1. Einleitung Bedeutung und Ursprung der Photosynthese Thermosynechococcus elongatus Photosynthese und Respiration in Cyanobakterien Der photosynthetische Elektronentransport linearer photosynthetischer Elektronentransport zyklischer photosynthetischer Elektronentransport respiratorischer Elektronentransport Der cyanobakterielle Plastochinon Pool Die Cytochrom bd Oxidase in E. coli Die Cytochrome bd Oxidase in Cyanobakterien Der Cytochrom b 6 f Komplex (Plastochinol-Plastocyanin-Oxidoreduktase) PetP eine kleine Untereinheit des cyanobakteriellen Cyt b 6 f Komplexes Ziele der Arbeit Material und Methoden Materialien Verwendete Chemikalien Geräte und Verbrauchsmaterialien Enzyme Standards für DNA- und Protein-Elektrophorese Mikrobiologische Methoden Steriles Arbeiten Escherichia coli und seine Handhabung Bakterienstämme Anzucht und Lagerung von E. coli Herstellung kompetenter E. coli-zellen Transformation von E. coli mittels Hitzeschock Heterologe Expression von PetP-His aus T. elongatus in E. coli Heterologe Expression der Cyt. bd Oxidase aus T. elongatus in E. coli Thermosynechococcus elongatus und seine Handhabung Verwendete Stämme Medien, Anzucht und Lagerung Kulturen für Langzeitlagerung Bestimmung der Zelldichte Transformation von T. elongatus mittels Elektroporation... 35

4 Inhaltsverzeichnis II Segregation des T. elongatus-genoms Nickel-Induktion der T. elongatus cyda-[pdg9]-mutante Molekularbiologische Arbeiten Plasmidpräparationen Präparation von DNA aus Cyanobakterien Präparation genomischer DNA aus Thermosynechococcus elongatus Schnellpräparation von DNA aus Cyanobakterien Konzentrations- und Reinheitsbestimmung einer DNA-Lösung Konzentration und Reinheit einer DNA-Lösung Abschätzen der DNA-Konzentration durch die Fluoreszenzintensität Agarose-Gelelektrophorese von DNA-Fragmenten DNA-Extraktion aus Agarosegelen Fällung von DNA Ethanol-Fällung von DNA Ammoniumacetat-Fällung von DNA Enzymatische Modifikation von DNA Restriktion von DNA durch Restriktionsendonukleasen Modifikation überhängender DNA-Enden Dephosphorylierung von DNA Ligation Polymerasekettenreaktion DNA-Sequenzierung Segregations-Überprüfung des rekombinaten T. elongatus-genoms RNA-Isolierung aus Thermosynechococcus elongatus DNase-Verdau der isolierten RNA Reverse Transkription Quantitative Real time PCR Analysen Transkript Quantifizierung Verwendete Plasmide Proteinbiochemische Methoden Präparation von Thylakoidmembranen aus T. elongatus Reinigung von heterolog exprimiertem PetP mittels Gravitationchromatographie Präparationen von Membranen aus E. coli Aufreinigung des überexprimiertem PetP-Proteins mittels FPLC... 50

5 Inhaltsverzeichnis III Reinigung der heterolog exprimierten Cyt bd Oxidase Reinigung von Antikörpern Nachweis von Proteinen SDS-PAGE (nach Laemmli, 1970) Blotten von Polyacrylamidgelen Färben von Blotmembranen mit Ponceau S Western-Blot mit proteinspezifischem Antikörper Verwendete Antikörper Proteinfällung mit Trichloressigsäure (TCA) Proteinbestimmung Biophysikalische Methoden UV/Vis-Spektroskopie Absorptionsspektren ganzer Zellen Bestimmung der Chlorophyllkonzentration K-Fluoreszenzemissionsspektroskopie P700 Messungen Fluoreszenzinduktion Cytochrom f Absorptions Kinetik Polarographische Messungen Verwendete Computerprogramme Ergebnisse PetP potentielle Untereinheit des Cytochrom b 6 f-komplexes Isolierung des homolog exprimierten PetP-His aus T. elongatus Optimierung der Reinigung des PetP-His-Proteins aus der Mutante T. elongatus-[petp-his] Klon Reinigung des heterolog exprimierten PetP Optimierung der Reinigung des heterolog exprimierten PetP Charakterisierung der T. elongatus petp-mutante Fluoreszenzinduktionsmessungen cydb Transkript Quantifizierung mittels qrt-pcr Cytochrom f- und P700-Reduktionskinetiken Charakterisierung der cyanobakteriellen Cytochrom bd Oxidase Peptid-Antikörper-Synthese Nachweis der Cytochrom bd Oxidase aus T. elongatus Funktionelle Analyse der Cyt bd Oxidase im T. elongatus Wildtyp... 81

6 Inhaltsverzeichnis IV cyda und cydb Transkript Quantifizierung mittels qrt-pcr Heterologe Expression der Cyt bd Oxidase in E. coli Reinigung des rekombinanten CydAB-Proteins Erstellung einer T. elongatus cyda-mutante Wachstumskurven der T. elongatus cyda-mutante Genomische Komplementation der T. elongatus cyda-mutante Nickel-induzierte Cytochrom bd Oxidase-Expression in der T. elongatus cyda-komplementationsmutante Funktionelle Analyse der Cyt bd Oxidase im Wildtyp, der cyda Mutante sowie der cyda [pdg6]-komplementationsmutante Erstellung einer T. elongatus cyda/ petp-doppelmutante Wachstumskurven der cyda/ petp-doppelmutante Cytochrom f- und P700-Reduktionskinetiken Chlorophyll-Fluoreszenzmessung am Photosystem Diskussion Genomische Komplementation in T. elongatus PetP- eine potentielle Untereinheit des Cyt b 6 f Komplexes?! Expression und Reinigung des PetP-Proteins Analyse der Funktion des PetP-Proteins Reinigung der heterolog exprimierten Cyt bd Oxidase Nachweis, Funktion, Regulation der cyanobakteriellen Cyt bd Oxidase Ausblick Zusammenfassung Abbildungen Tabellen Literatur

7 Abkürzungen V Abkürzungen Å Angström [0,1nm] AB Antibiotikum A. bidest zweifach destilliertes Wasser Amp Ampicillin AP Alkalische Phosphatase APS Ammoniumperoxodisulfat AS ATP BCIP Aminosäure Adenosintriphosphat 5-Brom-4-chlor-3-indolylphosphat β-dm Bromphenolblau β-dodecylmaltosid 3,3,5,5 -Tetrabromophenolsulffophthalein b H b-typ Häm des Cyt b 6 f Komplexes High Potential b L b-typ Häm des Cyt b 6 f Komplexes Low Potential bp Basenpaar BSA Rinderserumalbumin (borine serum albumine) C CAPSO Grad Celsius 3-(Cyclohexylamino)-1-Propansulfonsäure Chl CIAP Chlorophyll calf intestine alkaline phosphatase, alkalische Phosphatasse cm Zentimeter Cm CTAB Chloramphenicol Hexadecyltrimethylammoniumbromid Cyt Da Cytochtrom Dalton Differenz, Deletion DCMU 3-[3,4-Dichlorphenyl]-1,1dimethylharnstoff DBMIB 2,5-Dibromo-3-methyl-6-Isopropyl-p-benzochinon DMSO Dimethylsulfoxid DNA Desoxyribonucleinsäure DNase dntp Desoxyribonuklease Desoxyrobonukleotid E EDTA Einstein (1 Mol Photonen) Ethylendinitrotetraessigsäure Ethidiumbromid 3,8-Diamino-5-ethyl-6-phenylphenanthridiniumbromid e - Elektron ε Extinktionskoeffizient Fd Ferredoxin FeS Eisen-Schwefel-Zentrum FNR Ferredoxin-NADP + -Reduktase FPLC Fast-Protein-Liquid-Chromatographie FQR Ferredoxin,Plastochinon-Reduktase g Gramm h His-tag Stunde Histidin-tag Hepes N-2-Hydroxyethylpiperazine-n -2-ethansulfonsäure IPTG Isopropyl-β-D-thiogalactopyranosid Isoamylalkohol 3-Methyl-1-butanol kb Kilobasen Km Kanamycin LHC light harvesting complex (Lichtsammelkomplex)

8 Abkürzungen VI M Molar min Minute mrna MW messenger RNA Molekulargewicht NAD(P) + Nikotinamidadenindinukleotid(phosphat), oxidiert NAD(P)H + H + Nikotinamidadenindinukleotid(phosphat), reduziert NBT Nitrotetrazoliumblau nm Nanometer O 2 OD Sauerstoff optische Dichte ORF open reading frame, offener Leserahmen oriv orit vegetativer Replikationsursprung Transferreplikationsursprung Pc Plastocyanin PCC Pasteur Culture Collection PCR P680 polymerase chain reaction, Polymerasekettenreaktion Reaktionszentrum des Photosystems 2 P700 Reaktionszentrum des Photosystems 1 pet Gene, die für am photosynthetischen Elektronentransport beteiligte Proteine kodieren PMSF Phenylmethylsulfonylfluorid PQ Plastochinon qrt-pcr quantitative Real time PCR PS2 Photosystem 2 PS 1 Photosystem 1 PVDF Polyvinylidenflourid RNase Ribonuklease rpm Umdrehungen pro Minute RT Raumtemperatur s Sekunde SDS Natriumdodecylsulfat PAGE Polyakrylamidgelelektrophorese Tab. Tabelle TEMED N,N,N,N -Tetramethylethylendiamin TLCK Tosyllysylchloromethylketon Tris Tris-Hydroxymethyl-Aminoethan ü. N. über Nacht V Volt Vol Volumen v/v Volumen pro Volumen WT Wildtyp w/v Gewicht pro Volumen

9 Einleitung 1 1. Einleitung 1.1 Bedeutung und Ursprung der Photosynthese Eines der bedeutendsten Ereignisse der Evolution stellt die Entstehung der Photosynthese dar. Das Leben auf der Erde, wie wir es kennen, wäre ohne den Prozess der Photosynthese unvorstellbar und auf diese Art und Weise nicht möglich. Das Prinzip der Photosynthese beruht auf der Umsetzung der Energie des Sonnenlichtes in chemische fixierte Energie, die in Form von Energie- und Reduktionsäquivalenten gespeichert wird. Die photosynthetischen Reaktionen sind an eine Reihe von Proteinkomponenten gekoppelt, die sich in und an den Thylakoidmembranen der photosynthetisch aktiven Organismen befinden. Die Thylakoidmembranen sind bei eukaryotischen Algen und höheren Pflanzen in speziellen Organellen, den Chloroplasten lokalisiert. Bei Cyanobakterien liegen die Thylakoidmembranen dagegen ohne Kompartimentierung frei im Cytoplasma. Abbildung 1-1 Elektronenmikroskopische Aufnahme von Synechocystis sp. PCC 6803 Durch die Prozesse, die in den Reaktionszentren der Photosynthese stattfinden, entsteht ein Elektronendefizit, das für die Wiederherstellung der Reaktionsfähigkeit ausgeglichen werden muss. In Abhängigkeit des Elektronendonors, der dabei verwendet wird, differenziert man zwischen oxygener und anoxygener Photosynthese. Bei der anoxygenen Photosynthese, die man in photosynthetischen Bakterien findet, dienen Schwefelwasserstoff oder organische Verbindungen als Elektronendonoren. Bei der oxygenen Photosynthese, die bei höheren Pflanzen, eukaryotischen Algen und Cyanobakterien auftritt, fungiert dagegen Wasser als Elektronendonor und es

10 Einleitung 2 wird elementarer Sauerstoff als Nebenprodukt gebildet. Den Grundstein der prähistorischen Evolution der Photosynthese bilden die grünen Schwefelbakterien, die zu den anaeroben phototrophen Bakterien (Rhodospirillales) gehören und vor über 3,5 Milliarden Jahren die ersten phototrophen Organismen ausmachten (Stritzke, 1995). Der Ablauf der photosynthetischen Reaktionen dieser Bakterien ist deutlich einfacher als der Ablauf der photosynthetischen Reaktionen höherer Pflanzen, da der photosynthetische Elektronentransport nur über ein Reaktionszentrum läuft (Heldt, 1999). Die einzigen Bakterien, die die Fähigkeit zur oxygenen Photosynthese haben, sind die Cyanobakterien, deren ersten fossilen Funde aus präkambrischen Ablagerungen isoliert wurden und sich auf ungefähr 3,1 Milliarden Jahre zurückdatieren lassen (Helms, 1980; Strother, 1989). Dabei scheinen die fossilen Cyanobakterien den gegenwärtigen Cyanobakterien sehr ähnlich zu sein (Castenholz, 1992). In Abbildung 1-1 ist eine elektronenmikroskopische Aufnahme des mesophilen Cyanobakteriums Synechocystis sp. PCC 6803 (Synechocystis) dargestellt. Die evolutionäre Entwicklung der oxygenen Photosynthese der Cyanobakterien führte zur Anreicherung von Sauerstoff in der Erdatmosphäre, die bis dahin überwiegend aus CO 2, molekularem Wasserstoff, Methan, Ammoniak, Blausäure und Wasser bestand (Heldt, 1999). Durch den Anstieg des Sauerstoffgehaltes in der Atmosphäre konnte sich die lebenswichtige Ozonschicht ausbilden. Weiterhin konnten sich Lebensformen entwickeln, denen Sauerstoff als terminaler Elektronenakzeptor bei der Respiration dient. Abbildung 1-2 Proteinkomponenten der photosynthetischen Elektronentransportkette in der Thykaloidmembran. PS2: Photosystem 2; PS1: Photosystem 1; PC: Plastocyanin; n: Cytoplasma, p: Thylakoidlumen.

11 Einleitung 3 Sowohl der cyanobakterielle als auch der pflanzliche Photosyntheseapparat setzt sich, wie in Abbildung 1-2 zu sehen ist, aus zwei hintereinander geschalteten Photosystemen zusammen, die über eine Elektronentransportkette miteinander verbunden sind. Laut der Endosymbiontentheorie (Mc Fadden et al., 1994) scheinen Chloroplasten höherer Pflanzen, Prochlorophyten und Cyanobakterien gleichen Ursprungs zu sein (Akiko et al., 1999; Tomitani et al., 1999). Aufgrund der Phylogenie und des vergleichbaren Aufbaus des Photosyntheseapparates haben sich Cyanobakterien als Modellorganismen der Photosyntheseforschung etabliert (the Cyanobacteria, 2008), da sie sich im Vergleich zu höheren Pflanzen durch geringe Generationszeiten und somit durch höhere Proteinausbeuten auszeichnen. 1.2 Thermosynechococcus elongatus Abbildung 1-3 Elektronenmikroskopische Aufnahme des Cyanobakteriums T. elongatus Thermosynechococcus elongatus-bp1 (T. elongatus) ist ein einzelliges Cyanobakterium, das erstmals aus einer heißen Quelle in Japan (Beppu) isoliert wurde (Yamaoka et al., 1978). Die optimale Wachstumstemperatur dieses thermophilen Organismus, der in Abbildung 1-3 elektronenmikroskopisch dargestellt ist, liegt bei 55 C. Das vollständig sequenziert Genom dieses Cyanobakteriums (Nakamura et al., 2002) bildet die Grundlage für genomweite Analysen. Zusammen mit der Entwicklung und Optimierung von Transformationstechniken des Organismus (Mühlenhoff et al., 2002; Onai et al., 2004) ermöglicht die Kenntnis der vollständigen Genomsequenz die Erzeugung von ortsgerichteten Mutationen. Aufgrund seiner Thermostabilität eignet sich T. elongatus hervorragend für die Präparation von stabilen Membranproteinkomplexen. Bislang konnten durch

12 Einleitung 4 Präparationen aus diesem thermophilen Organismus die Kristallstrukturen von Photosystem 1 (PS1) (Jordan et al., 2001) und Photosystem 2 (PS2) (Zouni et al., 2001; Ferreira et al., 2004) aufgeklärt werden. Aufgrund der möglichen Kombination aus Strukturanalyse und ortsgerichteter Mutagenese ergeben sich mannigfaltige Möglichkeiten zur Untersuchung der komplexen Vorgänge der Photosynthese. 1.3 Photosynthese und Respiration in Cyanobakterien Abbildung 1-4 Membrankomponenten des respiratorischen und photosynthetischen Elektronentransportes in der Cytoplasmamembran (grau) und der Thylakoidmembran (grün) von Cyanobakterien. bd Cytochrom bd Oxidase; NADH-DH NADH Dehydrogenase; PS2 Photosystem 2; b 6 f Cytochrom b 6 f Komplex; PS1 Photosystem 1; Cyt. ox - terminale Oxidase Cyanobakterien besitzen neben der äußeren sowie der cytoplasmatischen Membran (in Abbildung 1-4 grau dargestellt) ein intrazelluläres Thylakoidmembransystem. Diese in multiplen, konzentrischen Lagen angeordneten Thylakoide liegen parallel zur Cytoplasmamembran, besitzen eine große Oberfläche und zeichnen sich durch eine hoch dynamische Natur aus, die die schnelle Anpassung an verschiedenste Umweltbedingungen ermöglicht (Nevo et al., 2007). In Cyanobakterien sind die funktionellen Komplexe der photosynthetischen Proteine ausschließlich in den Thylakoidmembranen zu finden (Keren et al., 2005). Eine Ausnahme stellen die Biogenesevorstufen der photosynthetischen Proteine dar, die in der Cytoplasmamembran zu finden sind (Zak et al., 2001). Wie in Abbildung 1-4 gezeigt wird, enthalten die Thylakoidmembranen sowohl photosynthetische als auch respiratorische Proteinkomplexe (Sherman et al., 1994). Folglich sind in Cyanobakterien im

13 Einleitung 5 Gegensatz zu höheren Pflanzen die photosynthetischen und respiratorischen Elektronentransportprozesse räumlich nicht voneinander getrennt, sondern finden parallel in den Thylakoidmembranen statt (Carr et al., 1982). Aufgrund der fehlenden Kompartimentierung müssen in Cyanobakterien Respiration und Photosynthese gut koordiniert sein, um gegenläufige Prozesse wie beispielsweise die Reoxidation von NADPH durch Respiration zu vermeiden, da dieses Energieäquivalent im Calvin Zyklus für die CO 2 Fixierung benötigt wird. Da Cyanobakterien über keinen Cytochrom bc 1 Komplex verfügen, nehmen der Cytochrom b 6 f (Cyt b 6 f) Komplex und der Plastochinon (PQ)- Pool beim photosynthetischer und respiratorischen Elektronentransport eine zentrale Rolle ein (Aoki et al., 1982). 1.4 Der photosynthetische Elektronentransport Abbildung 1-5 Modell der Verknüpfung von Photosynthese und Respiration in der cyanobakteriellen Thylakoidmembran. (NAD(P)H Dehydrogenase (NDH-1), Photosystem 2 (PS2), Succinat Dehydrogenase (SDH), Cytochrom b 6 f Komplex (cyt bf), Cytochrom bd Oxidase (cyt bd), Photosystem 1 (PS1), terminale Oxidase (cyt ox): Ferredoxin:NADP + Oxido-Reduktase (FNR) Beim photosynthetischen Elektronentransport unterscheidet man zwischen linearem und zyklischem Elektronentransport. Bei den funktionellen Komponenten des photosynthetischen Elektronentransportes, die in den Thylakoidmembranen vorkom-

14 Einleitung 6 men oder daran angelagert sind, handelt es sich (wie in Abbildung 1-5 gezeigt wird) zum einen um die membranständigen Proteinkomplexe Photosystem 2 (PS2), Photosystem 1 (PS1) und den Cyt b 6 f Komplex sowie die mobilen Elektronen-Carrier Plastochinon (PQ) und Plastocyanin (PC). Das Plastochinon besitzt einen stark hydrophoben Charakter und ist in der Membran lokalisiert. Dagegen befindet sich das lösliche Plastocyanin an der luminalen Seite der Membran. Ein weiterer für die Photosynthese bedeutsamer Proteinkomplex, der ebenfalls in der Thylakoidmembran zu finden ist, ist die Protonen-ATPase (wie in Abbildung 1-2 zu sehen ist). Gemeinsam mit den mobilen Elektronen-Carriern Plastochinon und Plastocyanin vermittelt der Cyt b 6 f Komplex bei der oxygenen Photosynthese den Elektronentransport zwischen den Photosystemen. In einigen Cyanobakterien und eukaryotischen Algen kann unter Kupfermangelbedinungen Plastocyanin durch Cytochrom c 6 ersetzt werden. In manchen Cyanobakterien wie beispielsweise in T. elongatus, in denen das Plastocyanin codierende pete Gen fehlt, dienen Cytochrom b 6 sowie Cytochrom M als mobile Elektronen-Carrier (Nakamura et al., 2002) linearer photosynthetischer Elektronentransport NADPH Licht Licht Fd FNR Stroma PS2 Cyt b 6 f PQ Lumen PS1 2H 2 O O 2 + 4H + H + PC, Cyt c 6 Abbildung 1-6 Die Proteinkomplexe des linearen Elektronentransportes der oxygenen Photosynthese. PS1: Photosystem 1 ; PS2: Photosystem 2 ; Cyt b 6 f : Cytochrom b 6 f Komplex ; FNR: Ferredoxin NADP + Oxido-Reduktase (nach Kurisu et al., (2003))

15 Einleitung 7 Der Ablauf des linearen Elektronentransportes der oxygenen Photosynthese ist schematisch in Abbildung 1-6 dargestellt. Im ersten Schritt wird Lichtenergie durch die peripheren und inneren Antennen der beiden Photosysteme (PS2 und PS1) absorbiert. Durch die absorbierte Lichtenergie wird im Reaktionszentrum von PS2 das so genannte special pair, ein Chlorophyll a-dimer mit einem Absorptionsmaximum von 680nm, angeregt. Dabei geht ein Elektron in einen angeregten Zustand über und wird über ein Phaeophytin-Molekül und ein Plastochinon (Q A ) auf ein am PS2 reversibel gebundenes Plastochinon (PQ) übertragen. Durch diesen Vorgang entsteht im Reaktionszentrum von PS2 ein Elektronendefizit, das durch die Spaltung von Wasser an der luminalen Seite der Membran ausgeglichen wird. Bei der Wasserspaltung entstehen Sauerstoff und Protonen. Das reversibel gebundene Plastochinon wird unter der Aufnahme von jeweils zwei Elektronen und Protonen zum Plastochinol reduziert. Die bei der Wasserspaltung freigesetzten Elektronen werden durch das Mangan-Cluster des PS2 gespeichert (Kok et al., 1970) und über einen Tyrosinrest zum special pair des Reaktionszentrums weitergeleitet. Das reduzierte Plastochinon löst sich von PS2 und wandert durch die Membran zum Cyt b 6 f Komplex. Im nächsten Schritt wird das Plastochinol unter der Abgabe von zwei Protonen vom Cyt b 6 f Komplex oxidiert. Die Elektronen des reduzierten Plastochinols werden dabei einzeln auf einen luminalen Elektronen-Carrier übertragen. Durch den Photoneneinfall ist im Reaktionszentrum von PS1 (P700) ebenso wie im Reaktionszentrum von PS2 eine Elektronenlücke entstanden. Dieses Elektronendefizit wird durch das Elektron des luminalen Carriers ausgeglichen, wenn dieser vom Cyt b 6 f Komplex zum PS1 diffundiert und dort als Elektronendonor dient. Das durch den Photoneneinfall angeregte Elektron gelangt über den primären Akzeptor A 0 (Chlorophyll a-molekül), ein Phyllochinon A 1, und drei [4Fe4S]-Zentren zum Ferredoxin, oder bei Cyanobakterien alternativ zum Flavodoxin. Das Ferredoxin wird durch die Ferredoxin-NADP-Oxireduktase (FNR) NADP + für die Reduktion von NADP + zu NADPH + H + genutzt. Die entstandenen Energieäquivalente werden im Calvin Zyklus durch die Reduktion von Kohlendioxid für die Synthese energiereicher Kohlenstoffverbindungen verwendet (Stryer, 1994). Durch die Protonen, die bei der Wasserspaltung am PS2 und bei Oxidation des Plastochinols am Cyt b 6 f Komplex ins Thylakoidlumen abgegeben werden, baut sich über die Membran ein Protonengradient auf. Dieser Protonengradient wird nach der

16 Einleitung 8 Mitchell-Hypothese von der ATP-Synthase für die Produktion von ATP genutzt (Mitchell, 1966) zyklischer photosynthetischer Elektronentransport Neben dem bereits beschriebenen linearen Elektronentransport, der von PS2 über den Cyt b 6 f Komplex zu PS1 verläuft, existiert außerdem der zyklische photosynthetische Elektronentransport. Dieser Elektronentransportweg verläuft zwischen dem PS I und dem Cyt b 6 f Komplex und führt auf diesem Weg dem Plastochinonpool Elektronen zu (Heimann et al., 1999). Beim zyklischen Elektronentransport werden Protonen ins Thylakoidlumen gepumpt. Dies hat einen erhöhten Protonengradienten über die Membran und somit eine Steigerung der ATP-Synthese zur Folge. Dieser Mechanismus ermöglicht die Anpassung des NADPH/ATP Verhältnisses an die aktuellen Bedürfnisse des Organismus. Bei vielen Cyanobakterien wie beispielsweise Synechocystis PCC 6803 dominiert dieser Weg des photosynthetischen Elektronentransportes unter physiologischen CO 2 -Konzentrationen (0,03%) oder bei schwachen Lichtverhältnissen (Kurisu et al., 2003). Abbildung 1-7 Modell des zyklischen Elektronentransfers. Dargestellt sind die verschiedenen Möglichkeiten der Elektronenrückführung. Cytochrom b 6 f Komplex (Cyt.b 6 f), Photosystem 1 (PS1), Ferredoxin NADP + Oxido-Reduktase (FNR), NADH-Plastochinon-Reduktase (NDH)

17 Einleitung 9 Wie in Abbildung 1-7 gezeigt wird, gibt es mehrere denkbare Wege für die Rückführung der Elektronen vom PS1 zum PQ-Pool, jedoch ist der genaue Ablauf des zyklischen Elektronentransportes bislang ungeklärt. Der Rücktransport der Elektronen könnte möglicherweise über die NADH-Plastochinon-Reduktase (NDH) zurück zum PQ-Pool erfolgen (Zhang et al., 2001; Sazanow et al., 1998). Ein alternativer Weg führt die Elektronen über die Ferredoxin-NAD + -Oxidoreduktase zurück (Zhang et al., 2001). Denkbar wäre auch, dass die Elektronen direkt vom Ferredoxin zum Cyt b 6 f Komplex gelangen. 1.5 respiratorischer Elektronentransport Tabelle 1-1 Die wichtigsten Proteinkomplexe des photosynthetischen und respiratorischen Elektronentransportes in cyanobakteriellen Thylakoidmembranen (nach Vermaas, 2001) Proteinkomplex Hauptuntereinheiten Cofaktoren Funktion Photosystem 2 D1, D2, CP43, CP47, PsbO Mn, Ca, Cl, Fe, PQ, Chlorophyll, Cyt b 559, Pheophytin Licht-induzierte Wasserspaltung und PQ Reduktion Succinat Dehydrogenase Typ-1 NADPH Dehydrogenase SdhA, SdhB, SdhC Flavin, FeS Zentren Succinat Oxidaton und PQ Reduktion NdhA-L FeS Zentren NADPH Oxidation und PQ Reduktion Cytochrom b 6 f Komplex Cyt b 6, Cyt f, Rieske, Untereinheit IV 2 Cytb, Cytf (Cytc), FeS PQH 2 Oxidation und PC/ Cyt c 6 Reduktion Photosystem 1 PsaA, PsaB und andere Psa Proteine Chlorophyll, Vitamin K 1, FeS Zentren Licht-induzierte PC/ Cyt c c 6 Oxidation und Fd Reduktion Cytochrom Oxidase CtaC, CtaD, CtaE Cu A. Cu B, Mg, Cyta, Cyt c Oxidation und O 2 Cyta 3 Reduktion In Cyanobakterien kommen die Elemente der respiratorischen Elektronentransportkette sowohl in der Cytoplasma- als auch der Thylakoidmembran vor. Beim respiratorischen Eletronentransport in den Thylakoidmembranen werden teilweise die gleichen redoxaktiven Komponenten wie beim photosynthetischen Elektronentransport verwendet: dazu gehören Plastochinon, der Cyt b6f Komplex und Plastocyanin oder Cytochrom c 6 (Scherer 1990; Vermaas 2001).

18 Einleitung 10 Der Plastochinon Pool wird durch die NAD(P)H Dehydrogenase, oder andere Substrat-Dehydrogenasen wie die Succinat Dehydrogenase (SDH), mit Elektronen gespeist (Cooley et al., 2000; Vermaas 2001). Neben dem Cytochrom-aa 3 -Komplex (CtaI) als terminale Cytochrom-Oxidase vom Typ I, der Cytochrome c 6 und Plastocyanin als Substrat nutzt, finden sich in der Cytoplasma- sowie der Thylakoidmembran weitere Oxidasen (Pils et al., 2001). Eine dieser Oxidasen ist die alternative Chinoloxidase, die Cytochrom bd Oxidase (Berry et al., 2002; Howitt et al., 1998; Pils et al., 1997). Außerdem wird eine zusätzliche Chinoloxidase vom Cytochrom-bo-typ postuliert, deren genaue Funktion noch ungeklärt ist (Howitt, 1998 et al.; Pils et al., 1997). Weiterhin kann der Cytochrom b 6 f Komplex den Plastochinon Pool oxidieren. 1.6 Der cyanobakterielle Plastochinon Pool Abbildung 1-8 Darstellung der verschiedenen Elektronentransportwege in Synechocystis PCC 6803 (Schneider, 2000). PS2: Photosystem 2; SDH Succinatdehydrogenase; NDH: NAD(P)H- Dehydrogenase; PQ/PQH 2 : Plastochinonpool; cyt b 6 f: Cytochrom b 6 f Komplex; cyt aa 3 : Cytochrom c-oxidase vom Typ aa 3 ; PS1: Photosystem 1; FNR: Ferredoxin:NADP + Oxido-Reduktase (FNR); cyt bd: Cytochrom bd-oxidase. In rot sind die jeweiligen Inhibitoren dargestellt Wie bereits erwähnt wurde, spielen sowohl der Cytochrom b 6 f Komplex als auch Plastochinon (PQ) Pool eine zentrale Rolle bei den Elektronentransportprozessen in Cyanobakterien (Aoki et al., 1983). Dabei werden, wie in Abbildung 1-8

19 Einleitung 11 schematisch dargestellt ist, sowohl über die NAD(P)H-Dehydrogenase (NDH) und die Succinatdehydrogenase (SDH) als auch über PS2 Elektronen in den PQ-Pool eingespeist (Cooley et al., 2001). Von PS1 werden über den zyklischen Elekronentransportweg ebenfalls Elektronen zu Verfügung gestellt. Vom Plastochinonpool aus werden die Elektronen auf den zentralen Cytochrom b 6 f Komplex, die terminalen Oxidase oder andere, alternative Oxidasen übertragen. Bei der Regulierung des photosynthetischen und respiratorischen Elektronentransportes sowie der Regulierung der beteiligten Proteine ist der PQ-Pool von zentraler Bedeutung, da über den Redox-Zustand des PQ-Pools verschiedene Mechanismen reguliert werden, wie beispielsweise die state transitions. Dabei handelt es sich um eine kurzfristige Umverteilung der peripheren Antennenkomplexe (schematisch in Abbildung 1-9 dargestellt) zwischen den beiden Photosystemen als kurzfristige Anpassung des Photosynthese-Apparates an veränderte Lichtintensitäten oder ein verändertes Belichtungsspektrum (Mullineaux, 2001). Abbildung 1-9 die durch state transitions bedingte Umverteilung der Phycobilisomen. Phycobilisomen (PBS) in blau, die Photosysteme (PS1, PS2) in grün dargestellt (Rögner, 2004). Damit über den Redox-Zustand des PQ-Pools verschiedenste Mechanismen gesteuert werden können, wird theoretisch eine Art Sensor System benötigt. Bislang gibt es keine Anhaltpunkte, wie ein solches Sensor System in Cyanobakterien realisiert ist. Der Cytochrom b 6 f Komplex scheint bei der Regulation des Redoxzustandes des PQ-Pools ebenso wie die Cytochrom bd Oxidase involviert zu sein (wie in

20 Einleitung 12 Abbildung 1-10 schematisch dargestellt ist). Studien in Synechocystis PCC 6803 (Synechocystis) lassen vermuten, dass die Cytochrom (Cyt) bd Oxidase unter Stressbedingungen den PQ-Pool vor einer Überreduktion schützt (Berry et al., 2002). Während die Funktion der Cyt bd Oxidase in Cyanobakterien bislang weniger gut untersucht und die funktionelle Expression bislang umstritten ist (Paumann et al., 2005), konnte diese für Escherichia coli isoliert und näher charakterisiert werden (Kita et al., 1984; Miller et al., 1983). Abbildung 1-10 Proteinkomplexe, die den Redoxzustand des PQ-Pools beeinflussen. Der Cyt b 6 f Komplex (links) und die Cyt bd Oxidase (rechts) sind schematisch dargestellt (Rögner, 2006) 1.7 Die Cytochrom bd Oxidase in E. coli Wie in Abbildung 1-11 zu sehen ist, setzt sich die Cyt bd Oxidase von E. coli aus zwei Untereinheiten: Untereinheit I / CydA (58.3kDa) und Untereinheit II / CydB (43.5kDa) zusammen, die gemeinsam ein Heterodimer bilden (Green et al., 1988). Im Gegensatz zu anderen terminalen Oxidasen (wie beispielsweise die Cyt aa 3 -, die Cyt caa 3 - oder die Cyt bo Oxidase) gehört die Cyt bd Oxidase nicht zu der Familie der Häm-Kupfer-Oxidasen (Kita et al., 1984; Miller et al., 1983). Bei den Cyt bd Oxidasen, die zur Familie der Chinol-Oxidasen gehören (Das et al., 2005) und nur in Prokaryoten zu finden sind, gibt es drei alternative Gruppen mit unterschiedlicher Substrat-Spezifität. In den α, β und γ Proteobakteria dient Ubichinol als Substrat. In Cyanobakterien wird Plastochinol als Substrat verwendet. In den übrigen Bakterienarten, in denen die Cyt bd Oxidase vorkommt, wird Menachinol als Substrat des Enzyms genutzt. Die Aminosäuren, die die Substrat-Spezifität definieren, sind jedoch bislang unbekannt (Zhang et al., 2004).

21 Einleitung 13 Der Komplex bindet drei Häm Moleküle, zwei high spin Häme (b 558 und b 595 ) und ein low spin Häm d (Jünemann, 1997). Das Häm b 558 wird durch die Aminosäuren Histidin 186 und Methionin 393 der CydA Untereinheit koordiniert (Kaysser et al., 1995; Fang et al., 1989). Das Häm b 595 wird vom Histidin 19 der CydA Untereinheit sowie der CydB Untereinheit koordiniert. Die Interaktionsstelle mit der CydB Untereinheit ist jedoch bislang unbekannt. Das Häm d wird ausschließlich von der CydB Untereinheit koordiniert. Auch hier ist die genaue Interaktion bislang unbekannt. Es konnte außerdem gezeigt werden, dass das Arginin 391 in der Untereinheit CydA die reduzierte Form des Häms b 558 stabilisiert und für die Chinol- Oxidase-Aktivität essentiell ist (Zhang et al., 2004). Mittels EPR Studien konnte die Orientierung der prosthetischen Gruppen aufgeklärt werden: Häm b 558 und Häm d wurden parallel zu der Membranaxe gefunden. Dagegen ist das Häm b 595 ist um 55 geneigt (Ingledew et al., 1992). Periplasma Cytoplasma Abbildung 1-11 Schematische Darstellung der Cytochrom bd Oxidase aus E. coli (Jünemann, 1997, modifiziert) Der Elektronen Transfer beginnt beim Chinon, dessen Bindestelle in der Nähe des Häm b 558 lokalisiert ist, geht über das Häm b 595 und anschließend zu Häm d. Dabei

22 Einleitung 14 wird in einer gemeinsamen Bindetasche von Häm b 595 und Häm d Sauerstoff zu Wasser reduziert (Hill et al., 1993). Die Reaktion ist an eine transmembrane Ladungstrennung sowie die Generation eines Membranpotentials gekoppelt. In E. coli ist die Cyt bd Oxidase aufgrund ihrer hohen Affinität zu Sauerstoff im Stande die Energieproduktion unter microaeroben Bedingungen aufrecht zu erhalten und anaerobe Prozesse vor Inhibierung durch Sauerstoff zu schützen (Hill et al., 1990). In Deletionsmutanten ist eine reduzierte Anpassung an Hitzestress zu beobachten sowie ein beeinträchtigtes Wuchsverhalten bei 37 C (Goldman et al., 1996). Für die Funktionalität der Cyt bd Oxidase sind neben den Strukturgenen cyda und cydb zwei weitere Gene von besonderer Bedeutung. Dies sind die Gene cydc und cydd, die einen Transporter vom ABC-Typ kodieren (Gergiou et al., 1987; Poole et al., 1989, 1993, 1994). Es konnte gezeigt werden, dass dieser Transporter für den Transport von Cystein (Pittmann et al., 2002) und Glutathion (Pittmann et al., 2005) ins Periplasma verantwortlich ist. Cystein und Glutathion scheinen bei der Häm Koordination im Komplex eine wichtige Rolle zu spielen, da es bei der Inaktivierung der Transporter-kodierenden Gene zu einem Häm d Mangel im assemblierten Komplex kommt und weiterhin die Häm bindenden Aminosäurereste im Enzym fehlen (Poole et al., 1989). Bislang wurden weder in Synechocystis noch in T. elongatus homologe Gene für cydc und cydd gefunden. 1.8 Die Cytochrome bd Oxidase in Cyanobakterien Die Existenz und Funktion einer Cyt bd Oxidase in Synechocystis wurde bislang durch Sequenzanalysen und die Charakterisierung von Deletionsmutanten untersucht. Es konnte durch Sauerstoffmessungen und Chlorophyll a-fluoreszenzmessungen am PS2 gezeigt werden, dass von drei putativen Oxidasen unter Standartbedingungen nur zwei aktiv sind: die Cyt bd Oxidase und die vorher identifizierte Cytochrom aa 3 -typ Oxidase CtaI (Howitt et al., 1998). Die CtaI kommt hauptsächlich in den Thylakoidmembranen vor, während die Lokalisierung der Cyt bd Oxidase bislang umstritten ist.

23 Einleitung 15 Abbildung 1-12 Inhibitoren des cyanobakteriellen Elektronentransportes Die Tatsache, dass Synechocystis Kulturen in Gegenwart von DBMIB (2,5-dibromo- 3-methyl-6-isopropyl-p-benzoquinone), einem Inhibitor des Cyt b 6 f Komplexes, überleben können, ist ein Hinweis auf das Vorhandensein einer funktionellen terminalen Oxidase, die Elektronen direkt vom PQ-Pool bezieht (Schneider, 2000). Ein weiterer Hinweis wurde über Chlorophyll a Fluoreszenzmessungen erbracht, mit Hilfe derer der Redox-Zustand des PQ-Pools und die Aktivität der angrenzenden Proteinkomplexe ermittelt werden kann. Der Elektronenfluss von PS2 kann (ebenso wie viele andere Schritte des Elektronentransportes in Cyanobakterien) durch spezifische Inhibitoren geblockt werden. Dabei kommt es zu ansteigenden Chlorophyll a Fluoreszenzsignalen. Die Angriffspunkte der verschiedenen Inhibitoren sind in Abbildung 1-12 schematisch dargestellt. Bei Belichtung in Anwesenheit von DCMU (3-(3,4-dichlorophenyl)-1,1- dimethylurea), einem Inhibitor von PS2, zeigen Synechocystis Zellen maximale Fluoreszenz. Die maximale Fluoreszenz wird durch DBMIB, das den Elektronentransfer von PS2 zum Cyt b 6 f Komplex blockiert, gequencht. Dies lässt auf die Anwesenheit und Aktivität einer weiteren alternativen Oxidase schließen, welche den Plastochinon Pool oxidiert (Berry et al., 2002). Experimente mit PCP (Pentachlorophenol) und HQNO (2-Heptyl-4-hydroxy-quinoline-N-oxide) zeigen, dass der beste Kandidat für diese Oxidase die putative Cyt bd Oxidase ist. In Kombination mit DBMIB erzeugen diese Inhibitoren der Chinol-Oxidase eine reduzierte Fluoreszenz-Quenchung im Vergleich zum alleinigen Einsatz von DBMIB. Eine Synechocystis cydab Mutante, in welcher die Gene der putativen Cyt bd Oxidase inaktiviert wurden, zeigt keine Quenchung der Fluoreszenz in der

24 Einleitung 16 Anwesenheit von DBMIB. Dies weist darauf hin, dass die Oxidase, deren Quenching-Effekt oben genannt wurde, von den Genen der putativen Cyt bd Oxidase (cyda und cydb) codiert wird. Die bisherigen Ergebnisse lassen eine regulatorische oder schützende Rolle der Cyt bd Oxidase vermuten, um einen überreduzierten PQ- Pool zu verhindern (Berry et al., 2002). 1.9 Der Cytochrom b 6 f Komplex (Plastochinol-Plastocyanin- Oxidoreduktase) Da Cyanobakterien über keinen Cytochrom (Cyt) bc 1 Komplex verfügen ist der Cyt b 6 f Komplex von zentraler Bedeutung bei den cyanobakteriellen Elektronentransportprozessen (Kallas, 1994). In der oxygenen Photosynthese vermittelt der Cyt b 6 f Komplex, der aus vier großen und bis zu fünf kleinen Untereinheiten besteht, den Elektronentransfer zwischen PS2 und PS1 (Hauska et al., 1997). Die einzelnen Untereinheiten sowie deren Funktion und Cofaktoren sind in Tabelle 1-2 zusammengefasst. Tabelle 1-2 Die Untereinheiten des Cytochrom b 6 f Komplexes und ihre Funktion Untereinheit Gen Molekulargewicht [kda] Cyt b 6 petb 24,7 Cofaktor 2 b-typ Häme 1 c i -typ Häm (Häm x) Chl a Funktion im Cyt b 6 f Komplex Elektronentransfer, Bildung von Q i und Q o Untereinheit IV petd 17,5 Chl a Bildung von Q i und Q o Cyt f peta 32,3 c-typ Häm Elektronentransfer Riese-FeS- Protein petc 19,3 2Fe-2S cluster Elektronentransfer, Stabilisierung des Dimers PetL petl 3,8 Carotinoid Stabilisierung des Dimers PetM petm 3,5 Carotinoid Regulatorische Funktion PetG petg 4 Carotinoid essentiell PetN petn 3,3 essentiell PetP petp 7,2 Regulatorische Funktion

25 Einleitung 17 Die Struktur des Cyt b 6 f Komplexes war lange Zeit weitgehend unbekannt. Deshalb wurde der Komplex oft mit dem Cyt bc 1 Komplex, einem Membranproteinkomplex des bakteriellen und mitochondrialen Elektronentransportes, verglichen, mit dem der Cyt b 6 f Komplex viele funktionelle Gemeinsamkeiten aufweist (Widger et al., 1984) und dessen Struktur schon seit geraumer Zeit mit einer Auflösung von 2,9Å bekannt war (Crofts et al., 1998; Iwata et al., 1998, Xia et al. 1997). Sowohl der Cyt b 6 f Komplex als der Cyt bc 1 Komplex sind Bestandteil beim Aufbau von Membranpotentialen und Protonengradienten, an die eine ATP-Synthese gekoppelt ist. Bei beiden Komplexen erfolgt der Transfer von Elektronen über die Oxidation eines in der Membran lokalisierten Chinons und die Reduktion eines luminalen, löslichen Elektronen-Carriers. Der Cyt bc 1 Komplex besteht aus drei katalytische Untereinheiten mit redoxaktiven, prosthetischen Gruppen. Dabei handelt es sich um Cyt b, Cyt c 1 und das Rieske-FeS- Protein. Sequenzvergleiche der Untereinheiten Cyt b 6 und Untereinheit IV des Cyt b 6 f Komplexes mit Cyt b (Widger et al., 1984) zeigen starke Homologien. Deshalb wurde die These entwickelt, dass Cyt b 6 und Untereinheit IV im Laufe der Evolution durch Genspaltung des Cyt b und Deletion seiner carboxyterminalen Helix entstanden sind. Abbildung 1-13 Struktur des dimeren Cyt b 6 f- Komplexes aus M. laminosus. Die linke Seite zeigt den Elektronentransportweg des Komplexes sowie die Abstände zwischen den Redox-Cofaktoren. Auf der rechten Seite sind die Untereinheiten mit den gebunden Cofaktoren dargestellt: Cyt b6 (blau), Untereinheit IV (violett), Rieske-Protein (gelb), Cyt f (rot), PetG, PetL, PetM und PetN (grün), β- Carotin (orange) und Chl a (dunkel grün) (nach Kurisu et al. (2003), modifiziert) Aktuellere Studien machen einen genaueren Einblick in die Struktur des Cyt b 6 f Komplexes möglich: Im Jahr 2003 konnte von 2 verschiedenen Arbeitsgruppen

26 Einleitung 18 zeitgleich die Struktur des Cyt b 6 f Komplexes aufgeklärt werden (mit einer Auflösung bis zu 3 Å). Dabei handelt es sich um die Komplexe aus Chlamydomonas reinhardtii (Stroebel et al., 2003) und Mastigocladus laminosus (Kurisu et al., 2003). Das Strukturmodell des Komplexes ist in Abbildung 1-13 dargestellt. Das native Dimer des Komplexes, das die funktionelle Einheit des Cyt b 6 f Komplexes darstellt (Breyton et al., 1997), hat ein Molekulargewicht von 217 kda. In Abbildung 1-14 ist die Verteilung der Untereinheiten innerhalb des Monomers schematisch dargestellt. Die große Untereinheit Cyt b 6,, die ein Molekulargewicht von 24,7 kda hat, besteht aus vier transmembranen Helices (Helix A-D) und einer amphiphilen Helix, die auf der Lumenseite parallel zur Membran angeordnet ist. Cyt b 6, bindet zwei axial angeordnete, über Histidinreste koordinativ gebundene Hämgruppen des b-typs. Diese Hämgruppen, die maßgeblich am Elektronentransport beteiligt sind, werden entsprechend ihres Redoxpotentials als b H (H = high potential) und b L (L = low potential) bezeichnet (Kallas, 1994; Kuras et al., 1997). Eine Besonderheit, die in beiden bislang veröffentlichten Cyt b 6 f Strukturen vorkommt, ist das Häm x (Kurisu et al., 2003) bzw. Häm c i (Stroebel et al., 2003), das in unmittelbaren Nähe des Häms b H entdeckt wurde. Dieses Häm besitzt zwar ein zentrales Eisenatom, scheint jedoch in keine der bekannten Hämfamilien eingeordnet werden zu können, da es nur über eine einzige Thioetherbindung an die Cyt b 6 Untereinheit gebunden ist. Im Gegensatz dazu findet bei typischen c-typ-cytochromen die Bindung über 2 Cysteine an einem orthogonal angeordneten Histidin-Liganden statt. Außerdem ist das zentrale Eisenatom beim Häm x nicht über Proteinseitenketten sondern über ein Molekül, bei dem es sich wahrscheinlich um H 2 O handelt, koordiniert. So wirft das Häm x viele Fragen auf. Seine Funktion ist bislang auch noch unklar. Aufgrund der Lage des Häm x könnte es eine Rolle beim zyklischen Elektronentransport zwischen dem Cyt b 6 f Komplex und PS1 spielen. Untereinheit IV, die drei transmembrane Helices (Helix E-G) enthält, ist die kleinste der vier großen Untereinheiten des Komplexes (Kallas et al., 1988). Sie bildet zusammen mit dem Cyt b 6 die Plastochinon-Bindenischen für reduziertes (Q 0 ) und oxidiertes Plastochinon (Q i ), die sich an den gegenüberliegenden Seiten der Thylakoidmembran befinden (Zito et al., 1999). Weiterhin ist das mit dem Cyt b 6 f

27 Einleitung 19 Komplex assoziierte Chl a über den Pyrol-Ring des Chlorophylls mit den Helices F und G der Untereinheit IV ligiert (Kurisu et al., 2003). Über hydrophobe Interaktion steht das Chl a außerdem mit der Cyt b 6 Untereinheit in Verbindung. Das Rieske-Eisen-Schwefel-Protein, das aus einer aminoterminalen, transmembranen Helix sowie einer carboxyterminalen, hydrophilen Domäne besteht, realisiert den Elektronentransfer vom Plastochinol zum Cyt f. Die carboxyterminale, hydrophile Domäne des Proteins enthält die Bindestelle des [2Fe2S]-Clusters. Dabei wird die prosthetische Gruppe über zwei Cysteine und zwei Histidine in der Domäne koordiniert. Im Gegensatz zu den anderen großen Untereinheiten, die symmetrisch in beiden Monomeren angeordnet sind, ist das Rieske-Protein diametrisch über die Achse des Monomers gespannt, was scheinbar zur Stabilisierung des Dimers beiträgt. Dabei ist der FeS-Cluster der jeweiligen Untereinheit Bestandteil des Elektronentransfers im benachbarten Monomer. Abbildung 1-14 schematische Darstellung der einzelnen Untereinheiten des Cyt b 6 f Komplexes Eine interessante Eigenschaft des Rieske-FeS-Proteins ist die mögliche Beweglichkeit der löslichen Domäne dieser Untereinheit. Die aminoterminale, transmembrane Helix fungiert hierbei als Membrananker der löslichen, beweglichen Domäne, die in der Lage zu sein scheint, zwischen mehreren Positionen hin und her zu schwingen und so die Lücke zwischen dem Häm b L und Cyt f während des

28 Einleitung 20 Elektronentransfers zu überbrücken. Die Idee dieser Bewegung basiert auf der Beweglichkeit des FeS-Proteins im verwandten Cyt bc 1 Komplex. Die Analysen der Kristallstrukturen dieses Komplexes zeigen das Rieske-Protein in drei verschiedenen Positionen: eine zur Plastochinol-Bindestelle (Q o ) gerichtete Position ( b-state ) (Xia et al., 1997), eine dem Cyt c 1 zugewandte Position ( c 1 -state ) (Zhang et al., 1998) und eine Zwischenposition (Iwata et al., 1998). Diese Bewegung des Rieske-Proteins konnte für den Cytochrom b 6 f Komplex bislang nicht experimentell gezeigt werden. Cytochrom f, das mit einem Molekulargewicht von 32,3 kda die größte Untereinheit des Komplexes ist, besteht aus einer transmembranen α-helix, und einem hydrophilen Teil, der ins Thylakoidlumen ragt. Der aminoterminale, hydrophile Teil der Untereinheit bindet kovalent ein c-typ-cytochrom. Im Gegensatz zu den meisten bekannten Cytochrom-Apoproteinen dient anstatt eines Histidin-Restes der Aminoterminus des Proteins als sechster Ligand des zentralen Eisenatoms (Cramer et al.., 1994). Cyt f katalysiert den Elektronentransfer vom Rieske-Eisen-Schwefel- Zentrum zum löslichen Elektronen-Carrier. Im dimeren Komplex treten die beiden Cyt f Untereinheiten nicht in direkten Kontakt miteinander aber sie formen zusammen eine schüsselartige Struktur, von der angenommen wird, dass sie als Schutz bei der Bewegung der beiden Rieske-FeS-Proteine dient, so dass diese in dem stark begrenzten Raum nicht in störende Wechselwirkungen miteinander treten (Kurisu et al., 2003). Bei den kleinen Untereinheiten des Cyt b 6 f Komplexes handelt es sich um PetG, PetL, PetM, PetN und PetP, deren definierte Funktion bislang noch nicht geklärt ist. Im Bezug auf die Zuordnung der kleinen Untereinheiten variieren die veröffentlichen Strukturen des Cyt b 6 f Komplexes. Nur die Zuordnung von PetM stimmt in den Strukturen von C. reinhardtii und M. laminosus überein. Experimente mit Deletionsmutanten in Chamydomonas reinhardtii zeigen, dass PetG essentiell für photoautotrophes Wachstum zu sein scheint und außerdem für die Assemblierung und Stabilisierung des Komplexes von Bedeutung ist (Berthold et al., 1995). PetL, das ebenfalls für die korrekte Assemblierung des Komplexes wichtig ist (Breyton et al., 1997; Whitelegge et al., 2002), scheint den Elektronentransport zu beeinflussen, wie durch Experimente mit C. reinhardtii gezeigt werden konnte

29 Einleitung 21 (Takahashi et al., 1996). PetM, das in Synechocystis nicht essentiell für die Redoxaktivität des Komplexes ist, konnte dagegen eine regulative Aufgabe zugeschrieben werden (Schneider et al., 2001). Wie ebenfalls durch Deletionsexperimente gezeigt werden konnte, führt die Abwesenheit von PetN dazu, dass kein funktioneller Cyt. b 6 f Komplex gebildet werden kann (Hager et al., 1999). Die mögliche Funktion von PetP, das nicht essentiell zu sein scheint, wird im Folgenden (siehe 1.10) gesondert erläutert. Der Cyt b 6 f Komplex verfügt über ein gebundenes β-carotin (Boronowsky et al., 2001; Yan et al., 2001), das laut der Struktur von Kurisu et al. (2003) zwischen den Helices PetL und PetM lokalisiert ist. Das Carotin scheint ebenfalls mit den Helices B und E sowie mit PetG in Kontakt zu treten. Dieses Carotin könnte ebenso wie das gebundene Chl a möglicherweise als Sensor für Reaktionspartner in den beiden Bindenischen Q o und Q i in Betracht gezogen werden PetP eine kleine Untereinheit des cyanobakteriellen Cyt b 6 f Komplexes In früheren Arbeiten konnte gezeigt werden, dass bei der Reinigung des Cyt b 6 f Komplex aus Synechocystis ein hypothetisches, 7.2-kDa großes Protein coisoliert wird (Wenk, 2000; Volkmer, 2004). Bei diesem Protein, das durch den open reading frame ssr2998 kodiert wird, handelt sich nicht um ein transmembranes sondern ein lösliches Protein. Der offene Leserahmen ssr2998 ist in Cyanobakterien hoch konserviert, wie das Alignment in Abbildung 1-15 zeigt. Allerdings kann weder in höheren Pflanzen noch Grünalgen ein homologes Protein gefunden werden Ssr2998/ Synechocystis PCC 6803 MTIEIGQKVKVYRLRDRVSPDVVGKLGKVGVVKDFKMTDG Tsr0524/ T. elongatus --MDVGQKVRVCRIRDRVAQDIIQKLGQVGQITGFKMTDG Asl482/ Anabaena PCC MEIGQKVKVFRLRDRVSAPIAKKLGEVGIIEGYKVTDG Ssr2998/ Synechocystis PCC 6803 SGIGAVVSFDDRTATWFFEDELKAI Tsr0524/ T. elongatus SGVGVIVTFDDRSSTWFFEDEVEVVG Asl482/ Anabaena PCC7120 AGIGVVVKFNDNTSTWFFEDEIKPV Abbildung 1-15 Alignment der hypotetischen Proteine Ssr2998 (PetP), Tsr0524 und Asl482. [rot = identische Aminosäuren; blau = ähnliche Aminosäuren]

30 Einleitung 22 Um die Funktion des Proteins untersuchen zu können, wurde der ORF ssr2998 in Synechocystis durch die Insertion einer Kanamycin-Resistenzkassette ausgeschaltet und die daraus entstandene Mutante analysiert (Volkmer, 2004). Die Tatsache, dass sich der ORF ssr2998 deletieren lässt, deutet darauf hin, dass das Produkt des Leserahmens unter den gewählten Wachstumsbedingungen nicht essentiell für Synechocystis ist. Jedoch führt der Verlust des 7.2-kDa Proteins zum reduzierten Wachstum von Synechocystis speziell unter Hochlicht-Bedingungen. Weiterhin beeinträchtigt das Fehlen des 7.2-kDa Proteins die Funktion des Cyt b 6 f Komplexes, was sich vor allem durch einen verlangsamten Elektronentransport am Cytochrom f und am Reaktionszentrum von PS1 sowie durch einen überreduzierten Plastochinon Pool zeigt (Volkmer et al., 2007). Außerdem werden durch die Abwesenheit des 7.2- kda Proteins die PS1/PS2 Stöchiometrie und die state transitions beeinflusst (Volkmer, 2004). Folglich scheint das 7.2-kDA Protein strukturell und funktionell mit dem Cyt b 6 f Komplexes verbunden und in die Regulierung der Elektronen- Transfer-Prozesse in Synechocystis involviert zu sein. Zusammen mit der Tatsache, dass ein open reading frame, der ein homologes Protein kodiert, in allen bislang sequenzierten cyanobakteriellen Genomen gefunden werden kann, deutet dies darauf hin, dass Ssr2998 funktionell mit dem Cyt b 6 f Komplexes in Cyanobakterien assoziiert ist. Diesem Protein wurde entsprechend der Nomenklatur der Untereinheiten des Cyt b 6 f Komplexes der Name PetP gegeben Ziele der Arbeit Im ersten Teil dieser Arbeit sollte das hypothetische Protein Tsr0524 (PetP) aus dem Cyanobakterium T. elongatus näher charakterisiert werden, um detaillierte Informationen über diese potentielle Untereinheit des Cyt b 6 f Komplexes zu gewinnen. Um einen Einblick in die mögliche Funktion des Proteins zu erhalten, wurde bereits im Rahmen meiner Diplomarbeit eine petp-deletionsmutante erstellt und untersucht. Im Rahmen dieser Arbeit soll die Charakterisierung durch Erstellung von Cyt f- und P 700 -Kinetiken sowie Fluoreszenzinduktionsmessungen vervollständigt werden. Weiterhin sollte die heterologe Überexpression und Reinigung von PetP in E. coli optimiert werden, um große Proteinmengen für die Herstellung von Antikörpern und Struktur-Analysen gewinnen zu können. Außerdem sollte über

31 Einleitung 23 Deletionsexperimente und quantitative Real Time PCR-Analysen gezeigt werden, inwieweit die Cyt bd Oxidase bei der Regulierung des PQ-Pools in der petp- Mutante eine Rolle spielt. Der zweite Teil dieser Arbeit beschäftigt sich mit der Cyt bd Oxidase aus T. elongatus. Wie bereits erwähnt wurde, ist über die Struktur, Funktion und Regulation Cyt bd Oxidase aus Cyanobakterien bislang nur wenig bekannt. Deshalb sollte im Rahmen dieser Arbeit die physiologische Funktion der Cyt bd Oxidase aus T. elongatus analysiert werden. Mit Hilfe von Chlorophyll a - Fluoreszensmessungen konnte in früheren Studien die Aktivität der Cyt bd Oxidase aus Synechocystis demonstriert werden (Howitt et al., 1998; Berry et al., 2002). Basierend auf dieser Methode sollte im Rahmen dieser Arbeit die Aktivität der Cyt bd Oxidase aus T. elongatus nachgewiesen werden. Über Analysen durch quantitative RT-PCR sollte die Transkription der Cyt bd Oxidase-codierenden Gene cyda und cydb untersucht werden, um mögliche Rückschlüsse auf die Regulation des Enzyms ziehen zu können. Um Hinweise auf die Funktion der Cyt bd Oxidase zu erhalten, sollte außerdem eine T. elongatus Mutante erstellt werden, in der die Cyt bd Oxidasecodierenden Gene inaktiviert sind. Weiterhin sollte im Rahmen dieser Arbeit erstmals eine Methode für die Komplementierung von Mutationen in T. elongatus etabliert werden, um zeigen zu können, dass der Phänotyp einer Mutante auf die jeweilige Mutation zurückzuführen ist und es sich nicht um einen Sekundäreffekt handelt. Neben Deletionsexperimenten geben Strukturanalysen von Proteinen oft Hinweise auf ihre Funktion. Da Proteinmengen, die unter natürlichen Bedingungen von Zellen gebildet werden, in den vielen Fällen nicht ausreichen, um Antikörper zu synthetisieren oder Struktur- und Funktionsanalysen durchzuführen, sollte in dieser Arbeit außerdem die heterologe Überexpression der Cyt bd Oxidase in E. coli sowie ihre Reinigung ermöglicht werden.

32 Material und Methoden Material und Methoden Die Methoden, die im Folgenden beschrieben werden, richten sich nach Standard- Vorschriften, wie sie in unterschiedlichen Methodensammlungen veröffentlicht wurden (Bertram, 1991; Lottspeich, 1998; Rehm, 1997; Sambrook, 2001). 2.1 Materialien Verwendete Chemikalien Die Chemikalien wurden im analytischen Reinheitsgrand verwendet. Aceton Acrylamid (Mix 37,5 : 1) Agar Agarose Ammoniumacetat Ammoniumeisen III-citrat Ammoniumperoxodisulfat, APS Ampicillin Anhydrotetracyclin Ascorbat 5-Bromo-4-Chloro-3-indoylphosphat 4-Toluidinsalz Rinderserumalbumin, BSA Bromphenolblau CaCl 2 Ca(NO 3 ) 2 3-(Cyclohexylamino)-1-Propansulfonsäure, CAPS 3-(Cyclohexylamino)-2-Hydoxy-1-Propansulfonsäure Chloramphenicol Chloroform 2,5-Dibromo-6-Isopropyl-3-methyl-1,4-Benzochinon Cetyltriethylammoniumbromid, CTAB CuSO 4 x 5H 2 O N,N -Dimethylformamid, DMF dntps DTT Dimethylsulfoxid, DMSO β-dodecylmaltosid (β-dm) Biomol Natriumethylendiamintetraacetat, EDTA Essigsäure Ethidiumbromid Ethanol, p.a Formaldehyd Glucose Glycerin 86-88% Glycin Harnstoff H 3 BO 3 Hefeextrakt Applichem Malinckrodt Baker Difco Amresco Baker Riedel-deHäen Fluka Sigma Acros Sigma Applichem Applichem Riedel-deHäen Riedel-deHäen Baker Acros Fluka Sigma Malinckrodt Baker Sigma Sigma Riedel dehäen Malinckrodt Baker MBI Fermentas Biomol Sigma Glycon Merck Malinckrodt Baker Fluka Malinckrodt Baker Riedel-deHäen Malinckrodt Baker Sigma Biomol Merck Baker Difco

33 Material und Methoden 25 N-(2-Hydroxyethyl) piperazin-n -(2-ethansulfonsäure), HEPES Hexadecyltrimethylammoniumbromid (CTAB) Isopropyl- -D-thiogalactosid, IPTG KCl K 2 HPO 4 x 3H 2 O K 3 [Fe(CN) 6 ], Ferricyanid KOH Kanamycin N-Laurylsarcosin Mannitol MES MgCl 2 MgSO 4 x 7H 2 O MnCl 2 MnSO 4 x 1H 2 O β-mercaptoethanol Natriumacetat Natriumascorbat Natriumcitrat x 2H 2 O NaCl Na 2 CO 3 NaHCO 3 Na 2 HPO 4 x 2H 2 O NaH 2 PO 4 NaOH NaNO 3 Na 3 PO 4 Na 2 S 2 O 3 (NH 4 ) 2 SO 4 NiSO 4 Nitrilotriessigsäure Nitroblau-Tetrazoliumchlorid, NBT Perfect Blot p-phenylbenzochinon, ppbq Pepton, tryptisch verdautes Casein Phenol Phosphorsäure Phenylmethylsulfonylfluorid, PMSF 2-Propanol RNAprotect TM Bacteria Reagent Saccharose Salzsäure Schwefelsäure Natriumdodecylsulfat, SDS Serva Blue N,N,N,N,tetramethylethylendiamin, TEMED Tosyllysylchloromethylketon, TLCK Trichloressigsäure Tris(hydroxymethyl)aminomethan, TRIS Triton X-100 Tween 20 Merck Sigma MBI Fermentas Riedel dehäen Riedel dehäen Riedel dehäen Baker Sigma Sigma Roth Merck Malinckrodt Baker Malinckrodt Baker Malinckrodt Baker Merck Merck Malinckrodt Baker Sigma Malinckrodt Baker Riedel dehäen Riedel dehäen Riedel dehäen Riedel dehäen Merck Malinckrodt Baker Baker Sigma Riedel dehäen Malinckrodt Baker Malinckrodt Baker Sigma Applichem Mobi Tech Sigma Roth Roth Riedel dehäen Sigma Malinckrodt Baker Qiagen Sigma Malinckrodt Baker Malinckrodt Baker Biomol Serva Sigma Sigma Malinckrodt Baker Biomol Sigma Sigma

34 Material und Methoden Geräte und Verbrauchsmaterialien Autoklav Chelating Sepharose Fast Flow DUAL-PAM-100 Elektrophoresekammern für Agarosegele für SDS-Gele, Protean 3 Fast Plasmid-Mini Fermenter, 5 Liter French-Press FPLC-Anlage, GradiFrac Sytem Gefrierschrank 70 C Geldokumentation Gelextraktionskit Glasperlen (RNase-/DNase-frei) Heizblock His-select nickel affinity gel KAPA qpcr Master Mix Klimakammer Klimaschrank Konzentratoren Centricon, Centriplus Kugelmühle " BeadBeater" Kunststoffgefäße Kryoröhrchen 2,0 ml Petrischalen Reaktionsgefäße 1,5 ml Reaktionsgefäße 1,5ml save lock Reaktionsgefäß 2,0 ml Röhrchen 12 ml Röhrchen 30 ml, 50 ml Magnetrührgeräte Mini RNeasy Kit Midipräpkit Nucleobond AX100 Nanodrop Leersäulen Chromatographie Parafilm PCR-Thermocycler Trioblock ph-meter Photometer Pipetten Pipettenspitzen PVDF-Membran QuantiTect Reverse Transcription Kit Rotamix Schüttelinkubator SemyDry Blottapparatur Sensi Mix One Step Kit Spannungsgeber Speed Vac Sterilbank Sterilfilter 0,2 µm, 0,45 µm Tischzentrifuge UV-Transiluminator Vortex Wasserbad H+P Labortechnik Amersham Biosciences Walz GmbH Stratagene Biorad Eppendorf Braun Thermo Spectronic Pharmacia REVCO MWG-Biotech, peqlab Macherey-Nagel Sigma Techne Sigma peqlab W. Ollbrink Kältetechnik Snijder Scientific Amicon, Millipore BioSpec Sarstedt Sarstedt Sarstedt Eppendorf Sarstedt Greiner Sarstedt, Corning Janke& Kunkel KG Quiagen Macherey-Nagel peqlab MoBiTec American National Cam Biometra Knick Beckmann DU7400 Eppendorf Sarstedt Millipore Qiagen ELMI Braun Biotech Biometra peqlab Gibco Savant Heraeus Millipore Eppendorf Biometra Heidolph Köttermann

35 Material und Methoden 27 Zentrifugen Beckmann Avanti J-25 Du Pont Sorvall RC-5B Ultrazentrifugen Beckmann Optima TL Beckmann L8-80M Enzyme Bei molekularbiologischen Arbeiten wurden die Restriktionsenzyme der Firmen MBI Fermentas sowie New England Biolabs verwendet. Beim Einsatz anderer DNAmodifizierender Enzyme (wie CIAP, T4- Ligase, T4-Polymerase) wurden die Produkte der Firma MBI Fermentas angewendet. Es wurde Taq-Polymerase der Firmen Invitrogen und Eppendorf, sowie Pfu-Polymerase aus eigener Herstellung für die Durchführung von PCRs eingesetzt. RNaseI, DNase und Lysozym wurden von Sigma bezogen. Für den DNase Verdau von RNA-Ansätzen wurde die Turbo free DNase der Firma Ambion verwendet Standards für DNA- und Protein-Elektrophorese Bei der elektrophoretischen Trennung von DNA-Fragmenten oder Proteinen wurden zur Bestimmung der Größe bzw. des Molekulargewichtes Standards als Referenz verwendet. Die folgenden Standards fanden Verwendung: Tabelle 2-1 DNA-Standards für Agarosegelelektrophorese Bezeichnung Hersteller Fragmentlängen [bp] λ / EcoRI/HindIII eigene Herstellung 21226, 5184, 4973, 4277, 3530, 2027, 1904, 1584, 1330, 983, 831, 564, 125 GeneRuler TM 1kb DNA Ladder MBI Fermentas 10000, 8000, 6000, 5000, 4000, 3500, 3000, 2500, 2000, 1500, 1000, 750, 250 puc/mspi MBI Fermentas 501, 489, 404, 331, 242, 190, 147, 111/ 110, 67, 34 Tabelle 2-2 Proteinstandards bei Verwendung eines Tris-Glycin SDS-PAGE-Systems Bezeichnung Hersteller Molekulargewicht [kda] See Blue Plus2 Prestained Protein Standard Invitrogen 250, 148, 98, 64, 50, 36, 22,16, 6, 4 Mark 12 Unstained Standard Invitrogen 200; 116,3; 97,4; 66,3; 55,4; 36,5; 31; 21,5; 14,4; 6,0; 3,5; 2,5 PageRuler TM Prestained Protein Ladder MBI Fermentas 170, 130, 100, 70, 55, 40, 35, 25, 15, 10

36 Material und Methoden Mikrobiologische Methoden Steriles Arbeiten Alle Nährmedien, Lösungen und sonstigen Arbeitsmaterialien, wie Reaktionsgefäße oder Pipettenspitzen wurden für Minuten bei 120 C und einem Druck von 1 bar autoklaviert. Glasgeräte, wie Erlenmeyerkolben, Begasungsröhren oder Reagenzgläser wurden zur Sterilisation für 6-8 Stunden bei 200 C im Thermoschrank inkubiert. Thermolabile Substanzen (wie beispielsweise Antibiotika) wurden durch Filtration durch einen 0,2 µm oder 0,45 µm Sterilfilter dekontaminiert Escherichia coli und seine Handhabung Bakterienstämme Im Zuge der experimentellen Arbeiten wurden folgende E. coli-stämme verwendet: Tabelle 2-3 Liste der verwendeten E. coli Stämme und ihrer Genotypen Stamm Genotyp Verwendung, Referenz E. coli DH5αMRC F - mera (mrr hsdrms-mrcbc) φ 80 lacz M15 (laczya-argf) supe44 hsdr17 reca1 enda1 gyra96 thi-1 rela1 E. coli BL21(DE3) hsds gal (λc Its857 ind1 Sam7 Klonierungsarbeiten und Amplifikation von Vektoren, methylasedefizient; Invitrogen heterologe Expression von Proteinen; Invitrogen nin5 lacuv5-t7 gene 1) E. coli C41(DE3) basiert auf E. coli BL21(DE3) modifizierte, heterologe Expression von Proteinen Miroux & Walker, 1996 E. coli C43(DE3) basiert auf E. coli BL21(DE3) modifizierte, heterologe Expression von Proteinen Miroux & Walker, 1996 E. coli BL21(DE3) cyo hsds gal (λc Its857 ind1 Sam7 nin5 lacuv5-t7 gene 1), cyoabcde - PD M. Lübben (RUB)

37 Material und Methoden Anzucht und Lagerung von E. coli Es wurden die folgenden Medien verwendet: LB 1 % (w/v) Pepton 0,5 % (w/v) Hefeextrakt 1 % (w/v) NaCl SOB 2 % (w/v) Pepton 0,5 % (w/v) Hefeextrakt 0,05 % (w/v) NaCl 2,5 mm KCl 10 mm MgCl 2 SOC 2 % (w/v) Pepton 0,5 % (w/v) Hefeextrakt 0,05 % (w/v) NaCl 2,5 mm KCl 10 mm MgCl 2 20 mm Glucose TB 1,2 % (w/v) Trypton 2,4 % (w/v) Hefeextrakt 4,0% (v/v) Glycerin 17 mm KH 2 PO 4 72 mm K 2 HPO 4 TP 2 % (w/v) Trypton 1,5 % (w/v) Hefeextrakt 0,8 % (w/v) NaCl 0,2% (w/v) Na 2 HPO 4 0,1% (w/v) KH 2 PO µm CaSO 4 Nach dem Lösen der angegebenen Substanzen wurde mit NaOH der ph-wert auf 7,0 eingestellt. Das jeweilige Medium wurde 20 Minuten bei 120 C autoklaviert. Die Anzucht der Bakterien zur späteren Isolierung von Plasmid-DNA erfolgte in LB- Medium. Zur Kultivierung von Bakterien auf LB-Agarplatten wurde dem Medium 1,5 % (w/v) Agar vor dem Autoklavieren hinzugefügt. SOB- und SOC- Medium fanden vor allem bei der Herstellung kompetenter E. coli-zellen sowie bei der Transformation ihre Verwendung. Das TP-Medium wurde vor allem bei heterologer Expression von Proteinen eingesetzt. Um einen Selektionsdruck auf die plasmid-tragenden Bakterien ausüben zu können, wurden den Medien definierte Mengen des jeweiligen, sterilfiltrierten Antibiotikums

38 Material und Methoden 30 hinzugefügt. Da Antibiotika in der Regel thermolabil sind, erfolgte dies erst nach ausreichender Abkühlung des Mediums nach dem Autoklavieren. Es wurden die folgenden Antibiotika-Konzentrationen verwendet: Ampicillin Chloramphenicol Kanamycin 100 µg/ml 50 µg/ml 50 µg/ml Anzucht der Zellen Die E. coli Zellen wurden auf LB-Agarplatten oder in Flüssigkultur bei 37 C kultiviert. Flüssigkulturen wurden von den entsprechenden Stammplatten von Einzelkolonien inokuliert und über Nacht bei 220 rpm auf einem Schüttler inkubiert. Enthielten die Bakterien ein Plasmid, so wurde entsprechend der Resistenz ein Antibiotikum hinzugefügt. Zur Abschätzung der Zelldichte einer Flüssigkultur wurde die optische Dichte bei 600 nm photometrisch bestimmt. Der Null-Abgleich erfolgte gegen das jeweilige unbeimpfte Medium. Agarplatten Aus einer Flüssigkultur wurden 50 µl bis 200 µl Bakteriensuspension auf eine Agarplatte ausplattiert und über Nacht bei 37 C inkubiert. Für die weitere Lagerung bei 4 C wurden die Platten mit Parafilm verschlossen und konnten so für einige Wochen aufbewahrt werden. Kulturen für Langzeitlagerung Da die Lagerung von Bakterienkulturen auf Agar-Platten bei 4 C nur über einen Zeitraum von wenigen Wochen empfehlenswert ist, wurden für die Langzeitlagerung Glycerinkulturen verwendet. Dazu wurden zunächst von der jeweiligen Kultur eine 2 ml-übernachtkultur angezogen und die Bakterien in der Tischzentrifuge für 3 Minuten bei rpm sedimentiert. Nach Abdekantieren des Überstandes erfolgte die Resuspension in frischem Medium mit 15 % Glycerin. Das Volumen der Glycerinkultur betrug 1 ml. Die Kryoröhrchen konnten nach Schockgefrierung in flüssigem Stickstoff bei -70 C für einen langen Zeitraum gelagert werden.

39 Material und Methoden Herstellung kompetenter E. coli-zellen (nach Inoue et al., 1990) Für die Herstellung kompetenter Zellen wurden 250 ml SOB Medium mit den betreffenden Zellen inokuliert und bei 18 C in einem 2 Liter Erlenmeyerkolben bis zu einer OD 600 = 0,6 bei rpm inkubiert. Anschließend erfolgte eine Inkubation für 10 Minuten auf Eis. Die Zellen wurden bei 2500 g in der Kühlzentrifuge sedimentiert (10 min, 4 C). Das Sediment wurde in 80 ml eiskaltem TB (10 mm HEPES-KOH ph 6,7, 15 mm CaCl2, 250 mm KCl, 55 mm MnCl2) resuspendiert und wieder für 10 min auf Eis inkubiert. Nach einem weiteren Zentrifugationsschritt wurden die Zellen vorsichtig in 20 ml eiskaltem TB aufgenommen DMSO bis zu einer Endkonzentration von 7 % zugegeben und die Zellen in 400 µl Aliquots schockgefroren. Die Lagerung erfolgte bei 70 C Transformation von E. coli mittels Hitzeschock (nach Inoue et al., 1990) Zur Transformation wurden ng DNA zu 200 µl kompetenten Zellen pipettiert und diese für 30 Minuten auf Eis inkubiert. Als Kontrolle diente jeweils ein Aliquot Zellen, das gleich behandelt und dem keine DNA zugesetzt wurde. Nach der Inkubation erfolgte ein Hitzeschock bei 42 C für 30 Sekunden. Die Ansätze wurden danach wieder für wenige Minuten auf Eis inkubiert. Nach der Zugabe von 800 µl SOB- oder SOC-Medium wurden die jeweiligen Ansätze für 1 Stunde bei 37 C geschüttelt (220 rpm). Abschließend wurden µl des jeweiligen Ansatzes auf selektiven LB-Platten ausplattiert und über Nacht bei 37 C inkubiert Heterologe Expression von PetP-His aus T. elongatus in E. coli Für die Expression von PetP in E. coli wurden immer frisch transformierte Zellen verwendet. Dazu wurde der Vektor pask-iba35-petp in E. coli BL21 (DE3) transformiert und auf Ampicillin 100 µg/ml selektiert. Zur Inokulation der 5-Liter Hauptkultur wurde eine 50 ml-vorkultur in LB + Antibiotika bei 37 C und 220 rpm über Nacht angezogen. Am nächsten Morgen wurden TP-Medium µg Ampicillin/ ml mit der Vorkultur im 5 Liter Braun-Reaktor beimpft und bis zu einer OD 550 = 0,5 unter Rühren (100 rpm) und Begasung (4-6 l Luft pro Minute) bei 37 C inkubiert. Nach Erreichen der genannten Zelldichte wurde die Hauptkultur mit Anhydrotetracyclin induziert (Endkonzentration = 0,2µg/ml). Die Anzucht der

40 Material und Methoden 32 induzierten Kultur erfolgte bei verschiedenen Temperaturen (siehe Ergebnisteil) für 3 Stunden Heterologe Expression der Cyt. bd Oxidase aus T. elongatus in E. coli Für die heterologe Expression der Cyt. bd Oxidase aus T. elongatus in E. coli wurden die Stämme E. coli BL21 (DE3), C41 (DE3), C43 (DE3) und BL21 (DE3) cyo verwendet. Als Vorkultur wurden 50ml TP-Medium, das 100 µg/ml Ampicillin enthält, mit einer frisch transformierten E. coli-kolonie beimpft und über Nacht bei 37 C und 200 rpm geschüttelt. Am nächsten Tag wurde die 5 Liter-Hauptkultur mit der Vorkultur inokuliert und bis zu einer OD 550 = 0,4 bei 37 C unter Rühren (100 rpm) und Begasung (4-6 Liter Luft pro Minute) inkubiert. Dann wurde die Kultur in mikroaerobe Wachstumsbedinungen überführt, indem die Begasung abgestellt wurde. Außerdem wurde eine Nitrat und alternative Kohlenstoffquelle zu der Kultur gegeben, um das Wachstum unter mikroaeroben Bedingungen zu erleichtern. Bei einer OD 550 = 0,5 wurde die Expressionskultur mit Anhydrotetracyclin induziert. Die Expressionsdauer betrug Stunden Thermosynechococcus elongatus und seine Handhabung Verwendete Stämme Die folgenden T. elongatus Stämme wurden in dieser Arbeit verwendet: Tabelle 2-4 Auflistung der verwendeten T. elongatus Stämme Stamm Anzucht Eigenschaften Referenz T. elongatus BG-11 Medium T. elongatus BG-11 petp Medium T. elongatus BG-11 petp-his Medium T. elongatus BG-11 cydab - Medium [pdg6] T. elongatus cydab - [pdg9] T. elongatus cydab - [pdg12] BG-11 Medium BG-11 Medium Wildtyp Labor Stamm petp- Deletionsmutante M. Gendrullis (2004) (Diplomarbeit) Mutante, mit c-terminalem His 10 -tag an petp M. Gendrullis (2004) (Diplomarbeit) tll2230, cydab minus; die Mutation der cydab diese Arbeit; Gene wurde komplementiert und stehen unter der V. Thiemann (2007) Kontrolle des cydab-eigenen Promotors tll2230, cydab minus; die Mutation der cydab Gene wurde komplementiert und stehen unter der Kontrolle des nrs-promotors aus Synechocystis tll2230, cydab minus; die Mutation der cydab Gene wurde komplementiert und stehen unter der Kontrolle des petc-promotors aus T. elongatus diese Arbeit; V. Thiemann (2007) diese Arbeit; V. Thiemann (2007)

41 Material und Methoden 33 Die folgenden T. elongatus Mutanten wurden im Rahmen dieser Arbeit erstellt: Tabelle 2-5 Auflistung der erzeugten T. elongatus Mutanten Stamm Anzucht Eigenschaften Selektionsdruck T. elongatus cyda T. elongatus tll2230 T. elongatus nifs BG-11 Medium BG-11 Medium BG-11 Medium cyda Mutante; eine Chloramphenicol- Resistenz wurde in das cyda Gen inseriert tll2230-deletionsmutante nifs-deletionsmutante Cm 16µg/ml Km 90µg/ml Km 90µg/ml T. elongatus cytm T. elongatus cyda/ petp BG-11 Medium BG-11 Medium cytm-deletionsmutante Doppelmutante cydab -- / petp Km 90µg/ml Cm 9µg/ml Km 90µg/ml Medien, Anzucht und Lagerung T. elongatus wurde stets in BG-11-Medium kultiviert. BG-11-Medium (alle Stammlösungen wurden im Kühlraum bei 4 C gelagert) 5,0 mm HEPES ph 8,2 1,0 % (v/v) 100x BG-FPC 1,76 M NaNO 3 30 mm MgSO 4. 7 H 2 O 25 mm CaCl 2. 2 H 2 O 3 mm Citronensäure 0,3 mm NaEDTA (ph8) 10 % Spurenelemente 0,1 % (v/v) 6 g/l Eisenammoniumcitrat gelöst in A.bidest 0,1 % (v/v) 20 g/l Na 2 CO 3 gelöst in A.bidest 0,1 % (v/v) 40 g/l K 2 HPO 4 gelöst in A.bidest Spurenelemente 4,6 mm H 3 BO 3 9,0 mm MgCl 2. 4 H 2 O 0,8 mm ZnSO 4. 7 H 2 O 1,6 mm Na 2 MoO 4. 2 H 2 O 0,3 mm CuSO 4. 5 H 2 O 1,7 mm Co(NO 3 ) 2. 6 H 2 O gelöst in Aqua bidest BG-11-Agarplatten Die Platten enthielten anstatt 5 mm HEPES 10 mm HEPES. Für die Herstellung der Platten wurde das Medium in zweifacher Konzentration angesetzt und getrennt vom Agar, der in Wasser gelöst wurde, autoklaviert. Nach dem Autoklavieren wurden Medium und gelöster Agar gemischt, dabei betrug die Agar-Konzentration der Platten 1,5 %.

42 Material und Methoden 34 Abbildung 2-1 Luftbeheizter Inkubator zur Anzucht von T. elongatus mit CO 2 -Begasung Die T. elongatus-kulturen wurden im BG-11-Medium in Erlenmeyerkolben oder in Begasungsröhren (wie in Abbildung 2-1 zu sehen ist) angezogen. Die Belichtungsintensität betrug µem -2 s -1 und die Temperatur 45 C. Die in den Begasungsröhren angezogenen Kulturen wurden mit 5 % CO 2 begast. Unter CO 2 - Begasung war es möglich, Kulturen in größeren Maßstäben anzuziehen. Dabei konnten die Kulturen sowohl in 50 ml-, 150 ml- und 300 ml-begasungsröhren, als auch im 3 l-penicillin-kolben bis hin zum 20 l-fermenter angezogen werden. Für die Anzucht eines Fermenters war es nötig, zunächst eine Vorkultur anzuziehen, mit der der Fermenter beimpft werden konnte. In der Regel wurde hierzu eine Kultur im 3 l- Penicillinkolben oder mehrere begaste 300ml-Kulturen angezogen. Das Selektivmedium enthielt bis zu 20 µg/ml Chloramphenicol oder bis zu 90 µg/ml Kanamycin. Die Antibiotika-Konzentration in den Selektivplatten lag bei 7,5 µg/ml Chloramphenicol und 60 µg/ml Kanamycin. Die Lagerung der Kulturen erfolgte mittels BG-11-Platten sowie mit Glycerinkulturen (siehe ). Dabei war es nötig, die Platten, die nach dem Ausstreichen der Kultur gut mit Parafilm verschlossen wurden, nach ungefähr 2 Wochen neu auszustreichen Kulturen für Langzeitlagerung Mittels Ausplattierung auf BG-11-Platten war nur eine relativ kurzfristige Lagerung möglich. Für die längerfristige Lagerung wurden Glycerinkulturen erstellt. Dazu wurde zunächst eine 20 ml-flüssigkultur bis zu einer OD 750 = 1 1,5 angezogen. Die

43 Material und Methoden 35 Kultur wurde durch Zentrifugation bei 5000 rpm für 10 Minuten bei Raumtemperatur sedimentiert. Die sedimentierten Zellen wurden in 400 µl Medium resuspendiert. Danach wurden die resuspendierten Zellen mit 200 µl Glycerin sowie 800 µl Medium versetzt. Damit das Glycerin in die Zellen eindringen konnte, wurden die Kulturen, 1 Stunde auf Eis belassen. Abschließend wurden die Ansätze in flüssigem Stickstoff eingefroren und bei -70 C gelagert Bestimmung der Zelldichte Zur Abschätzung der Zelldichte einer Flüssigkultur wurde die optische Dichte bei 750 nm photometrisch bestimmt. Der Null-Abgleich erfolgte gegen BG-11-Medium Transformation von T. elongatus mittels Elektroporation T. elongatus Kulturen wurden mittels Elektroporation nach dem Protokoll von Mühlenhoff et al. (1996) transformiert. Zunächst wurden ml Kultur bis zu einer OD 750 = 0,5-1 unter CO 2 -Begasung angezogen, und nach Bestimmung der optischen Dichte geerntet (5 min; 5000 rpm, RT). Dann wurden die Zellen mit 1 Volumen sterilem Puffer (2 mm Tricin, 1 mm EDTA, ph 8.0) sowie zweimal mit sterilem, destilliertem Wasser gewaschen. Die Zellen wurden in sterilem Wasser resuspendiert und dabei auf eine OD 750 nm = 20 gebracht. Nun wurden µl der vorbereiteten Zellen mit 12 µg der zu transformierenden DNA in einer Elektroporationsküvette gemischt, 2 min auf Eis gekühlt und dann elektroporiert. Als Kontrolle diente ein gleich behandelter Ansatz, bei dem keine DNA zugesetzt wurde. Die eingesetzte Spannung betrug zwischen 1,1-1,6 V/cm, bei 200 Ω und 25 µf. Nach der Elektroporation wurden die Zellen sofort in frisches BG-11-Medium transferiert. Zunächst wurden die Ansätze in Reagenzgläser überführt und dann zur Regeneration 24 h ohne selektives Antibiotikum wachsen gelassen. In den folgenden Tagen wurde der Selektionsdruck schrittweise erhöht und bei Bedarf Medium zugegeben. Wenn die Ansätze ein Volumen über 6 ml erreichten, wurden sie zunächst in 10 ml-begasungsröhrchen und später in 50 ml-begasungsröhren überführt. Zur Sicherheit wurden von dieser multiklonalen Kultur auch Ausstriche auf BG-II-Platten gemacht.

44 Material und Methoden Segregation des T. elongatus-genoms T. elongatus besitzt ein polyploides Genom. Als Segregation wird die Selektion eines Genoms bezeichnet, in dem nur noch rekombinante Genom-Kopien vorliegen. Die Segregation des rekombinanten T. elongatus-genoms erfolgte in mehreren Schritten in Flüssigmedium. Die Konzentration des selektiven Antibiotikums wurde dabei in kleinen Schritten kontinuierlich erhöht. Jedes Mal, wenn die multiklonale Kultur bereits eine OD 750 = 1-1,5 erreichte, wurde von die Kultur verdünnt. Der Zustand der Segregation des Genoms wurde mittels analytischer PCR überprüft (siehe ). Bei vollständiger Segregation erfolgte ein Einzel-Kolonie-Ausstrich aus der multiklonalen Kultur Nickel-Induktion der T. elongatus cyda [pdg9]-mutante Bei der T. elongatus cyda Mutante wurden die cydab Gene durch die Insertion einer Chloramphenicol-Resistenz-Kassette inaktiviert. Nach vollständiger Segregation wurde die Mutante komplementiert. Vor die komplementierenden cydab-gene wurde der nickel-indzierbare nrs-promotor aus Synechocystis kloniert. Zur Nickel-Induktion der T. elongatus cyda [pdg9]-mutante wurde zunächst eine 150 ml-kultur für 36 Stunden unter Begasung angezogen. Dann wurde die Kultur mit 20 µm NiSO 4 versetzt und für weitere Stunden unter Begasung angezogen, ehe die Zellen geerntet und mit der French Press aufgeschlossen wurden. Im Anschluss erfolgte die Isolierung der Membranen. 2.3 Molekularbiologische Arbeiten Sofern nicht gesondert darauf hingewiesen wird, wurde nach den Vorschriften von (Sambroock et al., 1989) verfahren Plasmidpräparationen Für kleinere Präparationen, z.b. zur Überprüfung von Klonen, wurde ein modifiziertes Protokoll der Plasmidschnellisolierung aus E. coli nach Holmes und Quigley (1981) verwendet. Diese Methode, die in der Durchführung schneller und einfacher als die Methode der alkalischen Lyse (Birnboim et al., 1979) ist, liefert eine Plasmid-Lösung mit Verunreinigungen durch Proteine und diente ausschließlich

45 Material und Methoden 37 der Gewinnung von Plasmiden, die im Rahmen analytischer Restriktionen charakterisiert werden sollten. Dabei wurden 1,5 3 ml einer E. coli-übernachtkultur in 75 µl Lysispuffer (8 % (w/v) Saccharose; 0,5 % (w/v) Triton X-100; 50 mm EDTA ph 8,0; 10 mm Tris- HCl ph 8,0; 0,7 mg/ml Lysozym) resuspendiert und dann 45 sek bei 100 C gekocht. Nach einer Zentrifugation für 15 Minuten bei rpm konnten die gummiartige Sedimente (Proteine und Zellwände) mit einem sterilen Zahnstocher entnommen werden. Die DNA wurde mit Isopropanol gefällt und mit 70 % Ethanol gewaschen. Die DNA-Sedimente wurden in der SpeedVac getrocknet und anschließend in Tris- HCl 10 mm ph 8 aufgenommen. Plasmidpräparationen höheren Sauberkeitsgrades wurden mit dem Plasmid-Miniprep Kit der Firma Eppendorf oder mit dem Nucleobond AX100 Kit der Firma Macherey- Nagel durchgeführt Präparation von DNA aus Cyanobakterien Präparation genomischer DNA aus Thermosynechococcus elongatus Um genomische DNA aus T. elongatus zu isolieren, wurde eine 50 ml-flüssigkultur bis zu einer OD 750 > 2 angezogen und die Zellen nach der Anzucht durch eine Zentrifugation (10 Minuten bei 6000 rpm) sedimentiert. Die Zellen wurden mit 10 ml TES (5 mm Tris-HCl ph8.5, 50 mm NaCl, 5 mm EDTA) gewaschen und dann erneut sedimentiert. Es erfolgte ein zweiter Waschschritt mit 1 ml TES. Die sedimentierten Zellen wurden in flüssigem Stickstoff eingefroren und für mindestens 2 Stunden bei -70 C belassen. Nach dem Auftauen wurde die Probe in 400 µl TES aufgenommen und mit 2,5 mg Lysozym versetzt. Nach einer Inkubation von min bei 50 C wurden zum Ansatz 50 µl Sacrosyl (10 %) und 600 µl Phenol hinzu gegeben und dieser für 15 Minuten bei RT auf dem Rotamix inkubiert. Nach einem Zentrifugationsschritt (10 Minuten, rpm) wurde der DNA-haltige Überstand in ein neues Reaktionsgefäß überführt. Es folgte ein RNase-Verdau (30 minütige Inkubation bei 37 C). Zu je 600 µl Probe wurden 100 µl 5 M NaCl (10 % CTAB, 0.7 M NaCl) und 80 µl CTAB/NaCl hinzu gegeben und für 10 Minuten bei einer Temperatur von mindestens 60 C inkubiert. Nachdem der Ansatz mit 1 ml Chloroform versetzt worden war, folgte eine Inkubation von 15 Minuten auf dem Rotamix und ein Zentrifugationsschritt (10 Minuten bei rpm). Der Überstand

46 Material und Methoden 38 wurde im Folgenden zweimal mit dem gleichen Volumen Phenol/Chloroform und einmal mit dem gleichen Volumen Chloroform extrahiert und die DNA durch die Zugabe von Isopropanol gefällt. Das Sediment wurde nach der Fällung mit 70 % Ethanol gewaschen, in der Speed Vac getrocknet und dann in 50 µl TE (10 mm Tris/HCl, ph 7.5, 1 mm EDTA ph 8.0) resuspendiert Schnellpräparation von DNA aus Cyanobakterien Die mittels dieser Methode isolierte DNA wurde vor allem im Rahmen der Überprüfung der Segregation des rekombinanten T. elongatus-genoms eingesetzt (siehe ). Zunächst wurden 5-10 ml einer Flüssigkultur durch Zentrifugation (10 Minuten, 5000 rpm) sedimentiert. Das Sediment wurde in 200 µl Aqua bidest. resuspendiert, im Heizblock für maximal 75 Sekunden gekocht und anschließend für 10 Minuten bei rpm zentrifugiert. Der Überstand, in dem sich die DNA befand, wurde in ein neues Reaktionsgefäß überführt. Für eine analytische PCR wurden im folgenden 10 µl dieser DNA-Lösung eingesetzt Konzentrations- und Reinheitsbestimmung einer DNA-Lösung Konzentration und Reinheit einer DNA-Lösung Zur Bestimmung der Konzentration und Reinheit einer DNA-Lösung wurde die optische Dichte bei 260 und 280 nm bestimmt. DNA besitzt bei 260 nm ein Absorptionsmaximum, wobei eine OD 260 = 1 einer DNA-Konzentration von 50 µg/ml entspricht. Unter Berücksichtigung des Verdünnungsfaktors konnte die Konzentration der DNA-Lösung errechnet werden. Die Verunreinigung der DNA-Lösung mit Proteinen konnte durch den Quotienten der OD 260 / OD 280 errechnet werden. Eine DNA-Lösung mit einem OD 260 /OD 280 -Quotienten von 1,8 gilt als proteinfrei Abschätzen der DNA-Konzentration durch die Fluoreszenzintensität Bei DNA-Lösungen, die erwartungsgemäß niedrig konzentriert waren, erfolgte die Bestimmung der DNA-Konzentration durch eine Einschätzung über die Fluoreszenz in einem ethidiumbromid-haltigen Agarosegel. In der Regel war dies bei DNA- Lösungen, die für eine Ligation (siehe ) bestimmt waren, der Fall. Die

47 Material und Methoden 39 Helligkeitsunterschiede zwischen der Vektorbande und der Bande des zu inserierenden Fragments im Gel sowie die Größe der entsprechenden Fragmente gab Auskunft über ihr mengenmäßiges Verhältnis zueinander Agarose-Gelelektrophorese von DNA-Fragmenten Zur Analyse oder Präparation von definierten DNA-Fragmenten wurde die DNA einer Agarosegelelektrophorese in einem TBE- (22,5 mm Tris-Borat; 0,5 mm EDTA, ph 8) oder TAE-Puffersystem (40 mm Tris-Acetat, 1 mm EDTA, ph 8) unterzogen. Bei präparativer Agarosegelelektrophorese wurde insbesondere das TAE-Puffersystem verwendet, da dieses sich gut für die Extraktionen von DNA- Fragmenten aus dem Agarosegel eignet. Das Borat, das im TBE-Puffer enthalten ist, interagiert mit dem Silica-Material des Extraktionskits und verringert so die Ausbeute. Es wurden Agarosekonzentrationen zwischen 0,7 % und 2 % verwendet. Dabei dienten 0,7 %ige Gele der Auftrennung von Fragmenten zwischen 0,8 und 12 kb; bei 1 %igen Gelen konnten Fragmente zwischen 0,5 und 7 kb und bei 2 %igen Gelen Fragmente zwischen 0,1 und 2 kp aufgetrennt werden. Die Visualisierung der verschiedenen DNA-Banden im Agarosegel erfolgte durch Ethidiumbromid (0,5 µg/ml), einem Fluoreszenzfarbstoff, der mit DNA interkaliert und bei Bestrahlung mit UV-Licht im sichtbaren Bereich (590 nm) fluoresziert. Auf diese Weise können bereits Nukleinsäuremengen von weniger als 5 ng detektiert werden (Mühlhardt, 1999). Die unter beschriebenen Standards wurden bei Größenbestimmung der DNA-Fragmente als Referenz verwendet DNA-Extraktion aus Agarosegelen Nach der Elektrophorese wurde zur präparativen Reinigung der DNA-Fragmenten das entsprechende Gelstück möglichst exakt aus dem Gel ausgeschnitten und mit Hilfe des Gelextraktionskits Nucleo Spin Extract 2 in 1 der Firma Macherey & Nagel nach Vorschrift des Herstellers gereinigt.

48 Material und Methoden Fällung von DNA Ethanol-Fällung von DNA Die DNA-Lösung wurde zur Fällung mit 1/10 Volumen Natriumacetat ph 5,2 und dem 2,5-fachen Volumen Ethanol p.a. versetzt und mehrmals invertiert, ehe der Ansatz für mindestens 30 Minuten bei -20 C belassen wurde. Danach wurde der Ansatz zentrifugiert (15 Minuten bei 4 C und rpm), der Überstand abdekantiert und das Sediment in 500 µl 70 % Ethanol p.a. aufgenommen. Es folgte ein weiterer Zentrifugationsschritt für 5 Minuten bei rpm und 4 C. Danach wurde das DNA-Sediment für 7 Minuten in der Speed Vac getrocknet und in einem geeigneten Volumen Tris/HCl 10 mm ph 8, TE (10 mm Tris/HCl ph8; 1 mm EDTA, ph8) oder Restriktionspuffer resuspendiert Ammoniumacetat-Fällung von DNA Diese Methode zur DNA-Fällung ist besonders dazu geeignet, um sehr kleine DNA- Fragmente (kleiner als 30 bp) von großen DNA-Fragmenten zu trennen. Für die Fällung wurde die DNA-Lösung mit dem gleichen Volumen 5 M Ammoniumacetat versetzt. Danach wurde das 2,5-fache Volumen Ethanol hinzugefügt. Es folgte eine 15 minütige Inkubation bei -70 C und ein Zentrifugationsschritt für 15 Minuten bei rpm und 4 C. Der Überstand wurde dekantiert und das Sediment mit 500 µl 70 % Ethanol p.a. überschichtet und erneut zentrifugiert. Abschließend wurde das Sediment in der Speed Vac getrocknet und in einem beliebigen Volumen 10 mm Tris/HCl, ph 8 oder TE aufgenommen Enzymatische Modifikation von DNA Die Herkunft der Enzyme, die zur Modifikation von DNA verwendet wurden, ist unter beschriebenen Restriktion von DNA durch Restriktionsendonukleasen Analytische Restriktionen enthielten in der Regel 0,5 µg und präparative 3 µg DNA in einem Reaktionsvolumen von µl. Die Reaktionsansätze variierten bezüglich

49 Material und Methoden 41 der verwendeten Enymmenge und Temperatur (entsprechend der Herstellerangaben) und wurden für 1-3 h oder ün durchgeführt Modifikation überhängender DNA-Enden Nach Restriktion und Fällung wurden bei Bedarf überhängende DNA-Enden mit T7- Polymerase aufgefüllt. Die Reaktion erfolgte mit 2 U Polymerase und 2,5 mm dntps für 30 min bei 37 C. Anschließend erfolgte die Inaktivierung der Polymerase durch eine Inkubation bei 75 C für 10 Minuten Dephosphorylierung von DNA Zur Minimierung der Anzahl an Religanden bei einer Ligation, wurden die Plasmide zunächst dephosphoryliert. Die gefällte DNA wurde in 1 x CIAP-Puffer (Calf Intestine Alkaline Phosphatase) aufgenommen und mit 1 U CIAP für 1 h bei 37 C inkubiert. Anschließend erfolgte die Inaktivierung des Enzyms durch eine Inkubation bei 75 C für 10 Minuten inaktiviert Ligation Abhängig von der Konzentration der einzusetzenden DNA-Fragmente, betrug das Reaktionsvolumen µl. Das Verhältnis zwischen Vektorfragment und Insert betrug zwischen 1/5 und 1/10. Unabhängig vom Volumen wurde 1,5 U T4-DNA- Ligase je Ansatz eingesetzt. Die Inkubation der Ligationsansätze erfolgte für 1 bis 3 Stunden bei Raumtemperatur. Vor der Transformation der Ligationsansätze wurde die Ligase durch eine Inkubation bei 75 C für 10 Minuten inaktiviert. Als Kontrolle diente ein Ansatz, bei dem ausschließlich Vektor-DNA verwendet wurde Polymerasekettenreaktion Bei der PCR (Polymerase-Kettenreaktion) werden definierte DNA-Fragmente in vitro selektiv amplifiziert (Mullis et al., 1987). Dazu wird ein DNA-Fragment benötigt, welches als Vorlage ( Template ) der Synthese dient und ferner kurze Oligonukleotide ( Primer ), die sich an das zu amplifizierende Fragment anlagern. Im Rahmen dieser Arbeit wurden sowohl präparative als auch analytische PCRs durchgeführt. Über präparative PCRs wurden die für die Herstellung der zu erzeugenden Mutanten notwendigen DNA-Fragmente amplifiziert. Analytische PCRs wurden durchgeführt, um isolierte Plasmide aus transformierten E. coli-zellen

50 Material und Methoden 42 daraufhin zu untersuchen, ob das gewünschte Fragment enthalten war. Analytische PCRs wurden dann eingesetzt, wenn aufgrund geringer DNA-Mengen oder aufgrund der großen Anzahl der zu untersuchenden Klone eine analytische Restriktion nicht sinnvoll war. Bei den durchgeführten PCRs wurden zwei verschiedene DNA- Polymerasen verwendet. Die Taq-DNA-Polymerase wurde insbesondere bei analytischen PCRs eingesetzt, da sie zwar eine 5-3 -Polymerisationsaktivität jedoch keine Fähigkeit zur Fehlerkorrektur besitzt. Sollten nach Möglichkeit kein Fehler bei der Amplifizierung auftreten, so wurde die Pfu-DNA-Polymerase, die zusätzlich zu der 5-3 -Polymerisationsaktivität noch eine 5-3 -Exonukleaseaktivität hat, verwendet, da sie in der Lage ist, falsch eingebaute Nukleotide zu erkennen und zu beseitigen. Das Volumen der PCR-Ansätze betrug µl. Dabei setzte sich ein Ansatz aus 0,2-2 µg genomischer DNA (oder 5 ng Plasmid-DNA), jeweils 25 pmol Primer, 1 x PCR-Puffer, 1,5 mm MgCl 2, 20 mm dntp-mix und 5% DMSO zusammen. Als Kontrolle diente ein Ansatz, dem die Template-DNA fehlte. Bei analytischen PCRs wurde als Kontrolle Plasmid-DNA ohne das zu amplifizierende Fragment als Template eingesetzt. Für alle PCRs wurden die Parameter, wie Anlagerungstemperatur und -zeit sowie die Elongationsdauer, in Abhängigkeit der Länge des zu amplifizierden Fragmentes und der Beschaffenheit der Primer individuell optimiert. Die Oligonukleotide, die im Rahmen dieser Arbeit verwendet wurden, sind im Folgenden aufgelistet: Tabelle 2-6 Oligonukleotide, die im Rahmen dieser Arbeit verwendet wurden Name Sequenz Verwendung nt-down;tsr0524 ct-down; tsr0524 nt-up;tsr0524 ct-up;tsr0524 Telo cydm 5' for Telo cydm 5' rev Telo cydm 3' for Telo cydm 3' rev Telo nifs 5' for CCCAAGCTTCCTGCCCTGCCGCCT TTTTCACAGC CCGCTCGAGCCTATGCTTTCAGTT TTTCAGCC AAGGAAAAGCGGCCGcATGCTGG GAAACTAGCACGTCCGG CCAATGCATTGGTTCTGCAGCAAC TCCCAAACTTTGTATAATCC ATATGGTACCGATGTCATTGCTGC GGAACTG ATATCTCGAGACCAGTACGACTA AGACAGGC ATATGAGCTCATGACGTAGCCATG TGGTCTC ATATTCTAGACCTAGCCTCCTGCA GATTAGC ATGGTACCGATCGCCATCAACCGTG CTAC Die Primer nt-down;tsr0524 und ct-down; tsr0524 wurden zur Amplifizierung des petp downstream-bereiches verwendet Die Primer nt-up;tsr0524 und ct-up; tsr0524 wurden zur Amplifizierung des petp upstream-bereich verwendet Amplifizierung des cydm-upstream Bereiches im Rahmen der Erstellung einer cydm Mutante in T. elongatus Amplifizierung des cydm-downtream Bereiches im Rahmen der Erstellung einer cydm Mutante in T. elongatus Amplifizierung des nifs-upstream Bereiches im Rahmen der Erstellung einer

51 Material und Methoden 43 Telo nifs 5' rev AATTCTCGAGATGCTGAGGTTGGC GGTAACG nifs Mutante in T. elongatus Telo nifs 3' for Telo nifs 3' rev ATATTCTAGACCATGGTGCTGCGG CAATATC ATATGAGCTCTCGCCAACAGTGAG TTACAGG Amplifizierung des nifs-downstream Bereiches im Rahmen der Erstellung einer nifs Mutante in T. elongatus Telo tll2230 5' for ATATGGTACCGTCCGCAGGTAAGG TTCCATC Telo tll2230 5' rev ATATGTCAACTCGGTGAGCTTGAC Amplifizierung des tll2230-upstream Bereiches im Rahmen der Erstellung einer tll2230 Mutante in T. elongatus GTGATTG Telo tll2230 3' for ATATGTCAACTCGGTGAGCTTGAC GTGATTG Amplifizierung des tll2230-downstream Bereiches im Rahmen der Erstellung einer Telo tll2230 3' rev ATATGAGCTCCGCCTGAAGCTCGAT tll2230 Mutante in T. elongatus TAGCTC Telo cydab ATGGTAGGTCTCAGGCCGCATTGG Amplifizierung der cydab-gene; IBA33 for AGAGCCTCGACACC Insertion in das Expressionsplasmid Telo cydab ATGGTAGGTCTCAGCGCTGGCCAC pask-iba33 IBA33 rev GACTTTGCCCCGGA Telo cydab ATGGTAGGTCTCAGGCCGCATTGG Amplifizierung der cydab-gene; IBA43 for AGAGCCTCGACACC Insertion in das Expressionsplasmid Telo cydab ATGGTAGGTCTCAGCGCTGGCCAC pask-iba43 IBA43 rev GACTTTGCCCCGGA Telo cydab ATGGTAGGTCTCAGCGCCGCATTGG Amplifizierung der cydab-gene; IBA45 for AGAGCCTCGACACC Insertion in das Expressionsplasmid pask-iba45 Telo cydab ATGGTAGGTCTCAGGCCGGCCACG IBA45 rev ACTTTGCCCCGGA cydab comp for C ATATATCGATACCAACTAGGGAGA GCCTGAGAG cydab comp rev P ATATCTGCAGAGACCTAGGCCACG ACTTTGC Prom Ni for Cla ATATATCGATGTCTCTGCCGTTGGG GTTTTG Prom Ni rev EE ATATGAATTCGGTCTCTCGCCTCTG CCTTTTTTATAAC Telo for cydab ATATGGTCTCAGGCGATGGCATTGG E31 AGAGCCTCGAC Telo rev cydab P ATATCTGCAGCTAGGCCACGACTTT GCCC Prom petc for Cla ATATATCGATAGGTGGGCAGCATA GTCTTC Prom petc rev EE ATATGAATTCGGTCTCTGGTTTACG CTTATTTACTTAAGG Telo for cydab ATATGGTCTCAGGCGATGGCATTGG E31 AGAGCCTCGAC Telo rev cydab P ATATCTGCAGCTAGGCCACGACTTTGCC C Amplifizierung des cydab-promotor- und Genbereiches im Rahmen der Erstellung einer cydab-komplementationsmutante Amplifizierung des nickelindzuzierbaren nrs-promotorbereiches aus Synechocystis im Rahmen der Erstellung einer cydab- Komplementationsmutante Amplifizierung des cydab-genbereiches im Rahmen der Erstellung einer cydab- Komplementationsmutante Amplifizierung des petc-promotorbereiches im Rahmen der Erstellung einer cydab-komplementationsmutante Amplifizierung des cydab- Genbereiches im Rahmen der Erstellung einer cydab- Komplementationsmutante DNA-Sequenzierung Um sicherzustellen, dass bei der Amplifizierung der DNA-Fragmente keine Fehler entstanden sind, wurde die Korrektheit der klonierten DNA-Konstrukte durch

52 Material und Methoden 44 Sequenzierung bestätigt. Die Sequenzierungen wurden durch die Firma MWG Biotech durchgeführt Segregations-Überprüfung des rekombinaten T. elongatus-genoms Um zu überprüfen, in wie weit eine eingefügte Mutation in alle Genom-Kopien der Zelle integriert wurde, wurde in regelmäßigen Abständen die Segregation kontrolliert. Dabei wurde mittels der Schnellpräparation (siehe ) DNA aus der jeweiligen T. elongatus-mutante isoliert. Danach wurden 5-10 µl der gewonnen DNA-Lösung als Template für eine analytische PCR eingesetzt. Daneben wurde als Negativkontrolle der Segregation in einem Ansatz Wildtyp-DNA als Template verwendet. Die folgenden Primer wurden verwendet, um die Segregation zu überprüfen: Tabelle 2-7 Primer, die zur Überprüfung der Segregation verwendet wurden NT-SegCheck CT-SeqCheck NTPetPNdeI Name Sequenz Verwendung SeqCheck Del cydab for SeqCheck Del cydab rev GAATCACCTCATAGCGATCGCC ATTGTC ATTGACCCAGCTCAGTTGCTGT GGAATTCCATATGGACGTGGGG CAAAAAGTGCGCG GCTGTGGCTGAAAACCAAGA GCCATCCAGCAGAATGTAGA Die Primer NT-SegCheck und CT- SeqCheck wurden zur Segregationsprüfung der petp-mutante verwendet Die Primer NTPetPNdeI und CT- SeqCheck wurden verwendet, um die Segregation der petp-his- Mutante zu überprüfen Die Primer SeqCheck Del cydab for und SeqCheck Del cydab rev zur Segregationsprüfung der cydab - Mutante verwendet SC_tll_for_neu GCCACCAGAGATCTACCTCTTC Die Primer SC_tll_for_neu und SC_tll_rev_neu AGGCCATTACCTCCATAGCAAG SC_tll_rev_neu wurden verwendet, um die Segregation der tll2230- Mutante zu überprüfen SeqCheck Del nifs for AGATGAACGGCATCCTGCGAGA Die Primer SeqCheck Del nifs for und SeqCheck Del nifs rev wurden SeqCheck Del nifs rev CGCAGAATCGTCCACAGCAGAA verwendet, um die Segregation der nifs-mutante zu überprüfen SeqCheck cytm for CCTAGCCACAGTTCGCCTCTTG Die Primer SeqCheck cytm for und SeqCheck cytm rev CCGGTTGCTGGCCTAGAATCAC SeqCheck cytm rev wurden verwendet, um die Segregation der cytm-mutante zu überprüfen

53 Material und Methoden RNA-Isolierung aus Thermosynechococcus elongatus Für die RNA Isolierung aus T. elongatus wurde das Qiagen Mini RNeasy Kit verwendet. Zunächst wurde eine T. elongatus Kultur bis zu einer Zelldichte OD 750 = 2 angezogen und 10 ml dieser Kultur bei 4 C sedimentiert (4800 rpm, 10 Minuten). Das Sediment wurde in 200 µl TE Puffer resuspendiert dann und mit 400 µl RNAprotect TM Bacteria Reagent gemischt. Dieser Ansatz wurde für mindestens 5 Minuten auf Eis inkubiert und dann zentrifugiert (1 Minute, rpm, bei 4 C). Das Sediment wurde zweimal mit 1 ml TE Puffer gewaschen. Nach erneuter Zentrifugation werden die sedimentierten Zellen in 1 ml 5 M Natriumiodat-Lösung resuspendiert. Die Probe wird für mindestens 20 Sekunden gevortext und dann erneut zentrifugiert. Es folgt ein weiterer Waschschritt mit 1 ml TE-Puffer. Nun werden die Zellen in 350µl RLT Puffer aufgenommen und mittels Glasperlen im Bead Beater aufgeschlossen. Dies geschieht in zwei Zyklen à 20 Sekunden. Zwischen den zwei Aufschluss-Schritten sollte der Ansatz auf Eis gekühlt werden. Nach dem Aufschluss wird der Ansatz für 2 Minuten bei rpm zentrifugiert, der Überstand in ein neues Reaktionsgefäß überführt und mit 250 µl Ethanol versehen. Die weitere Isolierung erfolgt entsprechend des Manuals des Qiagen RNEasy Mini Kits DNase-Verdau der isolierten RNA Nach der Isolierung der RNA erfolgt ein DNAse Verdau mit der Turbo-free DNase der Firma Ambion. Dazu wurde die isolierte RNA mit 1,5 µl DNase und 1/10 Volumen 10 x Puffer versetzt und für 30 Minuten bei 37 C inkubiert. Zur Inaktivierung des Enzyms wurde dann 1/10 Volumen des Inaktivierungsreagenzes zum Ansatz gegeben und dieser für 2 Minuten gevortext. Abschließend wurde der Ansatz erneut zentrifugiert und dann der Überstand in ein neues Reaktionsgefäß überführt Reverse Transkription Für die reverse Transkription wurde 1 µg der isolierten RNA verwendet, dabei wurde für die cdna Synthese das Qiagen QuantiTect Reverse Transcription Kit entsprechend der Vorschrift des Herstellers verwendet. Dabei wurden folgende Modifizierungen gemacht. Nach dem gdna wipeout -Schritt wurden 3 µl des Ansatzes entnommen und 1:10 mit RNase- und DNase-freiem Wasser verdünnt.

54 Material und Methoden 46 Dieser zweite Ansatz diente als Kontrolle bei späteren Real Time PCR Analysen (siehe ). Die verbleibenden 5 µl des Ansatzes werden mit Transkriptions- Master-Mix versehen. Mit diesem Ansatz werden dann die weiteren Schritte der cdna-synthese vollzogen. Nach Beendigung des Temperatur-Programms der cdna Synthese und Hitzeinaktivierung der Polymerase wird der cdna-ansatz 1:10 mit Wasser verdünnt. 10 µl des verdünnten Ansatzes werden als Template für Real Time PCR Analysen verwendet Quantitative Real time PCR Analysen Für die quantitative Real time PCR wurde das KAPA qpcr Kit der Firma peqlab verwendet. Der KAPA qpcr Master Mix enthält SYBR Green als Fluoreszenz- Farbstoff. Das Kit wurde entsprechend der Vorschrift des Herstellers verwendet. Der jeweilige Reaktionsansatz, dessen Volumen 22 µl betrug, setzte sich dabei aus 10 µl cdna, 11 µl KAPA qpcr Master Mix und 1 µl der entsprechenden Primerpaare zusammen. Es wurden folgende Primer für die quantitative Real time PCR verwendet: Tabelle 2-8 Primer, die für quantitative RT PCR verwendet wurden Name Sequenz Telo rnpb RT for GGTGCAACGGTGCGGTAAGAG Telo rnpb RT rev CAAGTGCCTCTAGCGGCTCTG Telo cydb RT for GCGCCGCAATATCCTCATGAC Telo cydb RT rev ATTGTGGCGGTGCGATAGTGG Telo cyda RT for CCAACTCATGGCTCCAGACTC Telo cyda RT rev ACCAATGGCCACCATCAGTCG Für jedes Primerpaar erfolgte eine Dreifachbestimmung pro Ansatz. Außerdem wurden für jedes Primerpaar Kontrollen mit H 2 0, genomischer DNA und RNA durchgeführt. Folgendes Temperatur-Programm wurde für die qrt-pcr Reaktion verwendet:

55 Material und Methoden 47 Schritt Reaktion Temperatur Dauer A Denaturierung; 95 C 10 Minuten Aktivierung der Polymerase B Denaturierung 95 C 15 Sekunden B Anlagerung und Elongation 62 C 45 Sekunden 40Zyklen B Reduktion unspezifischer Produkte 85 C 15 Sekunden Bestimmung der SYBR Green I Fluoreszenz C Pause 15 C Schritt A führt zur Denaturierung der Ansätze und der Aktivierung der Kapa Hot Start Taq Polymerase. Schritt B, der 40mal wiederholt wird, beinhaltet die Denaturierung des Ansatzes, die Anlagerung der Primer und die Elongation bei 62 C sowie einen Hitzeschritt bei 85 C, der dazu dient unspezifische Produkte vor der Amplikon Detektierung aufzuschmelzen. Am Ende von Schritt B wird jeweils die SYBR Green I Fluoreszenz bestimmt. Am Ende erfolgt Schritt C und damit das Ende der Reaktion. Zuvor wird noch eine Schmelzkurve der Reaktionsprodukte aufgezeichnet Transkript Quantifizierung Die Quantifizierung der Transkriptmenge erfolgte nach der durch Pfaffl (Pfaffl, 2001) etablierten Methode. Dabei werden die verschiedenen Effizienzen (E) der verschiedenen PCR Reaktionen, die für verschiedene Templates und Primer variieren, und die C(t) Werte der einzelnen PCR Reaktionen berücksichtigt. Für die Berechnung der Effizienz der PCR Reaktionen wurde das Programm LinReg verwendet Verwendete Plasmide Die in der Arbeit verwendeten und konstruierten Plasmide wurden zur Klonierung, Überexpression in E. coli oder als Trägerplasmid zur Transformation von Cyanobakterien verwendet.

56 Material und Methoden 48 Tabelle 2-9 Plasmide, die im Rahmen dieser Arbeit konstruiert und verwendet wurden Plasmid Eigenschaften/ Verwendung Referenz pbluescript II KS(+) Trägerplasmid für Transformation Sambrook et al., 1989 von Cyanobakterien; Ampicillin-Resistenz pbsl14/ pbsl15 Kanamycin-Resistenzkassette, die im Rahmen dieser Alexeyev, M.F., 1995 Arbeit zur Klonierung verwendet wurde pks Cm1 Cm R, pks+ mit CmR-Kassette in EcoRV-site in Richtung KpnI SacI Seidler, A., persönliche Mitteilung pks CmR2 Cm R, pks+ mit CmR-Kassette in EcoRV-site in Richtung SacI KpnI pask-iba33 Amp R, Tetracyclin-Promotor (teta) regulierte IBA BioTAGnology Expression, His-tag am C-Terminus der MCS pask-iba35 Amp R, Tetracyclin-Promotor (teta) regulierte IBA BioTAGnology Expression, His-tag am N-Terminus der MCS paskiba3 Amp R, C-terminalen Strep-tag IBA BioTAGnology pask-iba45 Amp R, Tetracyclin-Promotor (teta) regulierte IBA BioTAGnology Expression, C-terminaler His-tag N-terminaler Strep-tag pask-iba43 Amp R, Tetracyclin-Promotor (teta) regulierte IBA BioTAGnology Expression, N-terminaler His-tag C-terminaler Strep-tag pgem(r)-t easy Klonierungsplasmid; Ampicillin-Resistenz Promega pks Km petp Herstellung einer petp-deletionsmutante in T.elongatus diese Arbeit pask-iba3 cydab Plasmid zur heterologen Expression der Cyt bd diese Arbeit Oxidase in E. coli pask-iba33 cydab Plasmid zur heterologen Expression der Cyt bd diese Arbeit Oxidase in E. coli pask-iba43 cydab Plasmid zur heterologen Expression der Cyt bd diese Arbeit Oxidase in E. coli pask-iba45 cydab Plasmid zur heterologen Expression der Cyt bd diese Arbeit Oxidase in E. coli pask-iba35 petp heterologe PetP-Überexpression in E. coli diese Arbeit pks Km cytm Herstellung einer cytm-deletionsmutante in T. elongatus diese Arbeit pks Km nifs pks Km tll2230 Herstellung einer nifs-deletionsmutante in T. elongatus Herstellung einer tll2230-deletionsmutante in T. elongatus diese Arbeit diese Arbeit pks comp cydab Komplementierung der T. elongatus cydab - Mutante diese Arbeit pks comp cydab prom Ni Komplementierung der T. elongatus cydab - Mutante; diese Arbeit cydab unterliegen der Kontrolle des nrs-promotors aus Synechocystis pks comp cydab prom petc Komplementierung der T. elongatus cydab - Mutante; diese Arbeit cydab unterliegen der Kontrolle des petc-promotors aus T. elongatus pgem cyda Herstellung einer T. elongatus cyda Mutante diese Arbeit

57 Material und Methoden Proteinbiochemische Methoden Präparation von Thylakoidmembranen aus T. elongatus Zur Gewinnung von Membranen für die Präparation von Proteinen aus T. elongatus wurden Kulturen unterschiedlicher Größe (300 ml bis hin zu 20 l) angezogen und die Zellen durch Zentrifugation sedimentiert (15 Minuten, 7000 rpm). Die sedimentierten Membranen wurden in 150 ml Puffer A (20 mm MES-NaOH ph 6,5; 10 mm CaCl 2 ; 10 mm MgCl 2 ) resuspendiert. Die resuspendierten Zellen wurden dann für 90 Minuten mit 0,2 % Lysozym im abgedunkelten Schüttler bei 37 C inkubiert. Danach wurde die Zellsuspension mit der Frech Press bei 640 psi aufgeschlossen. Die aufgebrochenen Zellen wurden bei rpm für 15 Minuten zentrifugiert. Die sedimentierten Membranen wurden in 200 ml Puffer A resuspendiert, erneut zentrifugiert und danach mit Puffer B (Puffer A + 0,5 M Mannitol) gewaschen. Abschließend wurden die Membranen möglichst konzentriert in Puffer D aufgenommen und in Aliquots à 5 mg Chlorophyll in flüssigem Stickstoff eingefroren. Die aliquotierten Membranen wurden bei -70 C aufbewahrt Reinigung von heterolog exprimiertem PetP mittels Gravitationchromatographie Zur Vorbereitung wird das Säulenmaterial (5 ml His-select Nickel affinity gel der Firma Sigma) in eine MoBiTec-Leersäule gepackt, mehrfach mit H 2 O gespült und dann mit Solubilisierungspuffer (0.1 % β-dm, 500 mm NaCl, 25 mm Hepes ph 8.0, 5 mm Imidazol, 1 mm PMSF, 1 mm TLCK) äquilibriert. Für die Reinigung von PetP werden Thylakoidmembranen mit einer Menge von 5 mg Chlorophyll auf Eis aufgetaut. Zur Extraktion der Proteine werden die aufgetauten Membranen zunächst mit Solubilisierungspuffer auf einen Chlorophyllgehalt von mg/ml eingestellt und für 20 Minuten bei 5 rpm auf dem Rotamix Schüttler inkubiert. Dann werden die nicht solubilisierten Membranbestandteile durch einen Ultrazentrifugationsschritt sedimentiert (70I.Ti Rotor, 60 Minuten, rpm). Der erhaltene Überstand wird langsam auf die Säule gegeben (niedrige Tropfgeschwindigkeit). Nachdem der Extrakt über die Säule gelaufen ist, wird diese in 6 Waschschritten mit jeweils 50 ml Waschpuffer (Solubilisierungspuffer mit 0,05% β-dm + 5, 10, 15, 20, 25, 35mM Imidazol) gewaschen. Dann wird das Protein mit 1 ml Elutionspuffer (150 mm

58 Material und Methoden 50 NaCl, 25 mm Hepes ph 7.0, 200 mm Imidazol, 1 mm PMSF, 1 mm TLCK) eluiert, dabei wird der Elutionspuffer mehrfach auf die Säule gegeben Präparationen von Membranen aus E. coli Die Zellen der E. coli-überexpressionskultur (siehe und ) werden nach der entsprechenden Expressionsdauer durch Zentrifugation (15 Minuten bei 7000 rpm) sedimentiert. Die sedimentierten Zellen werden dreimal mit Puffer W (0,1 M Tris ph 8.0/ 1mM EDTA/ 0.15 M NaCl/ 1 mm PMSF, TLCK) gewaschen. Nach dem letzten Waschschritt werden die Zellen in Solubilisierungspuffer (0.1% β-dm; 500 mm NaCl; 25 mm Hepes ph 8.0; 5 mm Imidazol; 1 mm PMSF, 1 mm TLCK) resuspendiert und die Zellen mit der French Press bei 640 psi aufgeschlossen. Die Probe wird zunächst 10 Minuten bei rpm zentrifugiert, um Zelltrümmer zu sedimentieren. Danach erfolgt durch einen Zentrifugationsschritt in der Beckmann- Ultrazentrifuge (1h bei 40000rpm, Ti70 Rotor) die Trennung von löslichen und Membranproteinen. Die Membranen werden über Nacht im Kühlraum auf Eis inkubiert Aufreinigung des überexprimiertem PetP-Proteins mittels FPLC Zur Vorbereitung wird das Säulenmaterial (5 ml His-select Nickel affinity gel der Firma Sigma) mehrfach mit H 2 O gespült und dann mit Solubilisierungspuffer (0.1 % β-dm, 500 mm NaCl, 25 mm Hepes ph 8.0, 5 mm Imidazol, 1 mm PMSF, 1 mm TLCK) äquilibriert. Zur Extraktion der Proteine werden die präparierten Membranen (siehe 2.4.3) zunächst in Solubilisierungspuffer resuspendiert, auf eine Proteinkonzentration von 2 mg/ml eingestellt und für 30 Minuten bei 5 rpm auf dem Rotamix inkubiert. Dann werden die nicht solubilisierten Membranbestandteile durch einen Ultrazentrifugationsschritt sedimentiert (70Ti Rotor, 60 Minuten, rpm). Der erhaltene Überstand wird langsam auf die Säule gegeben (niedrige Tropfgeschwindigkeit). Danach wird die Säule in die Chromatographieanlage eingehängt und mit Waschpuffer mit 1, 2, 3, 4, 5 mm Histidin jeweils so lange gewaschen, bis sich kein Protein mehr von der Säule löste (manuelle Einstellung, 1 ml/min Flussrate). Das Protein wurde mittels eines programmierten Histidin-Gradienten (Flussrate = 1 ml/ min) von der Säule eluiert. Die maximale Histidin-Konzentration lag bei 100 mm. Das eluierte Protein wurde in 2 ml-fraktionen gesammelt.

59 Material und Methoden Reinigung der heterolog exprimierten Cyt bd Oxidase Zur Vorbereitung wird das Säulenmaterial (5ml His-select Nickel affinity gel der Firma Sigma) mehrfach mit H 2 O gespült und dann mit Solubilisierungspuffer (0.2 % β-dm, 500 mm NaCl, 50 mm Natrium-Phosphat-Puffer ph 8.0, 5 mm Imidazol, 1 mm PMSF, 1 mm TLCK) äquilibriert. Zur Extraktion der membranintegralen Proteine werden die präparierten Membranen zunächst in Solubilisierungspuffer resuspendiert und für 30 Minuten bei 5 rpm auf dem Rotamix inkubiert. Dann erfolgt ein Zentrifugationsschritt mit der Beckmann Ultrazentrifuge (70Ti Rotor, 60 Minuten, rpm). Der erhaltene Überstand wird langsam auf die Säule gegeben. Danach wird die Säule mit Waschpuffer (0.05 % β-dm, 500 mm NaCl, 50 mm Natrium-Phosphat-Puffer ph 8.0, 5 mm Imidazol, 1 mm PMSF, 1 mm TLCK) gewaschen, bis sich kein Protein mehr von der Säule löst. Das Protein wurde mit 2 ml Elutionspuffer (250 mm Imidazol; 50 mm Sodium Phosphate, ph 7.0; 150 mm NaCl; Proteaseinhibitoren) von der Säule eluiert, dabei wurde der Puffer mehrfach auf die Säule geladen Reinigung von Antikörpern Die Reinigung der Antikörper erfolgte mit Epox aktiverten beads der Firma Amersham (entsprechend der Herstellerinformationen). Die Peptide wurden in 0,1 M Bicarbonat ph 8.5 an das Material zur Affinitätsreinigung gebunden, die verbliebenen freien Bindestellen werden mit 1 M Glycin blockiert. Die Bindung der Antikörper erfolgt bei ph 7. Nach der Bindung der Antikörper wird das Material zur Affinitätsreinigung mit PBS gewaschen. Die Elution der Antikörper erfolgt in 0,1 M Glycin ph 2.5; dabei werden die Antikörper in 1 M Tris ph 8.5 aufgefangen und der ph-wert sofort auf ph mit 0,1 M NaOH eingestellt.

60 Material und Methoden Nachweis von Proteinen SDS-PAGE (nach Laemmli, 1970) Trenngelpuffer 2 M Tris; 0,4 % (w/v) SDS, ph 8.8 Sammelgelpuffer 1 M Tris; 0,4 % (w/v) SDS, ph x Laufpuffer 0,5 M Tris; 1,92 M Glycin; 1 % (w/v) SDS Ammoniumperoxodisulfat-Stammlösung APS 10 % (w/v) SDS-Probenpuffer 10 % (w/v) Glycerin 5 % (v/v) β-mercaptoethanol 3,1 % (w/v) SDS 6,2 mm Tris ph 8,0 0,01 % (w/v) Bromphenolblau Harnstoffhaltiger SDS-Probenpuffer für Membranproteine (2x Puffer) 0,125 M Tris-HCl; ph M Harnstoff 4 % SDS 20 % Glycerol 0,01 % (w/v) Bromphenolblau (BPB) 3-5 % β-mercaptoethanol Tabelle 2-10 Pipettierschema für die Herstellung von SDS-Gelen nach Laemmli Trenngel 12,5 % 13,5 % 15 % 17,5 % Sammelgel +/-5 % A/BisA 4,2 ml 4,5 ml 5 ml 5,8 ml 1,0 ml 1 M Tris/SDS 3,8 ml 3,8 ml 3,8 ml 3,8 ml 0,75 ml H 2 O 2,0 ml 1,6 ml 1,1 ml 0,3 ml 4,2 ml 10 % APS 40 µl 40 µl 40 µl 40 µl 20 µl TEMED 8 µl 8 µl 8 µl 8 µl 8 µl Die Zusammensetzung von Proteingemischen wurde mit Hilfe der SDS-PAGE nach (Laemmli, 1970) analysiert. Die Elektrophorese wurde in einer Protean 3 Kammer der Firma Biorad bei 200 V nach Angaben des Herstellers durchgeführt Blotten von Polyacrylamidgelen Zur Durchführung von Western-Blot Analysen wurden Proteine aus Polyacrylamidgelen auf eine PVDF-Membran transferiert. Zu diesem Zweck wurde eine SemiDry Blotapparatur der Firma Biometra verwendet. Die Membran wurde in Methanol gewaschen und das Whatman-Papier in Transferpuffer (20 mm CAPSO, ph 9.8, 20

61 Material und Methoden 53 % (v/v) Methanol) inkubiert. Der Transfer erfolgte für 1-2 h bei einer Stromstärke von 1,5 ma/cm Färben von Blotmembranen mit Ponceau S Durch die reversible Färbung der PVDF-Membran mit Ponceau S (0,5 % (w/v) in 1 % Essigsäure) konnte die Effizienz des Proteintransfers auf die Membran überprüft werden. Durch wiederholtes Waschen der Membran mit A. bidest konnte die Färbung rückgängig gemacht werden Western-Blot mit proteinspezifischen Antikörper Transferpuffer 20 mm CAPSO ph % (v/v) Methanol TBST 10 mm Tris ph mm NaCl 0,05 % (v/v) Tween 20 Blockpuffer TBST mit 3 % Perfect Blot (MoBiTec) oder mit 3 % BSA AP-Puffer 100 mm Tris ph mm NaCl 5 mm MgCl 2 Im Anschluss an die Elektrophorese konnte ein spezifischer Proteinnachweis mittels Western-Blot-Analyse erfolgen. Dabei wurden die im Proteingel elektrophoretisch aufgetrennten Proteine im elektrischen Feld quantitativ und irreversibel auf eine PVDF-Membran transferiert. Durch Inkubation mit spezifischen Antikörpern konnten anschließend einzelne immobilisierte Proteinbanden nachgewiesen werden. Um unspezifische Proteinbindungen zu verhindert, wurde die geblottete Membran für 1-2 Stunden im Blockpuffer bei Raumtemperatur geblockt. Dabei wurden freie Bereiche der Membran abgesättigt. Nach zweimaligem Waschen mit TBST + 0,2 % Triton X-100 und einmaligem Waschen mit TBST (jeweils für 10 min) wurde die Membran mit einer optimierten Verdünnung des primären Antikörpers in TBST + 3 % BSA für 2 h inkubiert. Nach erneutem Waschen mit TBST + 0,2 % (v/v) Triton und TBST wurde mit dem sekundären Antikörper ( Goat anti rabbit oder goat anti mouse, gekoppelt mit alkalischer Phosphatase) in TBST + 3 % BSA für 2 h inkubiert. Anschließend wurde die Membran 4 x für 10 min mit TBST + 0,2 % Triton gewaschen und für 15 min mit AP-Puffer inkubiert. Schließlich erfolgte die

62 Material und Methoden 54 Färbung mit 0,0125 % (w/v) NBT und BCIP in AP-Puffer, bis die optimale Signalintensität erreicht war Verwendete Antikörper Im Rahmen dieser Arbeit wurden folgende Antikörper verwendet: Tabelle 2-11 Auflistung der verwendeten Antikörper Antikörper Organismus Quelle Verdünnung anti-ue IV anti-cyt f anti-cyt b 6 anti-rieske Monoclonal anti Polyhistidine anti mouse IgG- Alkaline Phosphatase Conjugate anti rabbit IgG- Alkaline Phosphatase Conjugate anti-petp anti-cyda anti-cydb Streptavidin alcaline-ap Kaninchen (rabbit) Kaninchen (rabbit) Kaninchen (rabbit) Kaninchen (rabbit) Maus (mouse) Ziege (goat) Ziege (goat) Kaninchen (rabbit) Kaninchen (rabbit) Kaninchen (rabbit) Prof. Dr. R. Berzborn, Bochum 1 : 2500 Prof. Dr. R. Berzborn, 1 : 800 Bochum Prof. Dr. R. Berzborn, 1 : 2000 Bochum Prof. Dr. R. Berzborn, 1 : 2500 Bochum Sigma 1 : : 3000 Sigma 1 : Sigma 1 : Davids Biotechnology 1 : 750 1: 1000 Davids Biotechnology 1 : 750 1: 1000 Davids Biotechnology 1 : 500 GE Healthcare Proteinfällung mit Trichloressigsäure (TCA) Wenn Proteinlösungen zu stark verdünnt waren, um sie detektieren zu können, so wurden sie vor der Gelelektrophorese (entsprechend der Methode nach Peterson, 1979) mit TCA gefällt. Dazu wurden der Proteinlösung ¼ Volumen 100 %ige (w/v) TCA-Lösung hinzugefügt, kurz vermischt und der Ansatz für 30 min auf Eis inkubiert. Die Lösung wurde für 5 min bei rpm zentrifugiert und der Überstand vorsichtig entfernt. Das Proteinsediment wurde in Probenpuffer resuspendiert, welcher zur Neutralisation eventuell vorhandener Säurereste mit 0,1 M NaOH versetzt war.

63 Material und Methoden Proteinbestimmung Die Konzentrationsbestimmung von Proteinlösungen erfolgte entweder mit Hilfe eines BCA Protein Tests (Smith et al., 1985) der Firma Pierce oder der Methode nach (Warburg et al., 1941). Der BCA-Test basiert auf der Reduktion von Cu 2+ zu Cu + durch Proteine unter alkalischen Bedingungen (Biuret Reaktion). Cu + bildet mit Bichinoninsäure (BCA) einen violetten Farbkomplex. Nach der Warburg-Methode wird die optische Dichte der zu bestimmenden Protein- Lösung bei 280 nm und 260 nm bestimmt und in folgende Relation gesetzt: (1,55 A 280 ) (0,76 A 260 ) = Proteinkonzentration [mg/ml] 2.5 Biophysikalische Methoden UV/Vis-Spektroskopie Absorptionsspektren im Bereich von nm wurden an einem BECKMAN DU 7400 Spektrometer aufgenommen Absorptionsspektren ganzer Zellen Die Absporptionsspektren der ganzen Zellen im Bereich von nm wurden mit Hilfe eines Dioden Matix Photometer, das von dem Institut für Biophysik der Johann Wolfgang Goethe-Universität in Frankfurt am Main hergestellt wurde, aufgenommen. Die OD 750 der zu messenden Kultur wurde mit 70 %iger Saccharose auf 0,2 eingestellt. Die Saccharose-Endkonzentration lag somit bei %. Das Probenvolumen betrug 1,5 ml. Die Proben wurden für die Aufnahme des jeweiligen Absorptionsspektrums in spezielle UV-Plastikküvetten gefüllt Bestimmung der Chlorophyllkonzentration Cyanobakterien besitzen im Gegensatz zu den höheren Pflanzen nur Chlorophyll a. Die Chlorophyllbestimmung erfolgte photometrisch nach der Methode von (Porra et al., 1989). Für die Chlorophyllbestimmung von ganzen Zellen wurde 1 ml Kultur sedimentiert, das Sediment in 1 ml Methanol resuspendiert, gevortext und bei maximaler Geschwindigkeit zentrifugiert. Der Überstand wurde für die

64 Material und Methoden 56 photometrische Bestimmung verwendet oder vorher 1:4 mit Methanol verdünnt. Zur Konzentrationsbestimmung an Thylakoidmembranen wurden 5 µl Membranen zu 495 µl Methanol pipettiert, gevortext und wie beschrieben verfahren. Die in der Probe enthaltene Chlorophyllkonzentration berechnet sich nach folgender Formel: [Chl a] = 16,29 (OD 665,2 OD 750 ) 8,54 (OD OD 750 ) = [µg/ml] K-Fluoreszenzemissionsspektroskopie Fluoreszenzemissionsspektroskopie wurde an einem Lumineszenz-Spektrometer Aminco-Bowman Series 2 der Firma SLM Spectronic durchgeführt. Die Phycobilisomen wurden bei 580 nm angeregt. Emissionsspektren wurden von 630 nm bis 750 nm aufgenommen. Die Monochromatoren waren auf eine Bandbreite von 4 nm eingestellt. Anhand der Fluoreszenzemissions-Spektren bei 77K konnte das relative Verhältnis von Photosystem 1 und 2 sowie der Phycobilisomen bestimmt werden. Zunächst wurde eine T. elongatus-kultur bis zu einer OD 750 = 1 angezogen und mit Medium auf 5 µm Chlorophyll eingestellt. Es wurden zwei verschiedene Ansätze vorbereitet, indem jeweils 0,5 ml Suspension in Borosilitglas-Röhrchen gefüllt wurden. Für lichtinduzierte state transition wurden zunächst alle Proben für 30 Minuten im Dunkeln bei 45 C inkubiert, um state 2 einzustellen. Danach wurde eine Probe zunächst 10 Sekunden in Eis inkubiert und dann in flüssigem Stickstoff eingefroren. Die anderen Proben wurden zunächst für 20 Minuten mit Weißlicht mit einer Intensität von 200 µem-²s -1 belichtet (Inkubation bei 45 C). Zur Messung wurden die Proben in einem Quarzglas-Dewar mit flüssigem Stickstoff in den Strahlengang des Spektrometers gebracht. Die Emissionsspektren wurden aus Messungen gemittelt, um die Grundfluoreszenz reduziert, dann auf 650 nm bei Phycobilisomenanregung normiert P700 Messungen Die P700 Reduktionsmessungen wurden mit dem Gerät DUAL- PAM-100 P700 & Chlorophyll Fluorescence Measuring System der Firma Heinz Walz GmbH durchgeführt. PAM steht dabei für die Abkürzung Puls-Amplituden-Modulations- Fluorometer. Bei der P700 Re-Reduktionsmessung sind zwei gegenüber geschaltete Red Array Lampen für die Lichtgabe und die Anregung der Fluoreszenz verantwortlich, wie in Abbildung 2-2 zu sehen ist. Zunächst wird die

65 Material und Methoden 57 Grundfluoreszenz durch das Messlicht angeregt (F 0 ) und dann durch die Gabe eines Starklichtimpulses mit einer Lichtintensität von 3000 µmol/s -1 m -1 die maximale Fluoreszenz (F m ) induziert. Die variable Fluoreszenz F V ergibt sich aus den Fluoreszenzparametern F 0 und F m. Das Verhältnis dieser beiden Parameter zueinander (F 0 / F m ) dokumentiert die photosynthetische Aktivität. Abbildung 2-2 Messapperatur der DUAL-PAM Fluoreszenzinduktion Mit der Methode der Fluoreszenzinduktion konnte variable Chlorophyll a- Fluoreszenz von PS2 gemessen werden. Durch diese Messung, die ebenfalls mit dem Gerät DUAL-PAM-100 der Firma Walz durchgeführt wurden, kann indirekt auf den Redox-Zustand des PQ-Pools geschlossen werden. Bei Messungen mit T. elongatus wurde die Versuchsapparatur auf 45 C temperiert. Die für die Messung verwendeten Kulturen befanden sich in der logarithmischen Wuchsphase. Vor der Messung wurden die Kulturen auf eine Chlorophyllkonzentration von 10 µg/ml eingestellt. Für jede Messung wurden 2 ml Kultur verwendet, die in eine 1 x 1 cm große Quarzküvette gegeben wurden. Zunächst erfolgte eine 2 minütige Dunkelinkubation der Probe (unter Rühren), dann wurden die Probe für 1-4 Sekunden mit Blaulicht ( nm) mit einer Lichtintensität von 200 µmol m -2 s -1 belichtet. Die Fluoreszenz bei 686 nm wurde durch einen Photomultiplier detektiert. Durch den Einsatz verschiedener Inhibitoren konnten Erkenntnisse über den Redox-Zustand des PQ-Pools gewonnen werden.

66 Material und Methoden Cytochrom f Absorptions Kinetik Die Messung Cytochrom f Redox Kinetik erfolgte in Zusammenarbeit mit Helmut Kirchhoff (Institut für Botanik der Universität Münster). Bei dem Photometer, das für diese Messungen verwendet wurde, handelt es sich um einen Eigenbau (beschrieben in der Veröffentlichung Kirchhoff et al., 2000). Für die Messungen wurden die Zellen, die sich in der logarithmischen Wuchsphase befanden, auf eine Chlorophyll-Konzentration von 12,5 µg/ ml eingestellt. Die Kinetiken wurden durch kontinuierliche Lichtblitze, die in einem Abstand von 50 ms erfolgten, induziert (655 nm, LED cone; Walz GmbH, Effeltrich, Germany) und die Absorption bei 551, 556 und 561nm gemessen (Schneider et al., 2001). Die Cytochrom f Kinetik wird dabei aus der Absorptionsänderung der unterschiedlichen Wellenlängen berechnet (Kinetik bei 556nm minus der Absorptionsänderung der Kinetik bei 551 und 561nm). Es wurden die Kinetiken von jeweils vier unabhängigen Proben bestimmt. Dabei wurde jede Probe 32mal (in einer Wiederholungssequenz, 1Hz) gemessen Polarographische Messungen Die polarographischen Messungen wurden an einem fiber-optic -Oxygenmeter der Firma PreSens gemacht. Für die Messung von Sauerstoffentwicklung und verbrauch, wurden Flüssigkulturen unter Begasung mit 5 % CO 2 und Belichtung mit 20 µe/m²s Weißlicht kultiviert. Es wurde 1 ml Zellsuspension eingesetzt, deren Chlorophyllgehalt auf 15 µg/ ml eingestellt worden ist. Von drei unabhängigen Kulturen wurden je 3 Messungen vorgenommen und gemittelt. Der für die Messung verwendete Sauerstoff-Sensor wurde zunächst mit Sauerstoffgesättigtem und danach mit Natriumdithionidgesättigtem Wasser geeicht. Für die Messung wurde 1 ml Kultur, 10 µl DCBQ und 10 µl 5mM Natriumbikarbonat in die Messelektrode gegeben. Der respiratorische Sauerstoffverbrauch wurde im Dunkeln gemessen; eine Sauerstoffentwicklung bei Belichtung mit 10 me/m²s aufgezeichnet. Die photosynthetische Sauerstoffentwicklung wurde als Differenz zwischen Sauerstoffentwicklung im Licht und -verbrauch im Dunkeln ermittelt. Verwendete Computerprogramme Im Rahmen dieser Arbeit wurden die folgenden Computerprogramme, Internetprogramme und Datenbanken genutzt:

67 Material und Methoden 59 Tabelle 2-12 Computerprogramme, die im Rahmen dieser Arbeit verwendet wurden Name Firma Verwendung Word 2003 Microsoft Textverarbeitung Exel Microsoft Erstellung von Diagrammen und Tabellen; Auswertung von Messdaten Clone Manager 5 Scientific and Educational Software Planung von Klonierungen, Verwaltung von DNA-Sequenzen Opticon Monitor 2.02 MJ Research, Inc Durchführung und Auswertung der qrt-pcr LinReg PCR Dr. J.M. Ruijter, Academic Medial Centre, Amsterdam Auswertung / Analyse der Real Time PCR Daten Origin 6.0 Microcal Software, Inc Auswertung von Messdaten Fibox Microsoft Aufzeichnung der Daten an der O 2 -Elektrode SLM-Aminco Microsoft Aufzeichnung der 77K-Fluoreszenzdaten DUAL-PAM Microsoft Aufzeichnung der Daten der DUAL-PAM 100 Corel Photopaint Corel Corporation Bildbearbeitung Corel Draw Corel Corporation Bildbearbeitung Adobe Photoshop Adobe Dokumentation von Blots und Gelen Mozilla Firefox Mozilla Internet-Recherche CyanoBase Sequenzinformation über T. elongatus BP-1 Entrez PubMed Literatur Recherche gov/pubmed/ Expasy Analyse von DNA- und Proteinsequenzen Acrobat Reader 8.0 Adobe Lesen und Erstellen von pdf-datein

68 Ergebnisse Ergebnisse 3.1 PetP potentielle Untereinheit des Cytochrom b 6 f-komplexes Erstmals wurde PetP, das Produkt des offenen Leserahmens ssr2998 aus Synechocystis PCC 6803, bei der Aufreinigung des Cytochrom b 6 f Komplexes aus Synechocystis gefunden (Wenk, Bochum, 2000) und durch MALDI-TOF-Analysen und N-terminales Ansequenzieren identifiziert. Thomas Volkmer konnte im Rahmen seiner Promotion (Bochum, 2004) zeigen, dass es sich bei dem coisolierten Protein um eine weitere, bislang unbekannte Untereinheit des Cyt b 6 f Komplexes handelt, die für die Funktion des Komplexes zwar nicht essentiell ist, jedoch eine regulatorische Funktion hat. Durch Deletionsexperimente in Synechocystis konnte gezeigt werden, dass der Verlust des 7.2-kDa Proteins die Funktionalität des Cyt b 6 f Komplexes beeinträchtigt und zum reduzierten Wachstum von Synechocystis führt. Dies äußert sich durch einen verlangsamten Elektronentransport am Cytochrom f und am Reaktionszentrum von PS1 sowie durch die Überreduktion des Plastochinon Pools (Volkmer et al., 2007). Weiterhin werden durch das Fehlen des PetP-Proteins die PS1/PS2 Stöchiometrie und die state transitions beeinträchtigt. Auch bei der Reinigung des Cytochrom b 6 f Komplexes aus Thermosynechococcus elongatus konnte PetP, das Produkt des offenen Leserahmens tsr0524 aus T. elongatus, coisoliert werden (M. Ambill, 2004; D. Gomolla, 2006). Die Produkte der Leserahmen ssr2998 aus Synechocystis und tsr0524 aus T. elongatus weisen hohe Homologien zueinander sowie zu hypothetischen Proteinen anderer Cyanobakterien auf. Um weitere Informationen über die mögliche Funktion der PetP-Untereinheit des Cyt-b 6 f-komplexes zu erhalten, sollte im Rahmen dieser Arbeit das PetP-Protein aus T. elongatus weiterführend untersucht werden.

69 Ergebnisse Isolierung des homolog exprimierten PetP-His aus T. elongatus Wenn man die Funktion eines hypothetischen Proteins untersuchen möchte, ist es zum einen sehr sinnvoll, den Leserahmen, der das unbekannte Protein codiert, zu mutieren und die daraus resultierenden Mutanten zu charakterisierten. Zum anderen lassen sich aufgrund der Struktur eines Proteins auch oft Rückschlüsse auf dessen Funktion ziehen. Um Struktur- und Funktionsanalysen eines bestimmten Proteins machen zu können, ist es notwendig, das zu untersuchende Protein zu isolieren und zu reinigen. Die Aufreinigung des Proteins kann beispielsweise über Affinitätschromatographie erfolgen. Dazu wird das zu untersuchende Protein mit einem zweiten Protein fusioniert. Dieses zusätzliche Protein interagiert während der Reinigung mit einem immobilisierten Liganden und ermöglicht so die Trennung des Proteins vom Gesamtzellprotein des Expressionsorganismus. Als Affinitätsmarker, der entweder N- oder C-terminal mit dem aufzureinigenden Protein verknüpft wird, können sowohl ganze Proteine (beispielsweise das GFP-Protein) als auch kurze Peptide, so genannte tags, verwendet werden. Abbildung 3-1 Konstrukt zur Erstellung einer T. elongatus petp-his Mutante (Gendrullis, Diplomarbeit, 2004) Um das PetP-Proteins aus T. elongatus isolieren und reinigen zu können, habe ich bereits im Rahmen meiner Diplomarbeit ein Konstrukt erstellt, welches eine Polyhistidin-codierenden Sequenz an das petp-gen des T. elongatus-genoms anhängt. Durch die Fusionierung des PetP-Proteins mit dem Polyhistidinpeptid (einem sogenannten His-tag) sollte die Reinigung des Proteins mittels Affinitätschromatographie ermöglicht werden. Über die Primer, die bei Amplifizierung von petp verwendet wurden, konnte durch die PCR eine His 10 -tag-codierende Sequenz c- terminal angehängt werden. Das fertige Konstrukt ppetp-his, dass in Abbildung 3-1 zu sehen ist, enthält neben der petp-his-sequenz und einer Chloramphenicol-

70 Ergebnisse 62 Resistenz, die als Selektionsmarker dient, noch die upstream- und downstream- Bereiche des petp-gens. Da T. elongatus leicht mittels Elektroporation transformiert werden kann, stellte sich die Transformation mit dem Plasmid ppetp-his als unproblematisch heraus. Wie in Abbildung 3-2 schematisch dargestellt ist, konnte die Integration des C-terminalen His-tags in das Genom des Cyanobakteriums mittels homologer Rekombination (noch während meiner Diplomarbeit) erfolgen. upstream petp downstream genomische DNA homologe Rekombination upstream petp His 10 Cm R -Kassette downstream Plasmid-DNA Abbildung 3-2 Prinzip der homologen Rekombination zwischen dem Konstrukt ppetp-his und der genomischen DNA von Thermosynechococcus elongatus. Die über Einzelkolonie selektierten Klone wuchsen bei einer maximalen Chloramphenicol Konzentration von 20 µg/ml und wurden mittels analytischer PCR auf ihren Segregationszustand überprüft. Abbildung 3-3 zeigt das Agarosegel der analytischen PCR. In Spur 1 des Gels wurde die Negativkontrolle der PCR, bei der keine Template-DNA zugegeben wurde, aufgetragen. In Spur 2 wurde das PCR- Fragment der genomischen Wildtyp-DNA in der Höhe von 500bp sichtbar. Spur 3 zeigt das PCR-Fragment der rekombinaten, genomischen DNA der T. elongatus- [PetP-His]-Mutante des Klons 5.1. Im Vergleich mit dem PCR-Fragment der ppetp- His-Vektor-DNA (aufgetragen in Spur 4), die als Positivkontrolle diente, wurde deutlich, dass die Mutante vollständig segregiert war, da kein Fragment amplifiziert wurde, das der Größe des Fragmentes der Wildtyp-DNA entspricht. Obwohl die Mutante (noch während meiner Diplomarbeit) vollständig segregierte, war eine Aufreinigung des PetP-Proteins mittels Affinitätschromatographie erfolglos, deshalb sollte im Rahmen dieser Arbeit die Reinigung des homologen, Hisgetaggten-Proteins etabliert werden.

71 Ergebnisse bp 501 bp 331 bp M1 λ/ecori/hindiii-marker M2 puc19/mspi-marker 1 Negativkontrolle 2 Wildtyp 3 T. elongatus-[petp-his]-mutante 4 Positivkontrolle Abbildung 3-3 Ergebnis der analytischen PCR zur Überprüfung des Segregationzustandes der T. elongatus [PetP-His]-Mutante (Gendrullis, Diplomarbeit, 2004) Optimierung der Reinigung des PetP-His-Proteins aus der Mutante T. elongatus-[petp-his] Klon 5.1 Die Isolierung des Proteins durch Nickel-Chelat-Affinitäts-Chromatographie wurde nicht unter Verwendung eines HPLC- oder FPLC-Systems sondern durch konventionelle Chromatographie durchgeführt. Die Ausgangsbedingungen, die ursprünglich (während meiner Diplomarbeit) bei der Aufreinigung verwendet wurden, sind in der folgenden Tabelle dargestellt: Tabelle 3-1 Ausgangsbedingungen, die bei der PetP-His-Aufreinigung verwendet wurden (Gendrullis, Diplomarbeit, 2004) Extraktion Waschschritt 1 und Waschschritt 2 Waschschritt 3 und Waschschritt 4 Elution, Schritt 1-4 Zusammensetzung des Puffers ph-wert Volumen Imidazol- Konzentration Die Extraktion der Membranen (20mg Chl) erfolgte mit 0,75 % β-dm für 30 Minuten; das Membran-Extrakt wurde für 1 Stunde bei rpm in der Ultrazentrifuge zentrifugiert 300 mm NaCl 50 mm Tris-HCl ph mm MgCl 2 10 mm CaCl 2 1 mm PMSF, TLCK 300 mm NaCl 50 mm Tris-HCl ph mm MgCl 2 10 mm CaCl 2 1mM PMSF, TLCK 100 mm NaCl 50 mm Tris-HCl ph 7 1mM PMSF, TLCK ph = 7.5 à 36 ml 0 mm Imidazol bzw. 5mM Imidazol ph = 7.0 à 25 ml 10 mm Imidazol bzw. 15mM Imidazol ph = 7.0 à 3 ml 50, 75, 100 und 150 mm Imidazol Es wurden im Rahmen dieser Arbeit verschiedene Matrices getestet, da die Reinigung des Proteins über die Matrix Chelating Sepharose Fast Flow der Firma Amersham Biosciences während meiner Diplomarbeit keinen Erfolg zeigte. Bei der Reinigung erwies sich das Chromatographie-Material His-select Nickel affinity gel der Firma Sigma als sehr viel versprechend. Bei dieser Matrix ist im Gegensatz zu

72 Ergebnisse 64 anderen Matrices die Metall-chelatierende Gruppe über eine nicht-geladene, hydrophile Linkerregion mit der Agarose verbunden, wodurch unspezifische Bindungen an das Säulenmaterial vermindert werden. Sowohl die eingesetzte Menge an Thylakoidmembranen als auch die verwendete Detergenzmenge erwiesen sich als kritische Punkte bei der Reinigung. Das PetP-Protein ist an die Thylakoidmembranen assoziiert ebenso wie die Phycobilisomen, die die Proteinaufreinigung im Allgemeinen erschweren. Bei gesteigerter Menge der eingesetzten Thylakoide wurde somit nicht nur der PetP- sondern auch der Phycobilisomenanteil auf der Säule erhöht, was einen negativen Effekt auf das Reinigungsergebnis hatte. Wenn bei der Extraktion der Membranen zuviel Detergenz eingesetzt wurde, solubilisierte nicht nur das PetP- Protein sondern ebenso hydrophobe Membranproteine, die die Aufreinigung ebenfalls negativ beinträchtigen. Durch empirische Versuche wurde die Menge der einzusetzenden Membranen auf 5 mg Chlorophyll und die verwendete Detergenzmenge auf 0,1% β-dm optimiert. Weiterhin hatte die Verkürzung der Extraktionszeit auf 20 Minuten einen positiven Effekt auf die Reinigung des Proteins, da durch die kürzere Inkubationszeit weniger Fremdproteine solubilisiert wurden. Außerdem konnte das verwendete Puffersystem durch Steigerung der Salzkonzentration und durch Änderung des ph Wertes optimiert werden, was zur Folge hatte, dass während der IMAC weniger Proteine unspezifisch an die Matrix gebunden wurden. isolierte Membranen der T. elongatus [PetP-His] Mutante (5mg) Extraktion der Membranen mit 0,1% β-dm für 20 Minuten Sedimentierung der nichtsolubilisierten Proteine Ultrazentrifuge, Rotor: 70I.Ti 42000rpm, 60 Minuten, 4 C Direkte Auftragung des Extraktes auf die Affinitätssäule manuelle Chromatographie verschiedene Waschschritte à 30ml (7,5 40 mm Imidazol) Elution des Protein mit 250mM Imidazol Abbildung 3-4 Schema der optimierten Reinigung des PetP-Proteins aus T. elongatus mit Hilfe eines His-tag-Systems

73 Ergebnisse 65 Tabelle 3-2 Empirisch ermittelte Zusammensetzungen und Volumina der verschiedenen Puffer, die bei der PetP-Aufreinigung verwendet wurden Zusammensetzung des Puffers ph-wert Volumen Imidazol-Konzentration Extraktion Die Extraktion der Membranen (5mg Chl) erfolgte mit 0,1 % β-dm für 20 Minuten; das Membran-Extrakt wurde für 1 Stunde bei rpm in der Ultrazentrifuge zentrifugiert Waschschritt 1-6 Elution 500 mm NaCl 25 mm Hepes, ph 8 0,05 % β-dm 1mM PMSF, TLCK 150 mm NaCl 50 mm Tris-HCl, ph 7 1mM PMSF, TLCK ph = 8 jeweils 30 ml 5, 10, 15, 20, 25, 35 mm Imidazol ph = 7 1 ml (mehrfach über die Säule gegeben) 250 mm Imidazol Zusätzlich wurde die Bindung des Proteins an das Säulenmaterial optimiert. Bislang wurde das Protein durch eine so genannte Batch -Inkubation (1 h, 8 C, Rotamix, 3 rpm) an das Säulenmaterial gebunden. Bei der optimierten Reinigung des Proteins, deren Ablauf schematisch in Abbildung 3-4 dargestellt ist, wurde das Protein über langsamen Gravitationsfluss an die Matrix gebunden. Zusätzlich enthielt der Waschpuffer 0,05 % β-dm, um das Abwaschen von unspezifisch gebundenen Membranproteinen zu erleichtern. Ferner wurde das Volumen des Elutionspuffers stark vermindert, um das eluierte Protein in konzentrierter Form zu gewinnen. Die optimierten Reinigungsbedingungen sind in der Tabelle 3-2 zusammengefasst. MW M S D E E E 54 kda kda kda kda --- A B C Abbildung 3-5 SDS-PAGE und Western Blot Analysen der PetP-Isolierung mittels IMAC. (A) SDS-PAGE nach Coomassie-Färbung, (B) Western Blot Analyse mittels anti-petp-antikörper, (C) Western Blot Analyse mittels anti-poly-histidin-antikörper; MW = Molekulargewichts Marker, M = Membranen, S = Solubilisat, D = Durchlauf, E = Elutionsfraktion

74 Ergebnisse 66 Durch die Optimierung der verschiedenen Reinigungsparameter konnte das PetP-His Protein erfolgreich aus T. elongatus isoliert werden. Der Erfolg der Reinigung wurde mittels SDS-PAGE und Western Blot Analysen dokumentiert. Die SDS-PAGE zeigt (wie in Abbildung 3-5 A zu sehen ist) nur eine einzige Proteinbande, die unterhalb der 10 kda Bande des Proteingrößenstandarts läuft. Durch Western Blot Analysen mit Hilfe eines anti-poly-histidin- sowie eines anti-petp-antikörpers (dargestellt in Abbildung 3-5 B und C) konnte gezeigt werden, dass es sich bei dem gereinigten Protein um das his-getaggte PetP-Protein handelt. Die Reinigung des PetP-Proteins aus T. elongatus mittels IMAC konnte somit erfolgreich etabliert werden. Jedoch konnten nur kleine Proteinmengen (bis zu 100 µg) gereinigt werden, die für Strukturund Funktionsanalysen nicht ausreichen.

75 Ergebnisse Reinigung des heterolog exprimierten PetP In vielen Fällen sind die Mengen eines spezifischen Proteins, die unter natürlichen Bedingungen von Zellen gebildet werden, zu gering, um Struktur- und Funktionsanalysen durchzuführen zu können. In diesen Fällen besteht die Möglichkeit, das entsprechende Protein verstärkt im exprimierenden Organismus anzureichern bzw. zu überexprimieren. Im Allgemeinen unterscheidet man zwischen homologer und heterologer Überexpression. Bei homologer Überexpression erfolgt die Expression des Proteins im Ursprungsorganismus. Die homologe Überexpression ist in vielen Fällen günstig, da optimale physiologische Bedingungen herrschen, alle benötigten Faktoren für die korrekte Lokalisierung und Faltung vorhanden sind und Enzyme, die für posttranslationale Modifikationen benötigt werden, zur Verfügung stehen. Bei der heterologen Überexpression findet die verstärkte Anreicherung des Proteins nicht im Ursprungsorganismus sondern in einem schnell replizierenden Wirtsorganismus wie z.b. E. coli statt. Bei der heterologen Überexpression kann das Problem auftreten, dass die starke Anreicherung eines artfremden Genproduktes sich toxisch auf die Wirtszelle auswirkt. Dabei kann es zu einem proteolytischen Abbau des Proteins oder auch zum Absterben des Wirtsorganismus kommen, was dazu führt, dass das gewünschte Protein nicht exprimiert werden kann. In diesem Fall kann manchmal durch streng regulierte Expression die Überexpression dennoch ermöglicht werden. Abbildung 3-6 Konstrukt zur heterologen Überexpression von PetP in E. coli (Gendrullis, Diplomarbeit, 2004) Da die unter natürlichen Bedingungen gebildete Menge des PetP-Proteins zu gering ist, um Struktur- und Funktionsanalysen durchführen zu können, wurde bereits im Rahmen meiner Diplomarbeit ein Konstrukt erzeugt, dass die Überexpression des PetP-Proteins in E. coli sowie die anschließende Reinigung mittels IMAC

76 Ergebnisse 68 ermöglichte (dargestellt in Abbildung 3-6). Bei der Klonierungsstrategie diente der Vektor pask-iba35, dessen Expressionskassette unter der Kontrolle der Promotor/Operator-Region des teta-resistenzgens liegt (IBA, 1997), als Ausgangskonstrukt. Der verwendete IBA-Vektor besitzt eine His-tag-codierende Sequenz, mit der eine beliebige Gensequenz fusioniert werden kann, was die Überexpression von Proteinen mit N-terminalem His 6 -tag ermöglicht. MW E 1 E 2 E 3 E 4 55,4 kda ,5 kda ,5 kda ,4 kda --- PetP-His A B Abbildung 3-7 Heterologe Überexpression und Reinigung von PetP. A SDS-PAGE der Überexpression (Coomassie-Färbung) B SDS-PAGE (Silberfärbung) des mittels IMAC gereinigten PetP. MW = Molekulargewichtsstandart, 1 = Negativkontrolle der Expression, 2 = nichtindzuierte Expressionskultur, 3 = induzierte Expressionskultur, E 1-4 = Elutionsfraktionen 1-4 der PetP- Reinigung mittels IMAC (Gendrullis, Diplomarbeit, 2004) Nach erfolgreicher Klonierung des Expressionsplasmides wurde (während meiner Diplomarbeit) die heterologe Überexpression von PetP in E. coli erfolgreich etabliert (dargestellt in Abbildung 3-7 A). Außerdem konnten erste Reinigungserfolge des heterolog exprimierten Proteins mittels IMAC erzielt werden, wie in der silbergefärbten SDS-PAGE in Abbildung 3-7 B zu sehen ist. Allerdings war die Reinigung nur im kleinen Maßstab erfolgreich, so dass nicht ausreichend Protein für Struktur- und Funktionsanalysen gewonnen werden konnte. Aus diesem Grund sollte im Rahmen dieser Arbeit die Reinigung des Proteins im großen Maßstab etabliert werden.

77 Ergebnisse Optimierung der Reinigung des heterolog exprimierten PetP Um die Reinigung des heterolog überexprimierten PetP-Proteins zu optimieren und das rekombinante Protein in größeren Mengen reinigen zu können, wurde das Volumen der Expressionskulturen erhöht. Bislang hatten die E. coli Kulturen, die der Überexpression des PetP-Proteins dienten, ein Volumen von ml. Im Rahmen dieser Arbeit wurde die Überexpression im 5 Liter Maßstab durch Verwendung eines Bioreaktor-Systems der Firma Braun (dargestellt in Abbildung 3-8) etabliert. Abbildung 3-8 Kultivierung von E. coli im Bioreaktorsystem. Die Kultivierung der E. coli-kulturen im Bioreaktor hat im Vergleich zu Schüttelkulturen viele Vorteile: Zum einen können pro Expression bis zu 5 Liter Kultur auf einmal angezogen werden. Außerdem können durch die regulierbare Begasung mit Pressluft die Kulturen optimal mit Sauerstoff versorgt werden. Weiterhin lassen sich die Begasung, Durchmischung und Temperierung der Kultur durch die Steuereinheit des Bioreaktor-Systems genau regulieren. Zusätzlich bietet die Verwendung des Reaktor-Systems über eine eingebaute ph-elektrode den Vorteil, den ph-wert der Expressionskultur zu überwachen und bei Schwankungen zu regulieren. Dies ist von enormem Vorteil, da sich im Laufe der Expression durch die entstehenden Stoffwechselprodukte der Zellen oft der ph-wert der Kultur ändert (was das Wachstum der Zellen sowie die Expression negativ beeinflussen kann). Dazu bietet das Reaktor-Systems noch den weiteren Vorteil, dass über eine eingebaute Elektrode die Dichte der Kulturen gemessen werden kann. Dies ist gerade bei der

Mitochondriale Elektronentransportkette (Atmungskette)

Mitochondriale Elektronentransportkette (Atmungskette) Mitochondriale Elektronentransportkette (Atmungskette) Mitochondriale Elektronentransportkette (Atmungskette) Komplex I und II übetragen Elektronen auf Coenzym Q (Ubichinon) Gekoppelte Elektronen-Protonen

Mehr

Evolutionärer Vorteil als Grundlage zum Leben? Von Nadine Körtel Konrad-Adenauer Straße , Hainburg

Evolutionärer Vorteil als Grundlage zum Leben? Von Nadine Körtel Konrad-Adenauer Straße , Hainburg Phototrophe Lebensweise Evolutionärer Vorteil als Grundlage zum Leben? Von Nadine Körtel Konrad-Adenauer Straße 50 63512, Hainburg Gliederung Phototrophe Bakterien Endosymbiontentheorie Chloroplasten Pigmente

Mehr

Photosynthetischer Elektronen-Transport

Photosynthetischer Elektronen-Transport Photosynthetischer Elektronen-Transport Hendrik Küpper, Vorlesungsreihe Einführung in Bau und Funktion der Pflanzen, Sommersemester 2013 Rückblick: Geschichte der Photosynthese Cornelius van Niel (1932)

Mehr

Photosynthese. Pflanzen nied. Eukaryoten (Rotalgen) Prokaryoten (Cyanobakterien) Cyanobakterium Anabaena. Abb. aus Stryer (5th Ed.

Photosynthese. Pflanzen nied. Eukaryoten (Rotalgen) Prokaryoten (Cyanobakterien) Cyanobakterium Anabaena. Abb. aus Stryer (5th Ed. Photosynthese Pflanzen nied. Eukaryoten (Rotalgen) Prokaryoten (Cyanobakterien) Cyanobakterium Anabaena Chloroplasten Photosynthese Licht CO 2 + H 2 O (CH 2 O) + O 2 Licht Lichtreaktion: 2 H 2 O O 2 +

Mehr

Lichtgetriebener Elektronentransport in der Thylakoidmembran führt zu PMK

Lichtgetriebener Elektronentransport in der Thylakoidmembran führt zu PMK Lichtgetriebener Elektronentransport in der Thylakoidmembran führt zu PMK PMF ensteht an drei Punkten Wasserspaltung im Lumen Transport von Protonen vom Stroma zum Lumen durch Plastochinon Aufnahme eines

Mehr

Materialien und Methoden...16

Materialien und Methoden...16 Inhaltsverzeichnis I. Einleitung...1 1. Mitochondrien - Energielieferanten der eukaryontischen Zelle... 1 2. Die mitochondriale DNA-Replikation... 5 2.1. Transkriptionsabhängige mtdna-replikation... 5

Mehr

Aufbau eines Assays zur Optimierung einer Polymerase für die Generierung hochgradig fluoreszenz-markierter DNA

Aufbau eines Assays zur Optimierung einer Polymerase für die Generierung hochgradig fluoreszenz-markierter DNA Aufbau eines Assays zur Optimierung einer Polymerase für die Generierung hochgradig fluoreszenz-markierter DNA Von der Naturwissenschaftlichen Fakultät der Technischen Universität Carolo-Wilhelmina zu

Mehr

Atmungskette ( Endoxidation) Reaktionen und ATP-Synthase

Atmungskette ( Endoxidation) Reaktionen und ATP-Synthase Atmungskette ( Endoxidation) Reaktionen und ATP-Synthase Einleitung Aufrechterhaltung von Struktur und Funktion aller Lebensformen hängt von einer ständigen Energiezufuhr ab Höchste Energieausbeute liefert

Mehr

Von Nadine Ufermann und Marcus Oldekamp

Von Nadine Ufermann und Marcus Oldekamp Von Nadine Ufermann und Marcus Oldekamp Photosynthese: Allgemein und Lichtreaktion Photosysteme: PSI und PSII, Entdeckung und Funktion Mangan und Manganenzyme: Speziell sauerstoffentwickelnder Mn Cluster

Mehr

Regulation der Carotinoidbiosynthese in Nostoc PCC Dissertation Zur Erlangung des Doktorgrades der Naturwissenschaften

Regulation der Carotinoidbiosynthese in Nostoc PCC Dissertation Zur Erlangung des Doktorgrades der Naturwissenschaften Regulation der Carotinoidbiosynthese in Nostoc PCC 7120 Dissertation Zur Erlangung des Doktorgrades der Naturwissenschaften vorgelegt beim Fachbereich Biowissenschaften der Johann Wolfgang Goethe-Universität

Mehr

Molekulargenetische Charakterisierung von Untereinheiten des Cytochrom b 6 f-komplexes von Cyanobakterien der Gattung Anabaena

Molekulargenetische Charakterisierung von Untereinheiten des Cytochrom b 6 f-komplexes von Cyanobakterien der Gattung Anabaena Molekulargenetische Charakterisierung von Untereinheiten des Cytochrom b 6 f-komplexes von Cyanobakterien der Gattung Anabaena Dissertation zur Erlangung des Doktorgrades der Naturwissenschaften (Dr. rer.

Mehr

Biochemie und. chemischer Mechanismus

Biochemie und. chemischer Mechanismus Dissertation zur Erlangung des Doktorgrades der Fakultät für Chemie und Pharmazie der Ludwig-Maximilians-Universität München Biochemie und chemischer Mechanismus der Thiomethylierung von RNA Dorothea Maria

Mehr

Photosystem = Antenne + Reaktionszentrum

Photosystem = Antenne + Reaktionszentrum Photosynthetische Reaktionszentren Hendrik Küpper, Vorlesungsreihe Einführung in Bau und Funktion der Pflanzen, Sommersemester 2012 Photosystem = Antenne + Reaktionszentrum Licht Die Antennen absorbieren

Mehr

Glykolyse! Pyruvat-! dehydrogenase! Citronensäure-! Zyklus!!

Glykolyse! Pyruvat-! dehydrogenase! Citronensäure-! Zyklus!! Glykolyse! Pyruvat-! dehydrogenase! Citronensäure-! Zyklus!! Indirekte ATP synthese! Protonen können in wässriger Lösung sehr! schnell transportiert werden.! Ionen können biologische Membranen nicht spontan

Mehr

Photosynthetischer Elektronen-Transport

Photosynthetischer Elektronen-Transport Photosynthetischer Elektronen-Transport Hendrik Küpper, Vorlesungsreihe Einführung in Bau und Funktion der Pflanzen, Sommersemester 2012 Rückblick: Geschichte der Photosynthese Cornelius van Niel (1932)

Mehr

Untersuchungen zur Funktion von Stärke-Synthasen in der Kartoffel (Solanum tuberosum L.)

Untersuchungen zur Funktion von Stärke-Synthasen in der Kartoffel (Solanum tuberosum L.) Untersuchungen zur Funktion von Stärke-Synthasen in der Kartoffel (Solanum tuberosum L.) Inaugural-Dissertation Erlangung der Doktorwürde im Fachbereich Biologie der Freien Univeisität Berlin vorgelegt

Mehr

3. Lichtabhängige Reaktionen

3. Lichtabhängige Reaktionen 3. Lichtabhängige Reaktionen Problem: Wie wird die elektromagnetische Strahlung des Sonnenlichts in chemisch verwertbare Energie umgewandelt? Um die Lichtenergie chemisch nutzbar zu machen, muss elektromagnetische

Mehr

Photosynthetische Reaktionszentren

Photosynthetische Reaktionszentren Photosynthetische Reaktionszentren Hendrik Küpper, Vorlesungsreihe Einführung in Bau und Funktion der Pflanzen, Sommersemester 2013 Photosystem = Antenne + Reaktionszentrum Licht Die Antennen absorbieren

Mehr

Regulation der Glykolyse: Phosphofructokinase

Regulation der Glykolyse: Phosphofructokinase Regulation der Glykolyse: Phosphofructokinase Abbauwege des Pyruvats Weitere Oxidation (zu CO 2 ) Alkoholische Gärung Pyruvat- Decarboxylase Alkohol- Dehydrogenase NAD + wird bei der Gärung regneriert,

Mehr

1. EINLEITUNG Der eukaryontische Translationsinitiationsfaktor 5A (eif5a) Der Polyaminbiosyntheseinhibitor Agmatin...

1. EINLEITUNG Der eukaryontische Translationsinitiationsfaktor 5A (eif5a) Der Polyaminbiosyntheseinhibitor Agmatin... 1. EINLEITUNG... 14 1.1 Lebenszyklus der Malaria Erreger Plasmodium falciparum und Plasmodium vivax... 16 1.2 Molekulares Targeting... 18 1.2.1 Die alternative Fettesäurebiosynthese II in Plasmodium falciparum...

Mehr

Photosynthese. Astrobiologie: Panspermie und Terraforming von (Exo-)Planeten WS 13/14. Anna Till

Photosynthese. Astrobiologie: Panspermie und Terraforming von (Exo-)Planeten WS 13/14. Anna Till Astrobiologie: Panspermie und Terraforming von (Exo-)Planeten WS 13/14 Anna Till Einleitung Überblick 1 Photosynthese Allgemeines zur Photosynthese Oxygene Photosyntehese Anoxygene Photosyntehese Verlgeich:

Mehr

MOSC-Proteine aus Escherichia coli, Homo sapiens, Mus musculus und. Arabidopsis thaliana

MOSC-Proteine aus Escherichia coli, Homo sapiens, Mus musculus und. Arabidopsis thaliana Untersuchung Molybdäncofaktor-haltiger MOSC-Proteine aus Escherichia coli, Homo sapiens, Mus musculus und Arabidopsis thaliana Von der Fakultät für Lebenswissenschaften der Technischen Universität Carolo-Wilhelmina

Mehr

Physiologie der Photosynthese

Physiologie der Photosynthese Claus Buschmann Karl Grumbach Physiologie der Photosynthese Mit 106 Abbildungen UNIVERSITÄTS, BIBLIOTHEK Springer-Verlag Berlin Heidelberg New York Tokyo 1985 \ Inhaltsverzeichnis 1. Stoffumwandlungen

Mehr

Rekombinante Antikorper. fur,,lab-on-chip"

Rekombinante Antikorper. fur,,lab-on-chip Rekombinante Antikorper fur,,lab-on-chip" Von der Fakultat fur Lebenswissenschaften der Technischen Universitat Carolo-Wilhelmina zu Braunschweig zur Erlangung des Grades einer Doktorin der Naturwissenschaften

Mehr

VERZEICHNIS DER ABBILDUNGEN UND TABELLEN VERZEICHNIS DER ABKÜRZUNGEN UND TRIVIALNAMEN

VERZEICHNIS DER ABBILDUNGEN UND TABELLEN VERZEICHNIS DER ABKÜRZUNGEN UND TRIVIALNAMEN INHALTSVERZEICHNIS I VERZEICHNIS DER ABBILDUNGEN UND TABELLEN VII VERZEICHNIS DER ABKÜRZUNGEN UND TRIVIALNAMEN XIII 1 EINLEITUNG 1 1.1 Osmoadaption halophiler Mikroorganismen 2 1.1.1 Salt-in-cytoplasm

Mehr

Untersuchungen zur Wirkung von Pasteurella multocida Toxin

Untersuchungen zur Wirkung von Pasteurella multocida Toxin Institut fiir Experimentelle und Klinische Pharmakologie und Toxikologie der Albert-Ludwigs-Universitat Freiburg Untersuchungen zur Wirkung von Pasteurella multocida Toxin Dissertation zur Erlangung des

Mehr

Atmung Respiration 1

Atmung Respiration 1 Atmung Respiration 1 Atmung Die oxidative Phosphorylierung ist der letzte Schritt einer Serie von Energieumwandlungen, die insgesamt als Zellatmung oder einfach Atmung (Respiration) bezeichnet werden 2

Mehr

Biologie I: Funktionen des Blattes

Biologie I: Funktionen des Blattes Biologie I: Funktionen des Blattes Chloroplasten und Photosyntheseapparat Prinzipien der Energiegewinnung und Energienutzung Lichtreaktion der Photosynthese Dunkelreaktion der Photosynthese Copyright Hinweis:

Mehr

Photosystem=Antenne + Reaktionszentrum

Photosystem=Antenne + Reaktionszentrum Lichtsammelkomplexe Hendrik Küpper, Vorlesungsreihe Einführung in Bau und Funktion der Pflanzen, Sommersemester 2012 Photosystem=Antenne + Reaktionszentrum Die Antennen absorbieren die Photonen und leiten

Mehr

Protokoll Versuch 1 d Bestimmung der photochemischen Aktivität isolierter Chloroplasten mit der Sauerstoffelektrode

Protokoll Versuch 1 d Bestimmung der photochemischen Aktivität isolierter Chloroplasten mit der Sauerstoffelektrode Protokoll Versuch 1 d Bestimmung der photochemischen Aktivität isolierter Chloroplasten mit der Sauerstoffelektrode Chloroplasten verlieren bei ihrer Isolation die umhüllende Doppelmembran, die in der

Mehr

Posttranskriptionale Veränderungen der Genexpression bei hereditären Erkrankungen

Posttranskriptionale Veränderungen der Genexpression bei hereditären Erkrankungen Posttranskriptionale Veränderungen der Genexpression bei hereditären Erkrankungen Dissertation zur Erlangung des Doktorgrades Dr. rer. nat. des Fachbereichs Biologie, Chemie, Pharmazie der Freien Universität

Mehr

Manganenzyme und Photosystem II

Manganenzyme und Photosystem II Manganenzyme und Photosystem II von Gang Wang & Raimar Broser Steinfurt, den 17. November 2004 Inhaltsangabe 1. Bedeutung der Photosynthese 2. rt und rganelle der Photosynthese 3. Ablauf der Photosynthese

Mehr

Fd n H + 4H + 4e - 4e - PC oder Cyt c 6

Fd n H + 4H + 4e - 4e - PC oder Cyt c 6 1 1 Einleitung 1.1 Die oxygene Photosynthese Pflanzen, Algen und Cyanobakterien verfügen über die einzigartige Fähigkeit, Kohlendioxid (CO 2 ) und Wasser (H 2 O) unter Nutzung von Lichtenergie zum Aufbau

Mehr

3 Ergebnisse. 3.1 Die Speckling-Domäne von Wt1 umfaßt die Aminosäuren

3 Ergebnisse. 3.1 Die Speckling-Domäne von Wt1 umfaßt die Aminosäuren 3 Ergebnisse 3.1 Die Speckling-Domäne von Wt1 umfaßt die Aminosäuren 76-120 Die Existenz verschiedener Isoformen von WT1 ist unter anderem auf die Verwendung einer für die Aminosäuren KTS kodierenden alternativen

Mehr

Die Primärreaktion der Photosynthese

Die Primärreaktion der Photosynthese Die Primärreaktion der Photosynthese 1. Energetische Betrachtungen Wie ist es energetisch möglich, dass das so energiearme und stabile Wassermolekül in der Primärreaktion der Photosynthese zu Sauerstoff

Mehr

Die Primärreaktion der Photosynthese

Die Primärreaktion der Photosynthese Die Primärreaktion der Photosynthese 1. Energetische Betrachtungen Wie ist es energetisch möglich, dass das so energiearme und stabile Wassermolekül in der Primärreaktion der Photosynthese zu Sauerstoff

Mehr

Rekombinante Antikorperfragmente fur die. Zoonosediagnostik

Rekombinante Antikorperfragmente fur die. Zoonosediagnostik Rekombinante Antikorperfragmente fur die Zoonosediagnostik Von der Fakultat fur Lebenswissenschaften der Technischen Universitat Carolo-Wilhelmina zu Braunschweig zur Erlangung des Grades eines Doktors

Mehr

Hochdurchsatz Generierung und Analyse von Arabidopsis thaliana-proteinen

Hochdurchsatz Generierung und Analyse von Arabidopsis thaliana-proteinen MAX-PLANCK-INSTITUT FÜR MOLEKULARE GENETIK Hochdurchsatz Generierung und Analyse von Arabidopsis thaliana-proteinen Dissertation zur Erlangung der Doktorwürde des Fachbereichs Biologie, Chemie, Pharmazie

Mehr

Inhalt. Inhaltsverzeichnis

Inhalt. Inhaltsverzeichnis Inhaltsverzeichnis I Abbildungsverzeichnis VI Tabellenverzeichnis VIII Abkürzungsverzeichnis IX 1 Einleitung 1 2 Material und Methoden 10 2.1 Liste der verwendeten Geräte und Feinchemikalien 10 2.1.1 Geräte

Mehr

Neue Enzyme für ein altes Organeil: Kryptische peroxisomale Lokalisationssignale in Pilzen. Dissertation

Neue Enzyme für ein altes Organeil: Kryptische peroxisomale Lokalisationssignale in Pilzen. Dissertation Neue Enzyme für ein altes Organeil: Kryptische peroxisomale Lokalisationssignale in Pilzen Dissertation zur Erlangung des Doktorgrades der Naturwissenschaften (Dr. rer. nat.) Dem Fachbereich Biologie der

Mehr

Oxidative Phosphorylierung

Oxidative Phosphorylierung BICEMIE DER ERÄRUG II Grundzüge des Metabolismus xidative Phosphorylierung 24.04.2012 xidative Phosphorylierung xidative Phosphorylierung -Die Elektronen in AD und in FAD 2 (hohes Übertragungspotential)

Mehr

Die Rolle des Cytochrom b 6 f-komplexes in der photosynthetischen Elektronentransportkette

Die Rolle des Cytochrom b 6 f-komplexes in der photosynthetischen Elektronentransportkette Die Rolle des Cytochrom b 6 f-komplexes in der photosynthetischen Elektronentransportkette Bachelorarbeit im Studiengang Biologie der Heinrich-Heine- Universität Düsseldorf Isabelle Preißner Erstprüfer:

Mehr

Kerstin Brachhold (Autor) Das Basalapparat-Subproteom von Chlamydomonas reinhardtii

Kerstin Brachhold (Autor) Das Basalapparat-Subproteom von Chlamydomonas reinhardtii Kerstin Brachhold (Autor) Das Basalapparat-Subproteom von Chlamydomonas reinhardtii https://cuvillier.de/de/shop/publications/1867 Copyright: Cuvillier Verlag, Inhaberin Annette Jentzsch-Cuvillier, Nonnenstieg

Mehr

VL3: Struktur und Funktion des Photosystem I. Athina Zouni

VL3: Struktur und Funktion des Photosystem I. Athina Zouni VL3: Struktur und Funktion des Photosystem I Athina Zouni VL3: Plan Einleitung Grundlagen zur Lichtreaktion der Photosynthese Struktur und Funktion des cyanobakteriellen PSI Kristallstruktur des PSI: 2.5

Mehr

Pflanzliche und bakterielle Stoffwechselprozesse

Pflanzliche und bakterielle Stoffwechselprozesse Pflanzliche und bakterielle Stoffwechselprozesse 4.6 Pflanzliche und bakterielle Stoffwechselprozesse 4.6.1 Photosynthese 4.6.2 Chemosynthese 4.6.3 Calvin-Cyclus Photosynthese Die Photosynthese ist ein

Mehr

Versuchsprotokoll. 1.) Versuch 1d: Bestimmung der photochemischen Aktivität isolierter Chloroplasten mit der Sauerstoffelektrode

Versuchsprotokoll. 1.) Versuch 1d: Bestimmung der photochemischen Aktivität isolierter Chloroplasten mit der Sauerstoffelektrode Versuchsprotokoll 1.) Versuch 1d: Bestimmung der photochemischen Aktivität isolierter Chloroplasten mit der Sauerstoffelektrode 1.1. Einleitung: Bei der Isolierung von Chloroplasten erhält man Hauptsächlich

Mehr

Biologie für Mediziner

Biologie für Mediziner Biologie für Mediziner - Zellbiologie 1 - Prof. Dr. Reiner Peters Institut für Medizinische Physik und Biophysik/CeNTech Robert-Koch-Strasse 31 Tel. 0251-835 6933, petersr@uni-muenster.de Dr. Martin Kahms

Mehr

3.2 Posttranslationelle Modifikation von Wt1 durch Phosphorylierung

3.2 Posttranslationelle Modifikation von Wt1 durch Phosphorylierung 3.2 Posttranslationelle Modifikation von Wt1 durch Phosphorylierung Transkriptionsfaktoren erfahren oft eine posttranslationelle Modifikation in Form von Phosphorylierung und werden dadurch in ihrer Aktivität

Mehr

Antibiotika sind oft Inhibitoren der Genexpression

Antibiotika sind oft Inhibitoren der Genexpression Antibiotika sind oft Inhibitoren der Genexpression Inhibitoren der Transkription: Rifampicin, Actinomycin α-amanitin Inhibitoren der Translation: Puromycin, Streptomycin, Tetracycline, Chloramphenicol

Mehr

Auswirkung verschiedener Umweltbedingungen auf Photosystem II, nachgewiesen durch Messung der Chlorophyll-Fluoreszenz

Auswirkung verschiedener Umweltbedingungen auf Photosystem II, nachgewiesen durch Messung der Chlorophyll-Fluoreszenz Kurs 63032, -36, -26 Pflanzenphyiologische und ökologische Übungen Auswirkung verschiedener Umweltbedingungen auf Photosystem II, nachgewiesen durch Messung der Chlorophyll-Fluoreszenz Georg-August- Universität

Mehr

Fachverlag Köhler Giessen VETERINÄRMEDIZIN

Fachverlag Köhler Giessen VETERINÄRMEDIZIN VETERINÄRMEDIZIN Kälteanpassung \bi\ Listeria monocytogenes: Klonierung, D^Ä-Sequenzanalyse und Funktionsstudien der Gene CS/JL, CS/JLB und flar aus dem Wildtypstamm Listeria monocytogenes EGD Eva-Maria

Mehr

Herstellung und Charakterisierung von zellpermeablem Interferon-α des Waldmurmeltieres (Marmota monax)

Herstellung und Charakterisierung von zellpermeablem Interferon-α des Waldmurmeltieres (Marmota monax) Aus der Abteilung Innere Medizin II der Medizinischen Universitätsklinik der Albert-Ludwigs-Universität Freiburg im Breisgau Herstellung und Charakterisierung von zellpermeablem Interferon-α des Waldmurmeltieres

Mehr

Elektronenmikroskopie zeigte die Existenz der A-, P- und E- trna-bindungsstellen. Abb. aus Stryer (5th Ed.)

Elektronenmikroskopie zeigte die Existenz der A-, P- und E- trna-bindungsstellen. Abb. aus Stryer (5th Ed.) Elektronenmikroskopie zeigte die Existenz der A-, P- und E- trna-bindungsstellen Die verschiedenen Ribosomen-Komplexe können im Elektronenmikroskop beobachtet werden Durch Röntgenkristallographie wurden

Mehr

Citratzyklus. Biochemie Maria Otto,Bo Mi Ok Kwon Park

Citratzyklus. Biochemie Maria Otto,Bo Mi Ok Kwon Park Citratzyklus Biochemie 13.12.2004 Maria Otto,Bo Mi Ok Kwon Park O CH 3 C Acetyl-CoA + H 2 O HO C COO C NADH O C H Citrat Cis-Aconitat H C Malat Citratzyklus HO C H Isocitrat CH H 2 O Fumarat C = O FADH

Mehr

STRUKTUR UND FUNKTION DER PFLANZE :15

STRUKTUR UND FUNKTION DER PFLANZE :15 NAME: Vorname: Matr.Nr.: Studienkennz.: STRUKTUR UND FUNKTION DER PFLANZE 02.09.2009 10:15 1. Vorkommen von Organellen und Kompartimenten in unterschiedlichen Zelltypen: Kennzeichnen Sie in der untenstehenden

Mehr

Die gewebespezifische Genexpression in der Epidermis des Gerstenblattes

Die gewebespezifische Genexpression in der Epidermis des Gerstenblattes Die gewebespezifische Genexpression in der Epidermis des Gerstenblattes Dissertation zur Erlangung des naturwissenschaftlichen Doktorgrades der Bayerischen Julius-Maximilians-Universität Würzburg vorgelegt

Mehr

Modellkomplexe für das PhotosystemII. Robert Brüninghoff

Modellkomplexe für das PhotosystemII. Robert Brüninghoff Modellkomplexe für das PhotosystemII Robert Brüninghoff 20.05.2014 Überblick Photosynthese Photosystem-II Inhalt Sauerstoffentwickelnder Komplex (OEC) & Modelle 20/05/2014 FH Münster, Bioanorganische Chemie

Mehr

Reduction / Oxidation

Reduction / Oxidation Reduction / Oxidation Pyruvat C6H12O 6 Glucose Glycogen Glucose-6-P Glycolyse 2 e - 2 Pyruvat 2 e - 2 Acetyl-CoA 2 CO 2 ATP ADP ATP ADP Citrat-Zyklus oder Tricarbonsäure 4 CO 2 8 e - Zyklus 6 O2 6 H 2

Mehr

https://cuvillier.de/de/shop/publications/3308

https://cuvillier.de/de/shop/publications/3308 Frank Falinski (Autor) Überproduktion von Subkomplexen der F420H2- Dehydrogenase aus Archaeoglobus fulgidus und abschließende Untersuchungen zur Verbereitung von Methanophenazin in methanogenen Archaea

Mehr

Einführung in die Biochemie Fotosynthese Autotrophe Assimilation

Einführung in die Biochemie Fotosynthese Autotrophe Assimilation Fotosynthese Autotrophe Assimilation Die Fotosynthese läuft in den Chloroplasten ab. Der Chloroplast wird nach außen hin von einer Doppelmembran begrenzt. Im inneren befindet sich das Stroma, Stärkekörner,

Mehr

Biochemische UE Alkaline Phosphatase.

Biochemische UE Alkaline Phosphatase. Biochemische UE Alkaline Phosphatase peter.hammerl@sbg.ac.at Alkaline Phosphatase: Katalysiert die Hydrolyse von Phosphorsäure-Estern: O - O - Ser-102 R O P==O O - H 2 O R OH + HO P==O O - ph-optimum im

Mehr

Molekulare Mechanismen der p16-vermittelten Anoikisinduktion in humanen Pankreaskarzinom-Zellen

Molekulare Mechanismen der p16-vermittelten Anoikisinduktion in humanen Pankreaskarzinom-Zellen Aus der Medizinischen Klinik mit Schwerpunkt Hepatologie und Gastroenterologie der Charité - Universitätsmedizin Berlin Campus Virchow-Klinikum Leiter: Prof. Dr. Bertram Wiedenmann Arbeitsgruppe Prof.

Mehr

Gewebe- und zellspezifische Lokalisation der Alkaloidbiosynthese in Papaver somniferum L.

Gewebe- und zellspezifische Lokalisation der Alkaloidbiosynthese in Papaver somniferum L. Gewebe- und zellspezifische Lokalisation der Alkaloidbiosynthese in Papaver somniferum L. Dissertation Zur Erlangung des akademischen Grades Doctor rerum naturalium (Dr. rer. nat.) vorgelegt der Mathematisch-Naturwissenschaftlich-Technischen

Mehr

Sophia Buhs. Dissertation. Diplom-Biochemikerin

Sophia Buhs. Dissertation. Diplom-Biochemikerin Beeinflussung Phosphotyrosin-abhängiger Signalwege in humanen unter Einsatz von SH2-Domänen und Phosphatasen in Kombination mit dem TAT-Transduktionssystem Dissertation Zur Erlangung der Würde des Doktors

Mehr

Wirkungsmechanismen regulatorischer Enzyme

Wirkungsmechanismen regulatorischer Enzyme Wirkungsmechanismen regulatorischer Enzyme Ein Multienzymsystem ist eine Aufeinanderfolge von Enzymen, bei der das Produkt eines vorstehenden Enzyms das Substrat des nächsten Enzyms wird. Ein regulatorisches

Mehr

- der oxidative Abbau von Acetyl-CoA (und die somit gebildeten Reduktionsäquivalente) - Lieferung von Substraten für verschiedene Synthesen

- der oxidative Abbau von Acetyl-CoA (und die somit gebildeten Reduktionsäquivalente) - Lieferung von Substraten für verschiedene Synthesen Die Aufgabe des Citratcyklus ist: - der oxidative Abbau von Acetyl-CoA (und die somit gebildeten Reduktionsäquivalente) - Lieferung von Substraten für verschiedene Synthesen Die Aufgabe des Citratcyklus

Mehr

Schritt für Schritt Simulation Die Atmungskette

Schritt für Schritt Simulation Die Atmungskette KENNZEICHEN: KURS - SCHULE - - Schritt für Schritt Simulation Die Atmungskette Inhalt Übersicht über das Mitochondrium und die Mitochondrienmembran S.2 Zeichenerklärung S.3 Stichwortverzeichnis S.4 Leitfaden

Mehr

VL4: Purpurbakterien - Antennenchlorophylle. Kolonien von Purpurbakterien in Petrischale. Lebende Purpurbakterien

VL4: Purpurbakterien - Antennenchlorophylle. Kolonien von Purpurbakterien in Petrischale. Lebende Purpurbakterien VL4: Purpurbakterien - Antennenchlorophylle Kolonien von Purpurbakterien in Petrischale Lebende Purpurbakterien VL4: Photosynthetische Einheit in bakteriellen Purpurbakterien PSU (photosynthetic unit)

Mehr

https://cuvillier.de/de/shop/publications/1657

https://cuvillier.de/de/shop/publications/1657 Christian Landmann (Autor) Funktionelle Charakterisierung von Enzymen des Sekundärstoffwechsels in Lavendel (Lavandula angustifolia) und Erdbeere (Fragaria x ananassa) https://cuvillier.de/de/shop/publications/1657

Mehr

Hypothetische Modelle

Hypothetische Modelle Hypothetische Modelle Heutiges Paper Vorgehensweise: Screening nach neuen Mutanten mit neuen Phänotyp Neuer Phänotyp: CPD, NPA- Resistenz (CPD, NPA: Wachstumshemmung durch Inhibierung des Auxin- Transport

Mehr

Lichtabsorption. Handout zum Vortrag am REFERAT BIOLOGIE LEISTUNGSKURS. 11 Februar 2007 Verfasst von: Daniela Luxem

Lichtabsorption. Handout zum Vortrag am REFERAT BIOLOGIE LEISTUNGSKURS. 11 Februar 2007 Verfasst von: Daniela Luxem Lichtabsorption Handout zum Vortrag am 13.02.2007 REFERAT BIOLOGIE LEISTUNGSKURS 11 Februar 2007 Verfasst von: Daniela Luxem Lichtabsorption Handout zum Vortrag am 13.02.2007 Ziel dieser Arbeit ist, den

Mehr

Cornel Mülhardt. Molekularbiologie/ Genomics

Cornel Mülhardt. Molekularbiologie/ Genomics Cornel Mülhardt Molekularbiologie/ Genomics 1 Was ist denn Molekularbiologie", bitteschön? 1 1.1 Das Substrat der Molekularbiologie, oder : Molli-World für Anfänger 2 1.2 Was brauche ich zum Arbeiten?

Mehr

Molekulare Klonierung Praktikum

Molekulare Klonierung Praktikum Molekulare Klonierung Praktikum 2013 Praktikumsaufgabe Ligation 1. Zusammensetzung des Ligationsreaktions-ansatzes : 1 l Vektor DNA 1 l Insert DNA 2 l 10X Ligase Puffer 15 l destillertes Wasser 1 l Ligase

Mehr

Zellbiologie: BSc Arbeiten 15/16

Zellbiologie: BSc Arbeiten 15/16 Zellbiologie: BSc Arbeiten 15/16 Lehrstuhl Zellbiologie: Arbeitsgruppen Prof. Benedikt Kost Prof. Georg Kreimer PD Michael Lebert Slot Zeitraum Anzahl Plätze Semester 1 24.08.15 09.10.15 4 Ferien 2 09.11.15

Mehr

Vergleichende Charakterisierung von Synechocystis sp. PCC 6803 Wildtyp und einer Histidin-Kinase (Slr1759)-freien Mutante

Vergleichende Charakterisierung von Synechocystis sp. PCC 6803 Wildtyp und einer Histidin-Kinase (Slr1759)-freien Mutante Vergleichende Charakterisierung von Synechocystis sp. PCC 6803 Wildtyp und einer Histidin-Kinase (Slr1759)-freien Mutante Vergleichende Charakterisierung von Synechocystis sp. PCC 6803 Wildtyp und einer

Mehr

LEHRSTUHL ZELLBIOLOGIE

LEHRSTUHL ZELLBIOLOGIE LEHRSTUHL ZELLBIOLOGIE Signalwahrnehmung & weiterleitung: Regulation zellulärer Prozesse Protisten (Euglena gracilis) Grünalgen (Chlamydomonas reinhardtii) Moose (Physcomitrella patens) Höhere Pflanzen

Mehr

Posttranskriptionale RNA-Prozessierung

Posttranskriptionale RNA-Prozessierung Posttranskriptionale RNA-Prozessierung Spaltung + Modifikation G Q Spleissen + Editing U UUU Prozessierung einer prä-trna Eukaryotische messenger-rna Cap-Nukleotid am 5 -Ende Polyadenylierung am 3 -Ende

Mehr

Photosynthese. Stoffwechsel Kontrolle Physiologie. D. W. Lawlor Übersetzung von Merlet Behncke Bearbeitung von Donat-P. Hader

Photosynthese. Stoffwechsel Kontrolle Physiologie. D. W. Lawlor Übersetzung von Merlet Behncke Bearbeitung von Donat-P. Hader Photosynthese Stoffwechsel Kontrolle Physiologie D. W. Lawlor Übersetzung von Merlet Behncke Bearbeitung von Donat-P. Hader 98 Abbildungen, 17 Tabellen 1990 Georg Thieme Verlag Stuttgart -New York Inhaltsverzeichnis

Mehr

Daniela Lieder (Autor) Untersuchung der Reifung des Hepatitis B Virus Nukleokapsids

Daniela Lieder (Autor) Untersuchung der Reifung des Hepatitis B Virus Nukleokapsids Daniela Lieder (Autor) Untersuchung der Reifung des Hepatitis B Virus Nukleokapsids https://cuvillier.de/de/shop/publications/3644 Copyright: Cuvillier Verlag, Inhaberin Annette Jentzsch-Cuvillier, Nonnenstieg

Mehr

Universität Ulm. Protokoll zu den Grundübungen Pflanzenphysiologie und Molekulare Botanik. Wintersemester 2011/2012. Versuch C2: Hill Reaktion.

Universität Ulm. Protokoll zu den Grundübungen Pflanzenphysiologie und Molekulare Botanik. Wintersemester 2011/2012. Versuch C2: Hill Reaktion. Universität Ulm Protokoll zu den Grundübungen Pflanzenphysiologie und Molekulare Botanik Wintersemester 2011/2012 Versuch C2: Hill Reaktion Tutor: Vorgelegt von: Abgegeben am: Version: 1 Inhaltsverzeichnis:

Mehr

GEIM- TECHIMOLOGISCHE ARBEITSMETHODEN

GEIM- TECHIMOLOGISCHE ARBEITSMETHODEN GEIM- TECHIMOLOGISCHE ARBEITSMETHODEN Ein Handbuch experimenteller Techniken und Verfahren Herausgegeben von Rudolf Hagemann Bearbeitet von Frank Baldauf, Jörn Belter, Sabine Brantl, Baimund Eck, Karsten

Mehr

Übung 11 Genregulation bei Prokaryoten

Übung 11 Genregulation bei Prokaryoten Übung 11 Genregulation bei Prokaryoten Konzepte: Differentielle Genexpression Positive Genregulation Negative Genregulation cis-/trans-regulation 1. Auf welchen Ebenen kann Genregulation stattfinden? Definition

Mehr

Entwicklungs /gewebespezifische Genexpression. Coexpression funktional überlappender Gene

Entwicklungs /gewebespezifische Genexpression. Coexpression funktional überlappender Gene Übung 11 Genregulation bei Prokaryoten Konzepte: Entwicklungs /gewebespezifische Genexpression Coexpression funktional überlappender Gene Positive Genregulation Negative Genregulation cis /trans Regulation

Mehr

In den grünen Pflanzenteilen, genauer gesagt in bestimmten Organellen der Pflanzenzellen, den

In den grünen Pflanzenteilen, genauer gesagt in bestimmten Organellen der Pflanzenzellen, den A 7 Fotosynthese Stellen sie die Wort- und die Symbolgleichung für den Vorgang der Fotosynthese in grünen Pflanzen auf. Wortgleichung: Symbolgleichung: Vervollständigen Sie den Text. In den grünen Pflanzenteilen,

Mehr

Inhaltsverzeichnis... I. Ein Vorwort... VII. Synopse der Arbeit... IX. Synopsis of the thesis... XIII

Inhaltsverzeichnis... I. Ein Vorwort... VII. Synopse der Arbeit... IX. Synopsis of the thesis... XIII I INHALTSVERZEICHNIS Inhaltsverzeichnis... I Ein Vorwort... VII Synopse der Arbeit... IX Synopsis of the thesis... XIII A. Untersuchungen über die Stereoselektivität bakterieller, Pyruvat-abhängiger Aldolasen...

Mehr

Eukaryotische messenger-rna

Eukaryotische messenger-rna Eukaryotische messenger-rna Cap-Nukleotid am 5 -Ende Polyadenylierung am 3 -Ende u.u. nicht-codierende Bereiche (Introns) Spleißen von prä-mrna Viele Protein-codierende Gene in Eukaryoten sind durch nicht-codierende

Mehr

5. STOFFWECHSEL. Energie-Quelle Brennstoffe. 5.1 Übersicht. Red.-Äquivalente. Katabolismus

5. STOFFWECHSEL. Energie-Quelle Brennstoffe. 5.1 Übersicht. Red.-Äquivalente. Katabolismus Energie-Quelle Brennstoffe 5.1 Übersicht Red.-Äquivalente Katabolismus Kohlenstoff-Quelle Baustoffe CO 2 -Fixierung 5.1 Übersicht Anabolismus 5.1 Übersicht Red.-Äquivalente ATMUNG Oxidative Phosphorylierung

Mehr

Hemmung der Enzym-Aktivität

Hemmung der Enzym-Aktivität Enzym - Inhibitoren Wie wirkt Penicillin? Wie wirkt Aspirin? Welche Rolle spielt Methotrexat in der Chemotherapie? Welche Wirkstoffe werden gegen HIV entwickelt? Hemmung der Enzym-Aktivität Substrat Kompetitiver

Mehr

11. Chemische Evolution Biologische Evolution. 1.5 Milliarde Jahre

11. Chemische Evolution Biologische Evolution. 1.5 Milliarde Jahre 11. Chemische Evolution Biologische Evolution 1.5 Milliarde Jahre Frühe Vorstellungen 2. Primitives Leben: Spontan gebildet oder Hochentwickeltes Leben: Von Gott geschöpft Der Versuch 3. von L. Pasteur

Mehr

Aufgabe 5 (Supersekundärstruktur)

Aufgabe 5 (Supersekundärstruktur) Aufgabe 5 (Supersekundärstruktur) Fragestellung Bei der Untereinheit des Arthropodenhämocyanins aus Limulus polyphemus werden folgende Fragestellungen untersucht: - Welche Supersekundärstrukturen gibt

Mehr

Maike van Ohlen (Autor) Pieris rapae und das Glucosinolat-Myrosinase-System Cyanidentgiftung in Lepidoptera

Maike van Ohlen (Autor) Pieris rapae und das Glucosinolat-Myrosinase-System Cyanidentgiftung in Lepidoptera Maike van Ohlen (Autor) Pieris rapae und das Glucosinolat-Myrosinase-System Cyanidentgiftung in Lepidoptera https://cuvillier.de/de/shop/publications/6781 Copyright: Cuvillier Verlag, Inhaberin Annette

Mehr

12. Oxidative Phosphorylierung

12. Oxidative Phosphorylierung 12. Oxidative Phosphorylierung 303 Zweck: Gewinnung von ATP Regeneration von NAD + und FAD Gesamtreaktionen: 3 ADP + 3 P i 3 ATP NADH + 0,5 O 2 + H + NAD + + H-O-H 2 ADP + 2 P i 2 ATP FADH 2 + 0,5 O 2

Mehr

Spektroskopische Untersuchungen des lichtinduzierten zyklischen Elektronentransfers in Roseobacter denitrificans

Spektroskopische Untersuchungen des lichtinduzierten zyklischen Elektronentransfers in Roseobacter denitrificans Aerobe photosynthetische Bakterien Spektroskopische Untersuchungen des lichtinduzierten zyklischen Elektronentransfers in Roseobacter denitrificans Inaugural-Dissertation zur Erlangung der Doktorwürde

Mehr

SS Thomas Schrader. der Universität Duisburg-Essen. (Teil 8: Redoxprozesse, Elektrochemie)

SS Thomas Schrader. der Universität Duisburg-Essen. (Teil 8: Redoxprozesse, Elektrochemie) Chemie für Biologen SS 2010 Thomas Schrader Institut t für Organische Chemie der Universität Duisburg-Essen (Teil 8: Redoxprozesse, Elektrochemie) Oxidation und Reduktion Redoxreaktionen: Ein Atom oder

Mehr

Hemmung der Enzym-Aktivität

Hemmung der Enzym-Aktivität Hemmung der Enzym-Aktivität Substrat Kompetitiver Inhibitor Enzym Enzym Substrat Nichtkompetitiver Inhibitor Irreversibler Inhibitor Enzym Enzym Enzym - Kinetik Michaelis Menten Gleichung Lineweaver -

Mehr

Verzeichnis der Abbildungen und Tabellen... VIII Verzeichnis der Abkürzungen und Trivialnamen... XI I Einleitung... 1

Verzeichnis der Abbildungen und Tabellen... VIII Verzeichnis der Abkürzungen und Trivialnamen... XI I Einleitung... 1 Verzeichnis der Abbildungen und Tabellen... VIII Verzeichnis der Abkürzungen und Trivialnamen... XI I Einleitung... 1 1 Extremophile Organismen... 1 2 Halophile Mikroorganismen... 2 2.1 Lebensräume und

Mehr

UAufgabe 12: (evolutiv konservierte Aminosäuren)

UAufgabe 12: (evolutiv konservierte Aminosäuren) UAufgabe 12: (evolutiv konservierte Aminosäuren) Aufgabenstellung Wählen Sie zur Darstellung evolutiv konservierter Aminosäure-Positionen in "1lla" eine ihnen sinnvoll erscheinende Anfärbung. Exportieren

Mehr

Der Citratzyklus (= Trikarbonsäurezyklus, Krebszyklus)

Der Citratzyklus (= Trikarbonsäurezyklus, Krebszyklus) Der Citratzyklus (= Trikarbonsäurezyklus, Krebszyklus) Biochemischer Kreisprozeß Ablauf in der mitochondrialen Matrix Glykolyse β-oxidation Atmungskette AS-Abbau Der Citratzyklus Der Citratzyklus: Übersicht

Mehr

Pharmakologische Untersuchungen zur Neuropeptid Y Yi-, Y 2 - und Ys-Rezeptorselektivität peptidischer und nichtpeptidischer Liganden:

Pharmakologische Untersuchungen zur Neuropeptid Y Yi-, Y 2 - und Ys-Rezeptorselektivität peptidischer und nichtpeptidischer Liganden: o Pharmakologische Untersuchungen zur Neuropeptid Y Yi-, Y 2 - und Ys-Rezeptorselektivität peptidischer und nichtpeptidischer Liganden: Klonierung und funktioneile Expression des humanen Ys-Rezeptors in

Mehr

Chemische Evolution Biologische Evolution

Chemische Evolution Biologische Evolution 11. Chemische Evolution Biologische Evolution 1.5 Milliarde Jahre Frühe Vorstellungen Primitives Leben: Spontan gebildet Hochentwickeltes Leben: Von Gott geschöpft 2. Der Versuch von L. 3. Pasteur 1860-as

Mehr