Embedded Quality. Qualitätssicherung eingebetteter Software: Methoden und Best-Practices

Größe: px
Ab Seite anzeigen:

Download "Embedded Quality. Qualitätssicherung eingebetteter Software: Methoden und Best-Practices"

Transkript

1 Embedded Quality Qualitätssicherung eingebetteter Software: Methoden und BestPractices FUSIM Prof. Dr.Ing. K. Bender, Dipl.Ing. P. Jack, Dipl.Ing. A. Koç, Dipl.Ing. I. Péter, Dipl.Ing. G. Megyeri Informationstechnik im Maschinenwesen, TU München

2 'LH 'HXWVFKH %LEOLRWKHN &,3(LQKHLWVDXIQDKPH (LQ 7LWHOGDWHQVDW] I U GLHVH 3XEOLNDWLRQ LVW EHL 'HU 'HXWVFKHQ %LEOLRWKHN HUKlOWOLFK 'LHVHV :HUN LVW XUKHEHUUHFKWOLFK JHVFK W]W 'LH GDGXUFK EHJU QGHWHQ 5HFKWH LQVEHVRQGHUH GLH GHU hehuvhw]xqj GHV 1DFKGUXFNV GHU (QWQDKPH YRQ $E ELOGXQJHQ GHU :LHGHUJDEH DXI SKRWRPHFKDQLVFKHP RGHU lkqolfkhp :HJH XQG GHU 6SHLFKHUXQJ LQ 'DWHQYHUDUEHLWXQJVDQODJHQ EOHLEHQ DXFK EHL QXU DXV]XJVZHLVHU 9HUZHQGXQJ YRUEHKDOWHQ &RS\ULJKW +HUEHUW 8W] 9HUODJ *PE+,6%1 3ULQWHG LQ *HUPDQ\ +HUEHUW 8W] 9HUODJ *PE+ 0 QFKHQ 7HO )D[

3 Vorwort 'HUHQRUPHXQGVWHWLJZDFKVHQGH3UHLV/HLVWXQJVYRUWHLOYRQPLNURHOHNWURQLVFKVWDWWNRQYHQWLR QHOOHOHNWURPHFKDQLVFKJHVWHXHUWHU3URGXNWHI KUW]XUHLQHUSHUPDQHQWHQ9HUODJHUXQJGHU3UR GXNWIXQNWLRQDOLWlWLQ5LFKWXQJ6RIWZDUHGLHVLFKEHUHLWVKHXWHLP0DVFKLQHQXQG$QODJHQEDX GHU$XWRPDWLVLHUXQJVXQG3URGXNWLRQVWHFKQLNXQGGHU9HUNHKUVWHFKQLN]XHLQHU6FKO VVHOWHFK QRORJLH HQWZLFNHOW KDW%HL VROFKHQ 3URGXNWHQ PDFKW GLH HLQJHEHWWHWH 6RIWZDUH HLQHQ ZHVHQWOL FKHQ:HUWVFK SIXQJVDQWHLODXVXQGEHVWLPPW]XQHKPHQGGHQ.XQGHQQXW]HQ 1LFKW QXU GLH )XQNWLRQDOLWlW DXFK GLH.RVWHQ VROFKHU 3URGXNWH KDEHQ VLFK YRQ GHU 0HFKDQLN XQG(OHNWULN VWDUNLQ5LFKWXQJ0LNURHOHNWURQLNXQG6RIWZDUHYHUODJHUW%HLVSLHOVZHLVHOLHJWGHU $QWHLOGHU(OHNWURQLNLQGHU$XWRPRELOLQGXVWULH]ZLVFKHQ²(LQHQRFKVWlUNHUH9HUODJH UXQJ LVW LP %HUHLFK GHU.OHLQVHULH XQG 8QLNDWH ]X HUNHQQHQ ZR GLH 6RIWZDUH (QWZLFNOXQJVNRVWHQ GRPLQLHUHQ 9RQ GHQ (QWZLFNOXQJVDXIZHQGXQJHQ I U QHXH 3URGXNWH LP %HUHLFKGHV0DVFKLQHQEDXVIDOOHQELV]XDXIGLHGDULQHQWKDOWHQH6RIWZDUH,QHLQLJHQWHFK QLVFKHQ3URGXNWHQGHV0DVFKLQHQXQG$QODJHQEDXVHUUHLFKWVLHVRJDU$QWHLOHYRQ²GHU +HUVWHOOXQJVNRVWHQ6RIWZDUHLVWQLFKWQXU]XHLQHP,QQRYDWLRQVWUHLEHUVRQGHUQDXFK]XHLQHP HQWVFKHLGHQGHQ:LUWVFKDIWVIDNWRUJHZRUGHQ 'LHVHU WHFKQRORJLVFKH 'UXFN ]ZLQJW YLHOH 8QWHUQHKPHQ LKUH 3URGXNWHQWZLFNOXQJ UDGLNDO ]X lqghuqghqqglh]xqhkphqgh)xqnwlrqdolwlwlqwhooljhqwhu3urgxnwhlqghqhq6riwzduhhlqjhehw WHWLVWI KUW]XVWHLJHQGHU.RPSOH[LWlWXQGKRKHU)OH[LELOLWlWQLFKWQXUGHU3URGXNWHVHOEVWVRQ GHUQDXFKGHU(QWZLFNOXQJVSUR]HVVH'XUFKGLHHUZHLWHUWHQ)UHLKHLWVJUDGHVROFKHUHLQJHEHWWHWHU 6\VWHPH LVW HV P JOLFK HUKHEOLFK VFKQHOOHU XQG NRVWHQJ QVWLJHU DXI VLFK XQHUZDUWHW lqghuqgh $QIRUGHUXQJHQGHV0DUNWHVUHDJLHUHQ]XN QQHQ'LH(QWZLFNOXQJVSUR]HVVHZHUGHQVRPLW]X QHKPHQG]XHLQHPZHWWEHZHUEVEHVWLPPHQGHQ)DNWRU9RUGHP+LQWHUJUXQGGDVVEHUHLWVKHXWH 6RIWZDUH HLQH.HUQNRPSRQHQWH YRQ LQQRYDWLYHQ 3URGXNWHQ GDUVWHOOW KDW GHUHQ 4XDOLWlW HLQHQ HQWVFKHLGHQGHQ(LQIOXVVDXIGLH4XDOLWlWGHV*HVDPWSURGXNWV) UGHXWVFKH.08ZLUGGDPLWGLH %HKHUUVFKXQJ TXDOLWlWVVLFKHUQGHU (QWZLFNOXQJVSUR]HVVH HLQJHEHWWHWHU 6RIWZDUH OHEHQVHUKDOWHQG ]XU6LFKHUXQJHLQHVEHVWlQGLJHQZLUWVFKDIWOLFKHQ(UIROJV 'DVYRUOLHJHQGH'RNXPHQWHQWVWDQGLP5DKPHQGHV')$03URMHNWV)86,0 (VJLEWHLQHQhEHU EOLFN EHUGLH4XDOLWlWVVLFKHUXQJ46YRQHLQJHEHWWHWHU6RIWZDUH'DEHLZHUGHQQHEHQHLQHP TXDOLWlWVRULHQWLHUWHQ 6\VWHP9RUJHKHQVPRGHOO XQG GHP $EODXI GHV 7HVWSUR]HVVHV GHU 7HVWIDOO (QWZXUI 7HVWZHUN]HXJH (PXODWRUHQ VRZLH 4XDOLWlWVVLFKHUXQJVPD QDKPHQ EHVFKULHEHQ,P $QKDQJILQGHQVLFK46'RNXPHQWHGHU,QGXVWULHSDUWQHU9RUODJHQXQG&KHFNOLVWHQ]XU4XDOL WlWVVLFKHUXQJ*UXQGODJHI UGLHYRUOLHJHQGH6\VWHPDWLVLHUXQJGHU4XDOLWlWVVLFKHUXQJYRQHLQJH EHWWHWHU6RIWZDUHVWHOOWHQGLH%HVWDQGVDXIQDKPHEHLGHQ8QWHUQHKPHQXQG/LWHUDWXUTXHOOHQGDU 3URI%HQGHU JHI UGHUWYRP$,)$,)1U')$01U

4

5 Inhaltsverzeichnis Inhaltsverzeichnis 1 Einleitung Problemstellung Zielsetzung Aufbau des Handbuchs QSorientiertes SystemVorgehensmodell Vollständiges SystemVorgehensmodell Teilmodelle Iterative, inkrementelle Entwicklung von eingebetteter Software Der Testprozess Phasenplan Testdokumente Testwerkzeuge und Emulatoren Testwerkzeuge Klassifizierungsschema Übersicht Testwerkzeuge Auswahlverfahren und Bewertung von Werkzeugen InCircuitEmulatoren TestfallEntwurf Problemstellung Klassischer TestfallEntwurf Effizienter TestfallEntwurf TestdatenErmittlung mit der Klassifikationsbaummethode Spezifikation des Testablaufs mit erweiterten Message Sequence Charts Ausblick QSMaßnahmen im Vorgehensmodell Einführung in QSMaßnahmen Einordnung von QSMaßnahmen in den Entwicklungsprozess Best Practises Bestandsaufnahme bei den Projektpartnern Einleitung Softwareprojekte Entwicklungsvorgehen , itm I

6 Inhaltsverzeichnis 7.4 Testprozess Bewertung von Testwerkzeugen aus industrieller Sicht Unternehmen Unternehmen Unternehmen Anforderungen an eine entwicklungsbegleitende Testumgebung Unternehmen Unternehmen Unternehmen Unternehmen BestPractices Problemfelder Wünsche bezüglich des Handbuchs Anhang A Werkzeugübersicht 63 A.1 Testwerkzeuge A.1.1 ATTOL Coverage 63 A.1.2 ATTOL SystemTest 63 A.1.3 ATTOL UniTest 63 A.1.4 C++Test 64 A.1.5 CaliberRBT 64 A.1.6 Cantata 64 A.1.7 CCover 65 A.1.8 CodeTest 65 A.1.9 CodeWizard 65 A.1.10 CTB 65 A.1.11 IDAS TESTAT for C 66 A.1.12 LDRA Testbed 66 A.1.13 LOGISCOPE 66 A.1.14 McCabe QA 67 A.1.15 McCabe Test 67 A.1.16 MessageMaster 68 A.1.17 PClint 68 A.1.18 QA C 68 A.1.19 QADirector 69 A.1.20 Rational PureCoverage 69 A.1.21 TestDirector 69 A.1.22 TestExpert 70 A.1.23 TestQuest 70 II 2001, itm

7 Inhaltsverzeichnis A.1.24 TestRunner 70 A.1.25 TestWorks/TCAT C/C++ 71 A.1.26 Validator/Req 71 A.2 Emulatoren A.2.1 Applied Microsystems 72 A.2.2 Archimedes Software 72 A.2.3 Ashling Mikrosysteme 72 A.2.4 Ceibo Germany 73 A.2.5 Hitex 73 A.2.6 Kleinhenz 73 A.2.7 Lauterbach 74 A.2.8 MetaLink 74 A.2.9 Microtek 75 A.2.10 Nohau Elektronik 75 A.2.11 Phyton 75 A.2.12 Signum 76 A.2.13 WindRiver 76 Anhang B Qualitätssicherungsmaßnahmen 77 B.1 Konstruktive Qualitätssicherung B.2 Analytische Qualitätssicherung B.2.1 Statische Analyse 77 B.2.2 Programmverifikation 78 B.2.3 Review / Audit 79 B.2.4 Inspektion 80 B.2.5 Walkthrough 80 B.2.6 Dynamischer Test 81 B.2.7 Symbolischer Test 83 B.2.8 Schreibtischtest 84 Anhang C Dokumente der Projektpartner 85 C.1 Lenze Formblatt Review SWSpezifikation C.2 Lenze: Formblatt SWProgramminspektion Fehlerbeseitigung C.3 Lenze: Formblatt SWProgramminspektion SystemtestTestcases C.4 Lenze: Formblatt SWProgramminspektion C.5 Lenze: Formblatt SWReview Manuelle Systemtests C.6 Lenze: Formblatt Systemtes C.7 Lenze: Formblatt Testplan C.8 Lenze: SWImplementierungsrichtlinien , itm III

8 Inhaltsverzeichnis C.9 Lenze: Typprüfung C.10 Programmierrichtlinien C.11 Programmierrichtlinien II C.12 Prüfvorschriften und protokoll für den Typtest C.13 Review.Checklisten C.14 SWEntwicklungshandbuch (Entwurf) C.15 Test der CompilerUmsetzung C.16 Testplan für den Systemtest C.17 Testspezifikation C.18 Vorlage ReviewProtokoll C.19 Vorlage Testplan C.20 Vorlage Testspezifikation C.21 Vorlage VersuchsauftragVersuchsdurchführung C.22 Vorlage Versuchsplan C.23 Vorlage Versuchsterminplan Anhang D Weitergehende Dokumente 105 D.1 QSDokumente im VModell D.1.1 QSPlan 105 D.1.2 Prüfplan 106 D.1.3 Prüfspezifikation 108 D.1.4 Prüfprozedur 113 D.1.5 Prüfprotokoll 114 D.2 IEEE Standard for Software Test Documentation (IEEE ) D.2.1 Test Documentation (Overview) 116 D.2.2 Test Documentation 116 D.3 IEEE Guide for Software Quallty Assurance Planning D.4 Regeln für die Implementierung D.4.1 Regeln für die Kodierung 124 D.4.2 Regeln und Einschränkungen im Sprachumfang für die Sprache C 124 D.4.3 Programmierleitfaden für die Assemblerprogrammierung 125 D.5 NISTIR 4906 SQAssurance: Documentation and Reviews D.5.1 The Review Process 127 D.5.2 Checklists for Formal Reviews 129 D.6 IEEE Guide to Software Requirements Specifications (SRS) D.7 Software Development Checklists (from Construx Software) D.7.1 Requirements Checklist 141 D.7.2 Design 142 IV 2001, itm

9 Inhaltsverzeichnis D.7.3 Construction 143 D.7.4 QualityAssurance Checklist 156 D.7.5 Effective Inspections 156 D.7.6 Test Cases 157 Anhang E Literaturverzeichnis 159 Anhang F Glossar 163 Anhang G Abbildungen 169 Anhang H Tabellen , itm V

10

11 1 Einleitung 1 Einleitung %HVRQGHUH 0HUNPDOH LQWHOOLJHQWHU 3URGXNWH GHU $XWRPDWLVLHUXQJVWHFKQLN (LQJHEHWWHWH 6\VWHPH VLQG GLH.RPELQDWLRQYHUVFKLHGHQHUWHFKQLVFKHU'LV]LSOLQHQ0HFKDQLN3QHXPDWLN+\GUDXOLN(OHNW ULN(OHNWURQLNXQG,QIRUPDWLRQVWHFKQLNGDV(FKW]HLWYHUKDOWHQGLHHQJH.RSSOXQJ]XPWHFKQL VFKHQ3UR]HVVVRZLHGLH9LHO]DKOXQWHUVFKLHGOLFKHU.RPPXQLNDWLRQVX3UR]HVVVFKQLWWVWHOOHQ Bedienung Hardware eingebette Software Hardware Mechanik technischer Prozess Kommunikation Abbildung 1 : Intelligentes Produkt (Eingebettetes System),Q GLHVHQ 3URGXNWHQ HUIROJW HLQH SHUPDQHQWH 9HUODJHUXQJ GHU 3URGXNWIXQNWLRQDOLWlW XQG (QW ZLFNOXQJVNRVWHQLQ5LFKWXQJ6RIWZDUH'LHVHVRJHQDQQWHHLQJHEHWWHWH6RIWZDUHPDFKWHLQHQZHVHQW OLFKHQ:HUWVFK SIXQJVDQWHLODXVXQGEHVWLPPWGHQ.XQGHQQXW]HQ$OV.HUQNRPSRQHQWHHLQJH EHWWHWHU6\VWHPHKDWVLHHLQHQHQWVFKHLGHQGHQ(LQIOXVVDXIGLH4XDOLWlWGHV*HVDPWSURGXNWV>+D UGHXWVFKH.08ZLUGGDPLWGLH%HKHUUVFKXQJTXDOLWlWVVLFKHUQ GHU(QWZLFNOXQJVSUR]HVVHI UGLHHLQJHEHWWHWH6RIWZDUHOHEHQVHUKDOWHQG]XU6LFKHUXQJHLQHVEH VWlQGLJHQ ZLUWVFKDIWOLFKHQ (UIROJV GHQQ GLH ]XQHKPHQGH )XQNWLRQDOLWlW LQWHOOLJHQWHU 3URGXNWH I KUW]XVWHLJHQGHU.RPSOH[LWlWXQGKRKHU)OH[LELOLWlWGHU3URGXNWHVRZLHGHU(QWZLFNOXQJVSUR GH0D 1.1 Problemstellung 2EZRKO GLH PHLVWHQ 8QWHUQHKPHQ HLQ GHILQLHUWHV E]Z VWDQGDUGLVLHUWHV 9RUJHKHQVPRGHOO 4XDOL WlWVPDQDJHPHQWV\VWHP I U GLH (QWZLFNOXQJ WHFKQLVFKHU 6\VWHPH EHVLW]HQ JHEHQ GLH GRUW EH VFKULHEHQHQ (QWZLFNOXQJVSUR]HVVH YRUQHKPOLFK GLH 0HFKDQLN E]Z 0DVFKLQHQEDXHUVLFKW DXI GDV3URGXNWZLHGHU'DV6RIWZDUHHQWZLFNOXQJV9RUJHKHQZLUGPHLVWDX HU$FKWJHODVVHQE]Z QXUVHKUJUREEHVFKULHEHQ'LH)ROJHLVWGDVVHVNHLQHV\VWHPDWLVFKH3ODQXQJXQG'XUFKI KUXQJ YRQ4XDOLWlWVPD QDKPHQ EHUDOOH(QWZLFNOXQJVSKDVHQKLQZHJJLEW 'HU(QWZLFNOXQJVSUR]HVVHLQHVWHFKQLVFKHQ6\VWHPVGXUFKOlXIWDXVGHP%OLFNZLQNHOGHU6WHXHUXQJ W\SLVFKHUZHLVH GLH 3KDVHQ.RQVWUXNWLRQ 6WHXHUXQJVSURMHNWLHUXQJ (OHNWURNRQVWUXNWLRQ )HUWL JXQJ 0RQWDJHXQG6WHXHUXQJVWHVW,QEHWULHEQDKPH$EELOGXQJ'LH]HLWOLFKH$EIROJHGHU 2001, itm 1

12 1 Einleitung Mechanikkonstruktion Steuerungsprojektierung Fertigung und Montage Abbildung 2: Entwicklungsvorgehen technischer Systeme Steuerungstest Inbetriebnahme :HQQ DXFK GLH 0HWKRGHQ GHU 6RIWZDUHHQWZLFNOXQJ KHXWH VFKRQ ZHLW IRUWJHVFKULWWHQ VLQG VR EHU FNVLFKWLJHQVLHLP$OOJHPHLQHQQXUVHOWHQGLHLQWHFKQLVFKHQ6\VWHPHQYRUKDQGHQH,QIRUPD WLRQVWHFKQLN XQG QRFK ZHQLJHU E]Z JDU QLFKW GLH PHFKDQLVFKHQ.RPSRQHQWHQ RGHU JDU GHQ WHFKQLVFKHQ3UR]HVVZHOFKHQPDQPLWGHP6\VWHPUHDOLVLHUHQP FKWH 'HP JHJHQ EHU ODVVHQ VLFK HWDEOLHUWH 9RUJHKHQVZHLVHQ UHLQHU 6RIWZDUH6\VWHPH MHGRFK QLFKW HLQIDFK DXI GLH HLQJHEHWWHWH 6RIWZDUH EHUWUDJHQ 'DV 9RUKDQGHQVHLQ YRQ GUHL.RPSRQHQWHQ 6RIWZDUH +DUGZDUH XQG*HUlWHPHFKDQLNHUIRUGHUWHLQLQWHUGLV]LSOLQlUHV(QWZLFNOXQJVWHDPXQG GDV H[SORUDWLYH (QWZLFNHOQ GHU 6RIWZDUH 'DEHL ZLUG GLH HLQJHEHWWHWH 6RIWZDUH DOV GHU IOH[LEHOVWH 3DUWYHUVWDQGHQGHUVLFKGHQ*HJHEHQKHLWHQLP*HVDPWSURMHNWXQHLQJHVFKUlQNWDQSDVVHQPXVV :HLWHUKLQH[LVWLHUHQ8QWHUVFKLHGHEHLP7HVWXQG,QEHWULHEQDKPHWHFKQLVFKHU6\VWHPH%HLGHU HLQJHEHWWHWHQ 6RIWZDUH OLHJHQ YLHOH )HKOHU LP =HLWYHUKDOWHQ XQG LP =XVDPPHQVSLHO ]ZLVFKHQ 6RIWZDUH +DUGZDUH XQG 0HFKDQLN 'DV (FKW]HLWYHUKDOWHQ GLH 1HEHQOlXILJNHLW XQG GLH HQJH.RSSOXQJPLWGHPWHFKQLVFKHQ3UR]HVVHUVFKZHUHQGLH0HVVEDUNHLWXQG%HREDFKWEDUNHLW2KQH GDVIHUWLJH$XWRPDWLVLHUXQJVV\VWHPLVWGLHHLQJHEHWWHWH6RIWZDUHQXUHLQJHVFKUlQNWWHVWEDU =XGHPNRPPWGDVVGDV:LVVHQXQGGLH)HUWLJNHLWHQI UGHQNRQVWUXNWLYHQ$QWHLOGHU6RIWZDUH HQWZLFNOXQJHLQHV8QWHUQHKPHQVZHVHQWOLFKDXVJHSUlJWHUXQGYHUEUHLWHWHUVLQGDOV]XP%HLVSLHO I UGHQ7HVWXQGGLH,QEHWULHEQDKPH(UVFKZHUHQGNRPPWKLQ]XGDVV]XPHLQHQVSH]LHOOI U HLQJHEHWWHWH6\VWHPH/ VXQJHQIHKOHQZRJHHLJQHWH0HWKRGHQXQG:HUN]HXJHEHZHUWHWZHUGHQ 'DGLH6SDQQZHLWHGHU3URMHNWXQG3URGXNWDQIRUGHUXQJHQVHKUJUR LVWPDFKWGLH(PSIHKOXQJ HLQHVDOOJHPHLQHQ9RUJHKHQVPRGHOOVZHQLJ6LQQHGRFKIHKOWGHQ.08RIWGLH0LWWHOXQG5HV VRXUFHQXPVHOEHUGLH$QSDVVXQJDQLKUHEHVRQGHUHQ%HG UIQLVVHYRU]XQHKPHQ 'HPJHJHQ EHUVWHLJWPLWGHUVWlQGLJHQ)XQNWLRQVYHUODJHUXQJLQ5LFKWXQJ6RIWZDUHDXFKGHUHQ.RPSOH[LWlW'DGXUFKQLPPWGLH4XDOLWlWGHU6RIWZDUHHLQH]HQWUDOH6WHOOXQJLQGHU3URGXNWHQW ZLFNOXQJHLQ8PGLHVLFKGDUDXVHUJHEHQGHQ+HUDXVIRUGHUXQJHQ]XEHZlOWLJHQXQGGLH5LVLNHQ ]XPLQGHUQEHGDUIHVHLQHV9RUJHKHQVPRGHOOVGDVVGHQ(QWZLFNOXQJVSUR]HVVDXV6RIWZDUHVLFKW EHVFKUHLEWXQGKLOIWTXDOLWlWVVLFKHUQGYRU]XJHKHQ 1.2 Zielsetzung 'DV+DQGEXFKJLEWHLQHQhEHUEOLFN EHUGLH4XDOLWlWVVLFKHUXQJYRQ6RIWZDUH'DEHLZLUGDXV GHU/LWHUDWXUXQGGHQÅ%HVW3UDFWLFHV GHU8QWHUQHKPHQHLQ9RUJHKHQVPRGHOOYRUJHVWHOOWLQ GHP]XMHGHU463KDVHGLHP JOLFKHQ0HWKRGHQXQG:HUN]HXJH]XJHRUGQHWZHUGHQ,QVEHVRQ GHUH LVW HLQ V\VWHPDWLVFKHU 7HVWSUR]HVV LQ VHLQHQ (LQ]HOWHLOHQ GRNXPHQWLHUW +LHU LVW DXFK HLQH EHUVLFKWOLFKH%HZHUWXQJGHU0HWKRGHQXQG:HUN]HXJHZLHGHU]XILQGHQ , itm

13 System Ebene IT Ebene System SW Ebene System Anforderungsanalys Informationstechni Anforderungsanalys System Mechanikrungsanalys IT Hardwarerungsanalys Anforderungsanalys Software Software Grobentwur Software Software Software Mechanik IT Systemtes ITIntegration Test Hardware Software Systemtes Softwareund Test SystemIntegration und QSZiel e u. Richtlinien o. Test vorb er e Test obj Testumge vor berei Testumge Projekthand Pr ojektp Spezifi ka Testp lan Risikodurc hf üh TestZiele Testdu rchfü Testobjekte Testumge defini er Testpl (Endvers Testu mgebu objekt Testsequenz/ aus wäh Test ergebnis spei c h Testpl (Ers tvers Testmethoden kri t eri e n Testprozedur Test proz Testfall Test erge bnis Test auswe Testergebnis filter Testergebnis aus wer Ress our c en Ri chtl ini en u. fes tl eg Zeit plan Test fälle Test Testobj stimulie Test daten Testfä impl ementi Testfä (Implementie Testprot Legen Aktivit Obje Dokumenti des (z. B. C h ec k 1 Einleitung qualitätsorientiertes Vorgehensmodell Testprozess Testwerkzeuge und (Emulatoren) Qualitätssicherungs Maßnahmen Abbildung 3: Zielsetzung 'DV9RUJHKHQVPRGHOOZHOFKHVGLHTXDOLWlWVGRPLQDQWH6WHOOXQJGHU6RIWZDUHEHU FNVLFKWLJWKLOIWLQ HLQHPLQWHUGLV]LSOLQlUHQ7HDPGLHHLJHQHQ(QWZLFNOXQJVSUR]HVVH]XRUGQHQXQG]XVWUXNWXULHUHQ.ODVVLVFKH9HUIDKUHQGHV7HVWIDOOHQWZXUIVHUI OOHQGLH$QIRUGHUXQJHQGHU3UD[LVKLQVLFKWOLFKGHU (IIL]LHQ] GHU JUDSKLVFKHQ 'DUVWHOOXQJ XQG +DQGKDEEDUNHLW EHL XPIDQJUHLFKHQ 7HVWSUREOHPHQ QLFKW ]XIULHGHQVWHOOHQG 'DV KLHU YRUJHVWHOOWH.RQ]HSW I U GHQ 7HVWIDOO(QWZXUI EDVLHUW DXI GHU.ODVVLILNDWLRQVEDXP0HWKRGH]XU7HVWGDWHQ(UPLWWOXQJXQGHLQHUHUZHLWHUWHQ%HVFKUHLEXQJYRQ 0HVVVDJH 6HTXHQFH &KDUWV 06& I U GLH 7HVWDEODXI%HVFKUHLEXQJ 7HVWZHUN]HXJH XQG 46 0D QDKPHQNODVVLIL]LHUWXQGEHZHUWHWVWHOOHQHEHQIDOOVHLQHZLFKWLJH+LOIHEHLGHU$XVZDKOI U GDVHLJHQH8QWHUQHKPHQ'LH]DKOUHLFKHQ'RNXPHQWHXQG9RUODJHQ]XU4XDOLWlWVVLFKHUXQJGLHVLFKEHL GHQ 3URMHNWSDUWQHUQ EHZlKUW KDEHQ N QQHQ DXIZDQGVDUP LQ GLH HLJHQHQ +DQGE FKHU EHU QRPPHQZHUGHQ 1.3 Aufbau des Handbuchs,P.DSLWHOZLUGHLQDOOJHPHLQHV6\VWHP9RUJHKHQVPRGHOOEHVFKULHEHQLQGHUGLH4XDOLWlWVVL FKHUXQJVDVSHNWHYRQ6RIWZDUHLP9RUGHUJUXQGVWHKHQ'DGLH9HUEHVVHUXQJGHV7HVWPHWKRGLN XQGV\VWHPDWLNLP0LWWHOSXQNWGHV3URMHNWHV)86,0VWHKWHUIROJWHLQH6WUXNWXULHUXQJXQGGH WDLOOLHUWH%HVFKUHLEXQJHLQHV7HVWSUR]HVVHVLQ.DSLWHO$XIEDXHQGGD]XZLUGLP.DSLWHODXI 7HVWZHUN]HXJH XQG,Q&LUFXLW(PXODWRUHQ HLQJHJDQJHQ 1HEHQ GHU.ODVVLILNDWLRQ XQG $QJDEH EHU9HUIDKUHQ]XU$XVZDKOXQG%HZHUWXQJLVWKLHUDXFKHLQHhEHUVLFKW EHUJlQJLJH7HVWZHUN ]HXJHXQG(PXODWRUHQ]XILQGHQ.DSLWHOEHVFKUHLEWGHQ7HVWIDOO(QWZXUIPLW+LOIHGHU.RP ELQDWLRQ DXV GHU.ODVVLILNDWLRQVEDXPPHWKRGH XQG HUZHLWHUWHQ 0HVVDJH6HTXHQFH&KDUWV 'LH )UDJHZHOFKH4XDOLWlWVVLFKHUXQJV0D QDKPHLQZHOFKHU(QWZLFNOXQJVSKDVHHUIROJHQNDQQZLUG LQ.DSLWHOEHKDQGHOW+LHUZHUGHQ460D QDKPHQNXU]EHVFKULHEHQ²DXVI KUOLFKH%HVFKUHL EXQJ XQG %HZHUWXQJ $QKDQJ % ² XQG LQ GDV 9RUJHKHQVPRGHOO HLQJHRUGQHW $EJHVFKORVVHQ ZLUGPLWGHQ(UJHEQLVVHQGHU%HVWDQGVDXIQDKPHEHLGHQ)86,03URMHNWSDUWQHUQ.DSLWHO,QGHQ$QKlQJHQVLQG%HVFKUHLEXQJHQXQG9RUODJHQZLHGHU]XILQGHQ$QKDQJ$HQWKlOWQHEHQ HLQHU.XU]EHVFKUHLEXQJGHU:HUN]HXJHDXFKGLH.RQWDNWDGUHVVHXPZHLWHUJHKHQGHUH,QIRUPD WLRQHQ]X HUKDOWHQ'LH 4XDOLWlWVVLFKHUXQJVPD QDKPHQ VLQG LP $QKDQJ% QDFKGHQ*HVLFKWV SXQNWHQ(LQRUGQXQJ=LHO3U IREMHNWXQGEHQ WLJWH8QWHUODJHQ9RUJHKHQVZHLVHQ%HZHUWXQJ XQGZHLWHUJHKHQGH,QIRUPDWLRQHQEHVFKULHEHQ$QKDQJ&ZLHGHUXPEHLQKDOWHW'RNXPHQWHXQG 9RUODJHQGHU3URMHNWSDUWQHUGLHYHUDOOJHPHLQHUWXQGZHLWJHKHQGDQRQ\PLVLHUWZXUGHQ:HLWHU JHKHQGH'RNXPHQWHZLH46'RNXPHQWHGHV90RGHOOVRGHUGHU,(((,PSOHPHQWLHUXQJVUH JHOQXQG&KHFNOLVWHQEHILQGHQVLFKLP$QKDQJ' 2001, itm 3

Microsoft Exchange Server 2003 EXS2003A. Autor: Dr. Hendrik Siegmund. Überarbeitete Ausgabe vom 10. August 2006

Microsoft Exchange Server 2003 EXS2003A. Autor: Dr. Hendrik Siegmund. Überarbeitete Ausgabe vom 10. August 2006 EXS2003A Autor: Dr. Hendrik Siegmund Überarbeitete Ausgabe vom 10. August 2006 by HERDT-Verlag für Bildungsmedien GmbH, Bodenheim Microsoft Exchange Server 2003 Administration Internet: www.herdt4you.de/.at/.ch

Mehr

)DNXOWlW;9,,I U*HRZLVVHQVFKDIWHQGHU5XKU8QLYHUVLWlW%RFKXP (LQ,QWHUQHW'HVWLQDWLRQVLQIRUPDWLRQVV\VWHP ]XU0DUNWNRPPXQLNDWLRQLP7RXULVPXVPDUNHWLQJ *UXQGODJHQ.RQ]HSWLRQXQGH[HPSODULVFKH5HDOLVLHUXQJ PLWHLQHU:HE*,66RIWZDUH

Mehr

%YXSV.ÚVKIR)RKIQERR -RLEPXPMGLIW0IOXSVEX)PQEV*YGLW F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, 7]WXIQEHQMRMWXVEXMSR

%YXSV.ÚVKIR)RKIQERR -RLEPXPMGLIW0IOXSVEX)PQEV*YGLW F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, 7]WXIQEHQMRMWXVEXMSR 27% %YXSV.ÚVKIR)RKIQERR -RLEPXPMGLIW0IOXSVEX)PQEV*YGLW %YJPEKIZSQ2SZIQFIV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, &SHIRLIMQ -RXIVRIX[[[LIVHX]SYHIEXGL [[[LIVHXFYWMRIWWHIEXGL [[[LIVHXZLWHIEX %PPI 6IGLXI ZSVFILEPXIR

Mehr

%YXSV;SPJKERK1YWGLRIV -RLEPXPMGLIW0IOXSVEX7MPOI/ERIW %YXSQEXMWMIVYRK4VSKVEQQMIVYRK F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF,

%YXSV;SPJKERK1YWGLRIV -RLEPXPMGLIW0IOXSVEX7MPOI/ERIW %YXSQEXMWMIVYRK4VSKVEQQMIVYRK F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, ;;4 %YXSV;SPJKERK1YWGLRIV -RLEPXPMGLIW0IOXSVEX7MPOI/ERIW %YJPEKIZSQ.ERYEV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, &SHIRLIMQ -RXIVRIX[[[LIVHX]SYHIEXGL [[[LIVHXFYWMRIWWHIEXGL [[[LIVHXZLWHIEX %PPI 6IGLXI ZSVFILEPXIR

Mehr

Microsoft Windows Server 2003 W2003SPS. Autoren: Michael Raith, Dr. Hendrik Siegmund. Überarbeitete Ausgabe vom 10. August 2006.

Microsoft Windows Server 2003 W2003SPS. Autoren: Michael Raith, Dr. Hendrik Siegmund. Überarbeitete Ausgabe vom 10. August 2006. W2003SPS Autoren: Michael Raith, Dr. Hendrik Siegmund Microsoft Windows Server 2003 Überarbeitete Ausgabe vom 10. August 2006 by HERDT-Verlag für Bildungsmedien GmbH, Bodenheim Support: Server Internet:

Mehr

Barbara Hofmann THE BEAUTY TOOLS COMPANY. BEAUTY TOOLS and Make-up Guide

Barbara Hofmann THE BEAUTY TOOLS COMPANY. BEAUTY TOOLS and Make-up Guide Barbara Hofmann THE BEAUTY TOOLS COMPANY BEAUTY TOOLS and Make-up Guide Liebe Barbara Hofmann Kundin, lieber Barbara Hofmann Kunde, wir haben uns lange Gedanken darüber gemacht, wie wir Sie noch besser

Mehr

%YXSV6SPERH&EYGL F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, %HQMRMWXVEXMSR

%YXSV6SPERH&EYGL F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, %HQMRMWXVEXMSR --7 %YXSV6SPERH&EYGL %YJPEKIZSQ2SZIQFIV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, &SHIRLIMQ -RXIVRIX[[[LIVHX]SYHIEXGL [[[LIVHXFYWMRIWWHIEXGL [[[LIVHXZLWHIEX %PPI 6IGLXI ZSVFILEPXIR /IMR 8IMP HIW ;IVOIW HEVJ MR

Mehr

%YXSV1MGLEIP6EMXL %YJPEKIZSQ7ITXIQFIV %HQMRMWXVEXMSR F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF,

%YXSV1MGLEIP6EMXL %YJPEKIZSQ7ITXIQFIV %HQMRMWXVEXMSR F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, -7%% %YXSV1MGLEIP6EMXL %YJPEKIZSQ7ITXIQFIV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, &SHIRLIMQ -RXIVRIX[[[LIVHX]SYHIEXGL [[[LIVHXFYWMRIWWHIEXGL [[[LIVHXZLWHIEX %PPI 6IGLXI ZSVFILEPXIR /IMR 8IMP HIW ;IVOIW HEVJ

Mehr

%YXSVMRRIR&EVFEVE,MVWGL[EPH%RHVIE7GL[EV^ F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF,

%YXSVMRRIR&EVFEVE,MVWGL[EPH%RHVIE7GL[EV^ F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, //-28-) %YXSVMRRIR&EVFEVE,MVWGL[EPH%RHVIE7GL[EV^ %YJPEKIZSQ2SZIQFIV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, &SHIRLIMQ -RXIVRIX[[[LIVHX]SYHIEXGL [[[LIVHXFYWMRIWWHIEXGL [[[LIVHXZLWHIEX %PPI 6IGLXI ZSVFILEPXIR

Mehr

&6%5$66 &RPSDFW3&,:LGH8OWUD6&6,+RVWDGDSWHU &6%5$66 $QRUGQXQJ6WHFNYHUELQGHU

&6%5$66 &RPSDFW3&,:LGH8OWUD6&6,+RVWDGDSWHU &6%5$66 $QRUGQXQJ6WHFNYHUELQGHU 3URGXNWLQIRUPDWLRQ 6%5$66 RPSDFW3, Š :LGH8OWUD66,+RVWDGDSWHU Dokument Nr. 1756 Edition 03/2001 'HU6%5$66YRQ(.)LVWHLQXQLYHUVHOOHU DXIGHPRPSDFW3, Š 6WDQGDUGEDVLHUHQGHU :LGH8OWUD66,+RVWDGDSWHUJHHLJQHW]XP

Mehr

%YXSVMR8MRE;IKIRIV -RLEPXPMGLIW0IOXSVEX*VERO7GLEFIVX +VYRHPEKIR)(:QMX;MRHS[W YRH3JJMGI F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF,

%YXSVMR8MRE;IKIRIV -RLEPXPMGLIW0IOXSVEX*VERO7GLEFIVX +VYRHPEKIR)(:QMX;MRHS[W YRH3JJMGI F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, +3 %YXSVMR8MRE;IKIRIV -RLEPXPMGLIW0IOXSVEX*VERO7GLEFIVX %YJPEKIZSQ3OXSFIV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, &SHIRLIMQ -RXIVRIX[[[LIVHX]SYHIEX [[[LIVHXFYWMRIWWHIEX [[[LIVHXZLWHIEX %PPI 6IGLXI ZSVFILEPXIR

Mehr

WXPS. Windows XP Professional - Systembetreuer: Workstation WXPS 00-0-00-75-63. Autoren: Werner Hand, Dr. Hendrik Siegmund, Dr.

WXPS. Windows XP Professional - Systembetreuer: Workstation WXPS 00-0-00-75-63. Autoren: Werner Hand, Dr. Hendrik Siegmund, Dr. WXPS Windows XP Professional - Systembetreuer: Workstation WXPS 00-0-00-75-63 Autoren: Werner Hand, Dr. Hendrik Siegmund, Dr. Wolfram Titz 3. Auflage vom 14. Oktober 2004 by HERDT-Verlag für Bildungsmedien

Mehr

)'(0;7*4%8 %YXSVMR0MRHE=SVO -RLEPXPMGLIW0IOXSVEX&EVFEVE,MVWGL[EPH F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, -RXIVRIX[[[LIVHX]SYHIEX [[[LIVHXFYWMRIWWHIEX

)'(0;7*4%8 %YXSVMR0MRHE=SVO -RLEPXPMGLIW0IOXSVEX&EVFEVE,MVWGL[EPH F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, -RXIVRIX[[[LIVHX]SYHIEX [[[LIVHXFYWMRIWWHIEX )'(0;7*4%8 %YXSVMR0MRHE=SVO -RLEPXPMGLIW0IOXSVEX&EVFEVE,MVWGL[EPH %YJPEKIZSQ1EM F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, &SHIRLIMQ -RXIVRIX[[[LIVHX]SYHIEX [[[LIVHXFYWMRIWWHIEX [[[LIVHXZLWHIEX (EW )'(00SKS MWXIMRIIMRKIXVEKIRI

Mehr

%YXSV;SPJKERK7GLYP^'2-1'2) -RLEPXPMGLIW0IOXSVEX,ERW4IXIV.ELR'2-'2)1'7) F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, +VYRHPEKIRJÚV%R[IRHIV

%YXSV;SPJKERK7GLYP^'2-1'2) -RLEPXPMGLIW0IOXSVEX,ERW4IXIV.ELR'2-'2)1'7) F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, +VYRHPEKIRJÚV%R[IRHIV +; %YXSV;SPJKERK7GLYP^'2-1'2) -RLEPXPMGLIW0IOXSVEX,ERW4IXIV.ELR'2-'2)1'7) %YJPEKIZSQ2SZIQFIV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, &SHIRLIMQ -RXIVRIX[[[LIVHX]SYHIEXGL [[[LIVHXFYWMRIWWHIEXGL [[[LIVHXZLWHIEX

Mehr

%YXSV;SPJKERK7GLYP^'2-1'2) -RLEPXPMGLIW0IOXSVEX,ERW4IXIV.ELR'2-'2)1'7) %HQMRMWXVEXMSR F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF,

%YXSV;SPJKERK7GLYP^'2-1'2) -RLEPXPMGLIW0IOXSVEX,ERW4IXIV.ELR'2-'2)1'7) %HQMRMWXVEXMSR F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, 23%( %YXSV;SPJKERK7GLYP^'2-1'2) -RLEPXPMGLIW0IOXSVEX,ERW4IXIV.ELR'2-'2)1'7) %YJPEKIZSQ2SZIQFIV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, &SHIRLIMQ -RXIVRIX[[[LIVHX]SYHIEXGL [[[LIVHXFYWMRIWWHIEXGL [[[LIVHXZLWHIEX

Mehr

%YXSV4IXIV8VSTJ/EVPWVYLI +VYRHPEKIR'SQTYXIV%MHIH(IWMKR F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF,

%YXSV4IXIV8VSTJ/EVPWVYLI +VYRHPEKIR'SQTYXIV%MHIH(IWMKR F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, %' %YXSV4IXIV8VSTJ/EVPWVYLI %YJPEKIZSQ2SZIQFIV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, &SHIRLIMQ -RXIVRIX[[[LIVHX]SYHIEXGL [[[LIVHXFYWMRIWWHIEXGL [[[LIVHXZLWHIEX %PPI 6IGLXI ZSVFILEPXIR /IMR 8IMP HIW ;IVOIW

Mehr

&00 'DV3%6DUFKLYHDGGRQ5 GHU (LQNDXIVEHOHJH %HQXW]HUKDQGEXFK .RPSDWLEHO]X6$355HOHDVH 9HUVLRQ. 6WDQG0lU]

&00 'DV3%6DUFKLYHDGGRQ5 GHU (LQNDXIVEHOHJH %HQXW]HUKDQGEXFK .RPSDWLEHO]X6$355HOHDVH 9HUVLRQ. 6WDQG0lU] &00 'DV3%6DUFKLYHDGGRQ5 GHU (LQNDXIVEHOHJH %HQXW]HUKDQGEXFK.RPSDWLEHO]X6$355HOHDVH 9HUVLRQ 6WDQG0lU] &00'DV3%6DUFKLYHDGGRQGHU(LQNDXIVEHOHJH%HQXW]HUKDQGEXFK,QKDOW 9RUZRUW]XU9HUVLRQ 'DV3%6$UFKLYLHUXQJVNRQ]HSW

Mehr

Software- Qualitätssicherung

Software- Qualitätssicherung Ernest Wallmüller Software- Qualitätssicherung in der Praxis Carl Hanser Verlag München Wien IX 1 Software-Qualität und Software-Qualitätssicherung 1 1.1 Software Engineering und Software-Qualitätssicherung

Mehr

$XIHUVWHKXQJDOV*HLVWZHVHQRGHUPLWHLQHP. USHU"

$XIHUVWHKXQJDOV*HLVWZHVHQRGHUPLWHLQHP. USHU (LQOHLWXQJ $XIHUVWHKXQJDOV*HLVWZHVHQRGHUPLWHLQHP. USHU" Zeugen Jehovas lehren, dass Christus und die 144000 als Geistwesen auferstanden und in den Himmel gefahren sind. Die Erlösten auf der Erde bekommen

Mehr

Einlagensicherungssysteme Ökonomische Analyse unterschiedlicher institutioneller Ausgestaltungsformen

Einlagensicherungssysteme Ökonomische Analyse unterschiedlicher institutioneller Ausgestaltungsformen Einlagensicherungssysteme Ökonomische Analyse unterschiedlicher institutioneller Ausgestaltungsformen Dr. Ute Merbecks*/ Diplom-Kauffrau Gabriela Bauer-Behrschmidt** Diskussionsbeitrag Nr. 297 2000 * Wissenschaftliche

Mehr

%YXSVIR&EVFEVE,MVWGL[EPH;SPJ;MPG^IO -RLEPXPMGLIW0IOXSVEX*VERO7GLEFIVX %YJPEKIZSQ.ERYEV +VYRHPEKIR F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, &SHIRLIMQ

%YXSVIR&EVFEVE,MVWGL[EPH;SPJ;MPG^IO -RLEPXPMGLIW0IOXSVEX*VERO7GLEFIVX %YJPEKIZSQ.ERYEV +VYRHPEKIR F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, &SHIRLIMQ 30 %YXSVIR&EVFEVE,MVWGL[EPH;SPJ;MPG^IO -RLEPXPMGLIW0IOXSVEX*VERO7GLEFIVX %YJPEKIZSQ.ERYEV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, &SHIRLIMQ -RXIVRIX[[[LIVHXGSQ %PPI 6IGLXI ZSVFILEPXIR /IMR 8IMP HIW ;IVOIW HEVJ

Mehr

%YXSVMR8MRE;IKIRIV -RLEPXPMGLIW0IOXSVEX'LEVPSXXIZSR&VEYRWGL[IMK F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, +VYRHPEKIR

%YXSVMR8MRE;IKIRIV -RLEPXPMGLIW0IOXSVEX'LEVPSXXIZSR&VEYRWGL[IMK F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, +VYRHPEKIR 78; %YXSVMR8MRE;IKIRIV -RLEPXPMGLIW0IOXSVEX'LEVPSXXIZSR&VEYRWGL[IMK %YJPEKIZSQ2SZIQFIV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, &SHIRLIMQ -RXIVRIX[[[LIVHX]SYHIEXGL [[[LIVHXFYWMRIWWHIEXGL [[[LIVHXZLWHIEX %PPI

Mehr

%YXSV6EPJ/ÔLPIV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, +VYRHPEKIRHIV&MPHFIEVFIMXYRK JÚV;IF7IMXIR

%YXSV6EPJ/ÔLPIV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, +VYRHPEKIRHIV&MPHFIEVFIMXYRK JÚV;IF7IMXIR -6 %YXSV6EPJ/ÔLPIV %YJPEKIZSQ2SZIQFIV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, &SHIRLIMQ -RXIVRIX[[[LIVHX]SYHIEXGL [[[LIVHXFYWMRIWWHIEXGL [[[LIVHXZLWHIEX %PPI 6IGLXI ZSVFILEPXIR /IMR 8IMP HIW ;IVOIW HEVJ MR

Mehr

RUNDSCHREIBEN DIE STEUERBERATER

RUNDSCHREIBEN DIE STEUERBERATER DIE STEUERBERATER RUNDSCHREIBEN VOGELSTELLE R KAUFMANN Sehr geehrte Damen und Herren, Nichtanwendungserlasse hat das Bundesfinanzministerium in den letzten Jahren zwar seltener erlassen, aber im Fall der

Mehr

0-2 %YXSV1EVOYW*IMPRIV /SEYXSV%VRI&ÂYQPIV ºFIVEVFIMXIXI%YWKEFIZSQ.ERYEV 2IX^[IVOEHQMRMWXVEXMSR F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF,

0-2 %YXSV1EVOYW*IMPRIV /SEYXSV%VRI&ÂYQPIV ºFIVEVFIMXIXI%YWKEFIZSQ.ERYEV 2IX^[IVOEHQMRMWXVEXMSR F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, 0-2 %YXSV1EVOYW*IMPRIV /SEYXSV%VRI&ÂYQPIV ºFIVEVFIMXIXI%YWKEFIZSQ.ERYEV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, &SHIRLIMQ -RXIVRIX[[[LIVHX]SYHIEXGL [[[LIVHXFYWMRIWWHIEXGL [[[LIVHXZLWHIEX %PPI 6IGLXI ZSVFILEPXIR

Mehr

%YXSV4IXIV8IMGL -RLEPXPMGLIW0IOXSVEX&IEXI1ENIXWGLEO -RXIKVMIVXI0ÔWYRKIRQMX3JJMGI<4 F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF,

%YXSV4IXIV8IMGL -RLEPXPMGLIW0IOXSVEX&IEXI1ENIXWGLEO -RXIKVMIVXI0ÔWYRKIRQMX3JJMGI<4 F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, :&% %YXSV4IXIV8IMGL -RLEPXPMGLIW0IOXSVEX&IEXI1ENIXWGLEO %YJPEKIZSQ(I^IQFIV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, &SHIRLIMQ -RXIVRIX[[[LIVHX]SYHIEXGL [[[LIVHXFYWMRIWWHIEXGL [[[LIVHXZLWHIEX %PPI 6IGLXI ZSVFILEPXIR

Mehr

Wallmüller Software-Qualitätsmanagement in der Praxis

Wallmüller Software-Qualitätsmanagement in der Praxis Wallmüller Software-Qualitätsmanagement in der Praxis Mechatronik im Maschinenbau Technische Universität Darmstadt Prof. Dr.-Ing. Stephan Rinderknecht Petersenstraße 30 64287 Darmstadt Telefon: +49 61

Mehr

'LH:LHGHUNXQIW-HVX. Auferstehung der Gläubigen

'LH:LHGHUNXQIW-HVX. Auferstehung der Gläubigen (LQOHLWXQJ 'LH:LHGHUNXQIW-HVX Zeugen Jehovas glauben, dass die Wiederkunft Jesu schon stattgefunden hat, und zwar im Jahr 1914. Diese war nur für Zeugen Jehovas sichtbar (geistlich, nicht wirklich), nicht

Mehr

Anlage EÜR. Einnahmenüberschussrechnung nach 4 Abs. 3 EStG für das Kalenderjahr 2011 Beginn Ende

Anlage EÜR. Einnahmenüberschussrechnung nach 4 Abs. 3 EStG für das Kalenderjahr 2011 Beginn Ende 1 2 Name/Gesellschaft/Gemeinschaft/Körperschaft Vorname 2011 Anlage EÜR Bitte für jeden Betrieb eine gesonderte Anlage EÜR einreichen! 3 4 5 (Betriebs-)Steuernummer Einnahmenüberschussrechnung nach 4 Abs

Mehr

5. Anleihebedingungen und Garantie

5. Anleihebedingungen und Garantie 5. Anleihebedingungen und Garantie 5.1 Anleihebedingungen Anleihebedingungen (die "Anleihebedingungen") 1 1HQQEHWUDJXQG6WFNHOXQJ9HUEULHIXQJ9HUZDKUXQJhEHUWUDJEDUNHLW 1. Nennbetrag. Die Anleihe der SANHA

Mehr

VERNEHMLASSUNGSBERICHT DER REGIERUNG BETREFFEND DIE ABÄNDERUNG DES GESETZES ÜBER DAS URHEBERRECHT UND

VERNEHMLASSUNGSBERICHT DER REGIERUNG BETREFFEND DIE ABÄNDERUNG DES GESETZES ÜBER DAS URHEBERRECHT UND VERNEHMLASSUNGSBERICHT DER REGIERUNG BETREFFEND DIE ABÄNDERUNG DES GESETZES ÜBER DAS URHEBERRECHT UND VERWANDTE SCHUTZRECHTE (LGBL. 1999 NR. 160) (UMSETZUNG DER RICHTLINIE 2012/28/EU) Ministerium für Inneres,

Mehr

Inhalt. 1 Einführungsveranstaltung. 2 Qualität kompakt

Inhalt. 1 Einführungsveranstaltung. 2 Qualität kompakt Inhalt 1 Einführungsveranstaltung 1.1 Ziel der Veranstaltung Warum Qualität? Inhalt der Veranstaltung 1.2 Formaler Ablauf der Veranstaltung 1.3 Übungs- und Gruppeneinteilung 1.4 Bewertungskriterien mittels

Mehr

%YXSVIR.SEGLMQ4EPPQIV,IMOS7GLVÔHIV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, %HQMRMWXVEXMSR

%YXSVIR.SEGLMQ4EPPQIV,IMOS7GLVÔHIV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, %HQMRMWXVEXMSR %;7 %YXSVIR.SEGLMQ4EPPQIV,IMOS7GLVÔHIV %YJPEKIZSQ2SZIQFIV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, &SHIRLIMQ -RXIVRIX[[[LIVHX]SYHIEXGL [[[LIVHXFYWMRIWWHIEXGL [[[LIVHXZLWHIEX %PPI 6IGLXI ZSVFILEPXIR /IMR 8IMP

Mehr

Software-Qualitätsmanagement in der Praxis

Software-Qualitätsmanagement in der Praxis Software-Qualitätsmanagement in der Praxis Software-Qualität durch Führung und Verbesserung von Software-Prozessen Bearbeitet von Ernest Wallmüller 2., vollständig überarbeitete Auflage 2001. Buch. XII,

Mehr

Inhalt. Ariane Sommer. 1. Hollywood-Rawstyle. Karyn Calabrese. 2. Fit und vital mit 65. Judita Wignall. 3. Going Raw

Inhalt. Ariane Sommer. 1. Hollywood-Rawstyle. Karyn Calabrese. 2. Fit und vital mit 65. Judita Wignall. 3. Going Raw Inhalt 1. Hollywood-Rawstyle Ariane Sommer 6 2. Fit und vital mit 65 Karyn Calabrese 10 3. Going Raw Judita Wignall 14 4. 8. Erfurter Rohkosttag - diesj. Motto: mit Thomas Reinholz "Muskelaufbau mit Rohkost

Mehr

Agile Software-Entwicklung im Kontext der EN50128 Wege zum Erfolg

Agile Software-Entwicklung im Kontext der EN50128 Wege zum Erfolg Herzlich willkommen Agile Software-Entwicklung im Kontext der EN50128 Wege zum Erfolg Heike Bickert Software-/Systemingenieurin, Bereich Quality Management Braunschweig // 17.11.2015 1 Agenda ICS AG Fragestellungen

Mehr

Basiswissen Softwaretest

Basiswissen Softwaretest Andreas Spillner Tilo Linz Basiswissen Softwaretest Aus- und Weiterbildung zum Certified Tester Foundation Level nach ISTQB-Standard 3., überarbeitete und aktualisierte Auflage I Technische l'^vrau«! D~w.-iE*arit

Mehr

1.1 Basiswissen komprimiert... 4 1.2 Praxiswissen Testmanagement Übersicht... 8. 2 Testprozess und Testwerkzeuge 11

1.1 Basiswissen komprimiert... 4 1.2 Praxiswissen Testmanagement Übersicht... 8. 2 Testprozess und Testwerkzeuge 11 xi 1 Einleitung 1 1.1 Basiswissen komprimiert.......................... 4 1.2 Praxiswissen Testmanagement Übersicht.............. 8 2 Testprozess und Testwerkzeuge 11 2.1 Fundamentaler Testprozess.........................

Mehr

Viele, die die Offenbarung

Viele, die die Offenbarung t[.:«e[ U[œ «~U t Diese sind's, die gekommen sind aus der großen Trübsal und haben ihre Kleider gewaschen und haben ihre Kleider hell gemacht im Blut des Lammes. Darum sind sie vor dem Thron Gottes und

Mehr

Praxiswissen Softwaretest - Testmanagement

Praxiswissen Softwaretest - Testmanagement Praxiswissen Softwaretest - Testmanagement Aus- und Weiterbildung zum Certified Tester Advanced Level nach ISTQB-Standard dpunkt.verlag 1 Einleitung 1 1.1 Basiswissen - komprimiert 4 1.2 Praxiswissen Testmanagement

Mehr

Verständnis für die bei Mehrwertdiensten aktuell in vielerlei Hinsicht bestehende Rechtsunsicherheit vermag ein historischer Rückblick zu geben.

Verständnis für die bei Mehrwertdiensten aktuell in vielerlei Hinsicht bestehende Rechtsunsicherheit vermag ein historischer Rückblick zu geben. Rundfunk und Telekom Regulierungs-GmbH Schlichtungsstelle Mariahilfer Straße 77-79 A-1060 Wien Wien, 2. April 2002.RQVXOWDWLRQ]X.XQGHQEHVFKZHUGHQLP =XVDPPHQKDQJPLW0HKUZHUWGLHQVWHQ Sehr geehrte Damen und

Mehr

Einführung in das Software-Qualitätsmanagement

Einführung in das Software-Qualitätsmanagement Roland Petrasch Einführung in das Software-Qualitätsmanagement ^oyoc; 0 Einleitung 9 1 Qualitätsmanagement in der Software-Entwicklung 11 1.1 Entwicklung von Software-Produkten 11 1.1.1 Begriffsbestimmung

Mehr

6WXGLH]XUJOREDOHQ(QWZLFNOXQJ YRQ:LVVHQVFKDIWXQG7HFKQLN )UDXQKRIHU,QVWLWXWI U6\VWHPWHFKQLNXQG,QQRYDWLRQVIRUVFKXQJ,6,

6WXGLH]XUJOREDOHQ(QWZLFNOXQJ YRQ:LVVHQVFKDIWXQG7HFKQLN )UDXQKRIHU,QVWLWXWI U6\VWHPWHFKQLNXQG,QQRYDWLRQVIRUVFKXQJ,6, 1 'HOSKL8PIUDJH 6WXGLH]XUJOREDOHQ(QWZLFNOXQJ YRQ:LVVHQVFKDIWXQG7HFKQLN =XVDPPHQIDVVXQJGHU(UJHEQLVVH )UDXQKRIHU,QVWLWXWI U6\VWHPWHFKQLNXQG,QQRYDWLRQVIRUVFKXQJ,6, LP$XIWUDJGHV%XQGHVPLQLVWHULXPVI U%LOGXQJ:LVVHQVFKDIW)RUVFKXQJXQG

Mehr

ELTERNBRIEF. Berlin, Juli 2002 Nr. 64. Ein jegliches hat seine Zeit, und alles Vorhaben unter dem Himmel hat seine Stunde:

ELTERNBRIEF. Berlin, Juli 2002 Nr. 64. Ein jegliches hat seine Zeit, und alles Vorhaben unter dem Himmel hat seine Stunde: ELTERNBRIEF Berlin, Juli 2002 Nr. 64 Ein jegliches hat seine Zeit, und alles Vorhaben unter dem Himmel hat seine Stunde: geboren werden hat seine Zeit, sterben hat seine Zeit; weinen hat seine Zeit, lachen

Mehr

Qualitätssicherung. Was ist Qualität?

Qualitätssicherung. Was ist Qualität? Ein Überblick Methoden und Werkzeuge zur Softwareproduktion Was ist Qualität? "Als Qualität eines Gegenstandes bezeichnen wir die Gesamtheit seiner charakteristischen Eigenschaften" Hesse et al. 2 Was

Mehr

Kundeninformation. ÖKOMETRIC GmbH. ÖKOMETRIC GmbH Kontakt :Horst Rottler Bernecker Str. 17-21 D-95448 Bayreuth F rottler@oekometric.

Kundeninformation. ÖKOMETRIC GmbH. ÖKOMETRIC GmbH Kontakt :Horst Rottler Bernecker Str. 17-21 D-95448 Bayreuth F rottler@oekometric. ÖKOMERIC GmbH Kundeninformation 1HXH*UHQ]ZHUWHI U'LR[LQHXQGGLR[LQlKQOLFKH3&%LQ /HEHQVXQG)XWWHUPLWWHOQ $P)HEUXDUYHU IIHQWOLFKWHGLH(XURSlLVFKH.RPPLVVLRQHUZHLWHUWH*UHQ]ZHUWHI U 'LR[LQH3&''3&')XQGGLR[LQlKQOLFKH3&%LQ/HEHQVPLWWHOQ9(525'181*(*

Mehr

Verschenken oder vererben?

Verschenken oder vererben? Anwalts-u. Steuerkanzlei /W]RZ &ROOHJH 78199 BrŠunlingen Tel. 0771/9222-0 www.kanzlei-luetzow.de Verschenken oder vererben? )UGLH)UDJHREHVVLQQYROOHULVWHLQHQ7HLOVHLQHV9HUP JHQVEHUHLWV]X/HE]HLWHQ]X YHUVFKHQNHQ

Mehr

Inhalt. 1 Einleitung 1. 2 Grundkonzepte 11. 3 Erfahrungen systematisch nutzen 39

Inhalt. 1 Einleitung 1. 2 Grundkonzepte 11. 3 Erfahrungen systematisch nutzen 39 xi 1 Einleitung 1 1.1 Softwarequalität betrifft viele................................ 1 1.2 Für wen dieses Buch gemacht ist.............................. 1 1.3 Was Sie von diesem Buch erwarten können......................

Mehr

Standard Inhaltsverzeichnis für Testvorschrift

Standard Inhaltsverzeichnis für Testvorschrift Standard Inhaltsverzeichnis für Testvorschrift Inhaltsverzeichnis 1. Zweck, Veranlassung... 1 2. Allgemeines... 1 2.1 Zweck der Testvorschrift... 1 2.2 Freigabe und Änderungen... 1 2.3 Prinzipien... 2

Mehr

Software-Lebenszyklus

Software-Lebenszyklus Software-Lebenszyklus Inhalt Vorgehensmodell/Phasenplan Wasserfallmodell WAS-Beschreibung WIE-Beschreibung Weitere Phasenmodelle: Spiral-Modell, V-Modell, RUP Extreme Programming SW-Qualitätssicherung

Mehr

,$ -. "+0 *+*+ ! / -#$%$. #$%'' $ () 1 2$ #$%$! 1 2$3 )!

,$ -. +0 *+*+ ! / -#$%$. #$%'' $ () 1 2$ #$%$! 1 2$3 )! *+*+ *,$ -.! / -#$%$. #$%'' $ () "+0 *+*+ 4 *+*+ 1 2$ #$%$! 1 2$3 )! 1 *+*+ $& #$%'!' '!' 5 1! 1 4$5%! 1 63$ 1 $7$! 1 3! 1 77 8'7 1 /!$' 1 83% *+*+ 0 #$%'' '' #$%'' ''$' )%! $' #$% 5 87 $ 8$! 7$+ 1 #$%9$

Mehr

Peter Liggesmeyer. Software-Qualität. Testen, Analysieren und Verifizieren von Software. 2. Auflage. Spektrum k-/l AKADEMISCHER VERLAG

Peter Liggesmeyer. Software-Qualität. Testen, Analysieren und Verifizieren von Software. 2. Auflage. Spektrum k-/l AKADEMISCHER VERLAG Peter Liggesmeyer Software-Qualität Testen, Analysieren und Verifizieren von Software 2. Auflage Spektrum k-/l AKADEMISCHER VERLAG 1 Inhaltsverzeichnis 1 Einführung 1 1.1 Motivation 2 1.2 Terminologie

Mehr

Softwaretechnikpraktikum SS 2004. Qualitätsmanagement I. 1. Überblick. Qualität. Qualitätsmerkmal

Softwaretechnikpraktikum SS 2004. Qualitätsmanagement I. 1. Überblick. Qualität. Qualitätsmerkmal Softwaretechnikpraktikum SS 2004 Qualitätsmanagement I 5. Vorlesung 1. Überblick Planungsphase Definitionsphase Entwurfsphase Implem.- phase Fragen Was ist Qualität? Wie kann man Qualität messen? Wie kann

Mehr

9HUEUDXFKHUNUHGLWH)UDJHQXQG$QWZRUWHQ

9HUEUDXFKHUNUHGLWH)UDJHQXQG$QWZRUWHQ 0(02 Brüssel, den 14. November 2002 9HUEUDXFKHUNUHGLWH)UDJHQXQG$QWZRUWHQ 'LH(XURSlLVFKH.RPPLVVLRQKDWDP6HSWHPEHUHLQHQ9RUVFKODJI U HLQH QHXH 9HUEUDXFKHUNUHGLW5LFKWOLQLH DQJHQRPPHQ VLHKH,3 $XI GHU7DJXQJGHV5DWHV:HWWEHZHUEDP1RYHPEHUZHUGHQGLH0LQLVWHULQ

Mehr

Telekom-Control Österreichische Gesellschaft für Telekommunikationsregulierung mbh

Telekom-Control Österreichische Gesellschaft für Telekommunikationsregulierung mbh Telekom-Control Österreichische Gesellschaft für Telekommunikationsregulierung mbh Informationen zur Anzeige nach 6 Abs. 2 SigG betreffend die Anzeige durch Zertifizierungsdiensteanbieter, die keine qualifizierten

Mehr

Wenn Scrum auf CMMI trifft!

Wenn Scrum auf CMMI trifft! Wenn Scrum auf CMMI trifft! Best Practice kombiniert mit Agilen Methoden! &DSDELOLW\ 0DWXULW\ 0RGHO &DSDELOLW\ 0DWXULW\ 0RGHOLQJ &00 DQG &00, DUH UHJLVWHUHG LQ WKH 8 6 3DWHQW DQG 7UDGHPDUN 2IILFH E\ &DUQHJLH

Mehr

Architektur in der Mechatronik. existierender Testwerkzeuge

Architektur in der Mechatronik. existierender Testwerkzeuge Universelle Testsystem Architektur in der Mechatronik Ansatz zur Systematisierung Ansatz zur Systematisierung existierender Testwerkzeuge Gliederung Umfeld und Problemstellung Testsystem Architektur Funktionale

Mehr

Testmanagement bei SAP-Projekten

Testmanagement bei SAP-Projekten Testmanagement bei SAP-Projekten Erfolgreich Planen Steuern Reporten bei der Einführung von SAP-Banking von Alberto Vivenzio, Domenico Vivenzio 1. Auflage Springer Vieweg Wiesbaden 2012 Verlag C.H. Beck

Mehr

13 Anhang A: Erfüllung der Norm ISO 9000 durch HERMES

13 Anhang A: Erfüllung der Norm ISO 9000 durch HERMES 13 Anhang A: Erfüllung der Norm ISO 9000 durch Hinweis Einleitung Eine der wesentlichsten Grundlagen für die Qualitätssicherung in einem Unternehmen ist die Normenserie «ISO 9000», insbesondere ISO 9001:1994

Mehr

Brüssel, den 24. September 2002

Brüssel, den 24. September 2002 ,3 Brüssel, den 24. September 2002 /XIWIDKUWYHUVLFKHUXQJ QDFK GHP 6HSWHPEHU 'LH(XURSlLVFKH.RPPLVVLRQ VFKOlJW 0LQGHVW YHUVLFKHUXQJVDQIRUGHUXQJHQ I U DOOH /XIWIDKUW XQWHUQHKPHQPLW)OXJEHWULHELQ(XURSDYRU 1DFK

Mehr

T1 - Fundamentaler Testprozess

T1 - Fundamentaler Testprozess AK 2 am Armin Beer, Support Center Test der Software- Entwicklung 1 für einen erfolgreichen Test? Projektteam strebt nach Qualität Aufwände sind eingeplant (Richtwerte) 20 bis 30% des Gesamtaufwandes In

Mehr

Praxiswissen Softwaretest Test Analyst und Technical Test Analyst

Praxiswissen Softwaretest Test Analyst und Technical Test Analyst Graham Bath Judy McKay Praxiswissen Softwaretest Test Analyst und Technical Test Analyst Aus- und Weiterbildung zum Certified Tester - Advanced Level nach ISTQB-Standard 2., durchgesehene Auflage 2011

Mehr

S A X E N. Amtl. MITTEILUNGEN. 4. Advent- und Weihnachtsmar kt am 26. und 27. November 2005

S A X E N. Amtl. MITTEILUNGEN. 4. Advent- und Weihnachtsmar kt am 26. und 27. November 2005 An einen Haushalt 3RVWJHEKUEDUEH]DKOW Amtl. MITTEILUNGEN S A X E N D E R M A R K T G E M E I N D E Tel. 07269/355 Fax 355-20 www.saxen.at e-mail: gemeinde@saxen.at J ahr gang: 2005 ausgegeben am: 28.10.2005

Mehr

1.1 Basiswissen komprimiert... 4 1.2 Praxiswissen Testmanagement Übersicht... 8. 2 Fundamentaler Testprozess 11

1.1 Basiswissen komprimiert... 4 1.2 Praxiswissen Testmanagement Übersicht... 8. 2 Fundamentaler Testprozess 11 xiii 1 Einleitung 1 1.1 Basiswissen komprimiert.......................... 4 1.2 Praxiswissen Testmanagement Übersicht.............. 8 2 Fundamentaler Testprozess 11 2.1 Testplanung und -steuerung........................

Mehr

(Titel des Berichts)

(Titel des Berichts) (Titel des Berichts) Praxissemesterbericht von (Vorname Name) aus (Geburtsort) Matrikelnummer Anschrift Telefon HTW Aalen Hochschule für Technik und Wirtschaft Betreuender Professor Abgabetermin Angaben

Mehr

=XNXQIW GHU,PPRELOLHQVXFKH QXW]HQ 2QOLQH 3ODWWIRUPHQ ]X,PPR 6XFKH QXW]HQ =HLWXQJVLQVHUDWH SHUV QOLFKHQ.RQWDNW (UIROJVIDNWRU JUR H $XVZDKO DQ 2EMHNWHQ :LFKWLJVWHQ )DNWRUHQ VLQG *UR HV $QJHERW 8QNRPSOL]LHUWH

Mehr

T2 Fundamentaler Testprozess

T2 Fundamentaler Testprozess T2 Fundamentaler Siemens AG Österreich 2005 All Rights Reserved Institut f. Software Technology, TU-Graz Armin Beer, PSE Support-Center Test Overview der Software- Entwicklung 2 1 Wasserfall-Modell Analyse

Mehr

&KULVWRSK%XWWHUZHJJH +DUW]JHVWHUQ±+DUW]KHXWH.RQWLQXLWlWVOLQLHQXQG.RQVHTXHQ]HQHLQHU3ROLWLNJHJHQGHQ 6R]LDOVWDDW

&KULVWRSK%XWWHUZHJJH +DUW]JHVWHUQ±+DUW]KHXWH.RQWLQXLWlWVOLQLHQXQG.RQVHTXHQ]HQHLQHU3ROLWLNJHJHQGHQ 6R]LDOVWDDW &KULVWRSK%XWWHUZHJJH +DUW]JHVWHUQ±+DUW]KHXWH.RQWLQXLWlWVOLQLHQXQG.RQVHTXHQ]HQHLQHU3ROLWLNJHJHQGHQ 6R]LDOVWDDW Diskussionen über das Zweite SGB-II-Änderungsgesetz, das Hartz-IV- Fortentwicklungsgesetz und

Mehr

Praxiswissen Softwaretest Test Analyst und Technical Test Analyst

Praxiswissen Softwaretest Test Analyst und Technical Test Analyst isql-reihe Praxiswissen Softwaretest Test Analyst und Technical Test Analyst Aus- und Weiterbildung zum Certified Tester Advanced Level nach ISTQB-Standard von Graham Bath, Judy McKay 2., durchgesehene

Mehr

IV Software-Qualitätssicherung

IV Software-Qualitätssicherung Softwaretechnik- Praktikum: 12. Vorlesung Jun.-Prof Prof.. Dr. Holger Giese Raum E 3.165 Tel. 60-3321 Email: hg@upb.de Übersicht I II III IV V Einleitung Ergänzungen zur Software-Entwicklung Software Management

Mehr

Notwendigkeit der Testautomatisierung? Neue Ideen, Konzepte & Werkzeuge

Notwendigkeit der Testautomatisierung? Neue Ideen, Konzepte & Werkzeuge i.s.x. Software GmbH & Co. KG Notwendigkeit der Testautomatisierung? Neue Ideen, Konzepte & Werkzeuge i.s.x. Software GmbH & Co. KG Dresden, 19. Februar 2013 Karin Eisenblätter Die i.s.x. Software GmbH

Mehr

Praxiswissen Softwaretest - Testmanagement

Praxiswissen Softwaretest - Testmanagement Andreas Spillner Thomas Roßner Mario Winter Tilo Linz Praxiswissen Softwaretest - Testmanagement Aus- und Weiterbildung zum Certified Tester Advanced Level nach ISTQB-Standard 2., überarbeitete und aktualisierte

Mehr

9RUVFKODJ I U HLQH 5LFKWOLQLH EHU GLH

9RUVFKODJ I U HLQH 5LFKWOLQLH EHU GLH 0(02 Brüssel, 20. Februar 2002 9RUVFKODJ I U HLQH 5LFKWOLQLH EHU GLH 3DWHQWLHUEDUNHLW FRPSXWHULPSOHPHQWLHUWHU (UILQGXQJHQ (siehe auch IP/02/277) :DVVLQGGLH+DXSWSXQNWHGHV9RUVFKODJV" Eine Erfindung, die

Mehr

Surface Pro 3 Ihr Laptop Ersatz. Microsoft Surface Pro 3 128 GB Bundle

Surface Pro 3 Ihr Laptop Ersatz. Microsoft Surface Pro 3 128 GB Bundle Impuls 1-2015 Surface Pro 3 Ihr Laptop Ersatz. Microsoft Surface Pro 3 128 GB Bundle Microsoft Surface Docking Station Pro 3 Windows 8.1 Pro 30,5 cm (12") ClearType Full-HD-Plus Display Intel Core i5 Mobile

Mehr

K W W S Z Z Z I H O V H U G H

K W W S Z Z Z I H O V H U G H K W W S Z Z Z I H O V H U G H *ULOOHQHLQ3KlQRPHQ LVW*ULOOHQDXFKHLQUHFKWOLFKHV3UREOHP" Deutschland grillt gerne. Nach einer Telefonumfrage des Instituts für Projektmanagement im Auftrag der CMA und ZMP

Mehr

Sprachaufenthalte weltweit!

Sprachaufenthalte weltweit! Sprachaufenthalte weltweit! Sprachen lernen - Erfolg erleben Hotline 0848 75 75 75 INDIEN Goa 85 Indien Indien - Sprachaufenthalt im Land der Gegensätze Das Einzige, was man hier erwarten darf ist das

Mehr

Qualitätsmanagement. Andreas Bäuml SWT-Projekt 16.11.2007 WS 07/08

Qualitätsmanagement. Andreas Bäuml SWT-Projekt 16.11.2007 WS 07/08 Qualitätsmanagement Andreas Bäuml SWT-Projekt 16.11.2007 WS 07/08 Gliederung Gliederung: 1. Motivation 2. Qualitätsmanagement 3. Konstruktive Maßnahmen 4. Analytische Maßnahmen 5. Diskussion Projekt Softwaretechnik:

Mehr

Sprachaufenthalte weltweit!

Sprachaufenthalte weltweit! Englisch Französisch Spanisch Italienisch Portugiesisch Russisch Deutsch Chinesisch Japanisch Arabisch Türkisch Hindi Sprachaufenthalte weltweit! Sprachen lernen - Erfolg erleben www.linguista.ch Hotline

Mehr

,QKDOW $QUXIHQ $QUXISURWRNROO (LQVWHOOXQJHQ 2QOLQH'LHQVWH 1HXH1RWL] ,KU(ULFVVRQ5H 'RNXPHQWDWLRQ,QIRUPDWLRQHQXQG &RPPXQLFDWLRQV6XLWH&'

,QKDOW $QUXIHQ $QUXISURWRNROO (LQVWHOOXQJHQ 2QOLQH'LHQVWH 1HXH1RWL] ,KU(ULFVVRQ5H 'RNXPHQWDWLRQ,QIRUPDWLRQHQXQG &RPPXQLFDWLRQV6XLWH&' ,QKDOW (LQOHLWXQJ,KU(ULFVVRQ5H 'RNXPHQWDWLRQ,QIRUPDWLRQHQXQG &RPPXQLFDWLRQV6XLWH&' %HYRU6LHWHOHIRQLHUHQ &KHFNOLVWH %HWULHEVPRGL 'HU$NNX 'LH6,0.DUWH (LQXQG$XVVFKDOWHQ *HVFKORVVHQH.ODSSH *H IIQHWH.ODSSH

Mehr

Senior Consulting. Senior Consulting Strategical, Conceptual and Technical Consulting. 30.01.2011 Seite 1

Senior Consulting. Senior Consulting Strategical, Conceptual and Technical Consulting. 30.01.2011 Seite 1 30.01.2011 Seite 1 This flyer is exclusively for the use of client personnel. No part of it may be distributed, quoted or reproduced outside the client organisation without the prior written approval of

Mehr

Requirements-Management Ein praktisches Beispiel

Requirements-Management Ein praktisches Beispiel 2003 Eurocopter Deutschland GmbH 2003 Requirements-Management Ein praktisches Beispiel a.s.drexler@t-online.de Softwareprozesse in Luft- und Raumfahrtprojekten Workshop der DGLR am 15.10.2003 Der Vortrag

Mehr

Testmanagement in IT-Projekten

Testmanagement in IT-Projekten Teil 1: Projektmagazin 05/20009 Teil 2: Projektmagazin 06/2009 1 Test: Prozess, bei dem ein Programm oder ein Software-System ausgeführt wird, um Fehler zu finden Teil 1: Projektmagazin 05/20009 Teil 2:

Mehr

%LQQHQPDUNWDQ]HLJHU )RUWVFKULWWH EHL GHU 8PVHW]XQJDEHUDXFKYLHOH9HUWUDJVYHUOHW]XQJHQ

%LQQHQPDUNWDQ]HLJHU )RUWVFKULWWH EHL GHU 8PVHW]XQJDEHUDXFKYLHOH9HUWUDJVYHUOHW]XQJHQ ,3 Brüssel, 19. November 2001 %LQQHQPDUNWDQ]HLJHU )RUWVFKULWWH EHL GHU 8PVHW]XQJDEHUDXFKYLHOH9HUWUDJVYHUOHW]XQJHQ 'HU 3UR]HQWVDW] GHU QRFK QLFKW LQ QDWLRQDOHV 5HFKW XPJHVHW]WHQ %LQQHQPDUNWULFKWOLQLHQ GDV

Mehr

MyProcess AG Kurzprofil

MyProcess AG Kurzprofil MyProcess AG Kurzprofil MyProcess AG, Lachen, CH-8853, Schweiz Positionierung Die MyProcess AG hat Kernkompetenzen auf allen wesentlichen Gebieten der Software-Entwicklung auf Basis neuer Technologien.

Mehr

Werkzeugunterstützte Verknüpfung von Anforderungen und Tests Voraussetzung für eine systematische Qualitätssicherung

Werkzeugunterstützte Verknüpfung von Anforderungen und Tests Voraussetzung für eine systematische Qualitätssicherung Werkzeugunterstützte Verknüpfung von Anforderungen und Tests Voraussetzung für eine systematische Qualitätssicherung Dr. Sadegh Sadeghipour sadegh.sadeghipour@itpower.de Meike Lim meike.lim@itpower.de

Mehr

23 Prävention in NRW. Fußball in der Schule

23 Prävention in NRW. Fußball in der Schule 23 Prävention in NRW Fußball in der Schule Prävention in NRW 23 Fußball in der Schule Liebe Leserin, lieber Leser die Sprache macht es uns oft nicht leicht, weibliche und männliche Formen gut lesbar in

Mehr

)h5(,1(,1)250$7,216*(6(//6&+$)7,1'(56&+:(,=

)h5(,1(,1)250$7,216*(6(//6&+$)7,1'(56&+:(,= %HULFKWGHU*URXSHGH5pIOH[LRQ )h5(,1(,1)250$7,216*(6(//6&+$)7,1'(56&+:(,= ]XKDQGHQGHV6FKZHL]HULVFKHQ%XQGHVUDWHV -XQL 2 0LWJOLHGHUGHU*URXSHGH5pIOH[LRQ Vorsitz: %HDW.DSSHOHU, Aspiwaldweg 22, 3037 Herrenschwanden;

Mehr

.XUDWRULXPMXQJHUGHXWVFKHU)LOP

.XUDWRULXPMXQJHUGHXWVFKHU)LOP .XUDWRULXPMXQJHUGHXWVFKHU)LOP ÖFFENTLICHE STIFTUNG Kuratorium junger deutscher Film Postfach 120428 65082 Wiesbaden 3UHVVHPLWWHLOXQJ 65203 Wiesbaden, den 25.11.2005 Schloß Biebrich Rheingaustraße 140 Telefon:

Mehr

Systemen - Testprozess. Testprozess. Testprozess: Aktivitäten. Testplanung und Teststeuerung. Testplanung und Teststeuerung

Systemen - Testprozess. Testprozess. Testprozess: Aktivitäten. Testplanung und Teststeuerung. Testplanung und Teststeuerung 2007 Dr. Klaudia Dussa-Zieger P r a k t I s c h e Testprozess - Inhalt Testprozess Testen von Software-Systemen Systemen - Testprozess Lehrplan 2003 Testplanung Testausführung ierung Testendebewertung

Mehr

6LFKHUKHLW YRQ 1DKUXQJVHUJlQ]XQJHQ.RPPLVVDU %\UQHEHJU WSROLWLVFKH(LQLJXQJLP5DW

6LFKHUKHLW YRQ 1DKUXQJVHUJlQ]XQJHQ.RPPLVVDU %\UQHEHJU WSROLWLVFKH(LQLJXQJLP5DW ,3 Brüssel, 27. September 2001 6LFKHUKHLW YRQ 1DKUXQJVHUJlQ]XQJHQ.RPPLVVDU %\UQHEHJU WSROLWLVFKH(LQLJXQJLP5DW.RPPLVVDU'DYLG%\UQHHUNOlUWHVLFKKHXWH]XIULHGHQGDU EHUGDVVGHU5DW HLQH SROLWLVFKH (LQLJXQJ EHU

Mehr

Block R (Rahmen): SE Aktivitäten 21.10.04 2. Vorlesung Methoden des Software Engineering. Block R Rahmen Aktivitäten der Software-Entwicklung

Block R (Rahmen): SE Aktivitäten 21.10.04 2. Vorlesung Methoden des Software Engineering. Block R Rahmen Aktivitäten der Software-Entwicklung Block R (Rahmen): SE Aktivitäten 21.10.04 1 Vorlesung Methoden des Software Engineering Block R Rahmen Aktivitäten der Software-Entwicklung Martin Wirsing Einheit R.2, 21.10.2004 Block R (Rahmen): SE Aktivitäten

Mehr

Systemen - Testprozess. Testprozess. Testprozess: Aktivitäten. Testplanung und Teststeuerung. Lehrplan 2003 Testplanung

Systemen - Testprozess. Testprozess. Testprozess: Aktivitäten. Testplanung und Teststeuerung. Lehrplan 2003 Testplanung P r a k t I s c h e Testprozess - Inhalt Testprozess Testen von Software-Systemen Systemen - Testprozess Lehrplan 2003 Testplanung Testausführung ierung Testendebewertung Testberichterstattung Lehrplan

Mehr

GESAMTBEURTEILUNG UND EMPFEHLUNGEN

GESAMTBEURTEILUNG UND EMPFEHLUNGEN *HVDPWEHXUWHLOXQJXQG(PSIHKOXQJHQ 'LHZLFKWLJVWHQ+HUDXVIRUGHUXQJHQODXWHQ 6LFKHUXQJHLQHVKRKHQ:LUWVFKDIWVZDFKVWXPV Nach einer längeren Phase der Stagnation in den ersten Jahren dieses Jahrzehnts hat Deutschland

Mehr

$XWRUHQÃ5LFKDUGÃ5RWKÃ-RKDQQHVÃ6FKHXULQJÃ 0LWÃ*HQHKPLJXQJÃGHUÃ&RPSHQGLRÃ%LOGXQJVPHGLHQÃ$*Ã &+= ULFKÃ Ã&RPSHQGLRÃ%LOGXQJVPHGLHQÃ$*Ã&+= ULFKÃÃ

$XWRUHQÃ5LFKDUGÃ5RWKÃ-RKDQQHVÃ6FKHXULQJÃ 0LWÃ*HQHKPLJXQJÃGHUÃ&RPSHQGLRÃ%LOGXQJVPHGLHQÃ$*Ã &+= ULFKÃ Ã&RPSHQGLRÃ%LOGXQJVPHGLHQÃ$*Ã&+= ULFKÃÃ ,&7 $XIODJHYRP'H]HPEHU $XWRUHQ5LFKDUG5RWK-RKDQQHV6FKHXULQJ 0LW*HQHKPLJXQJGHU&RPSHQGLR%LOGXQJVPHGLHQ$* &+= ULFK &RPSHQGLR%LOGXQJVPHGLHQ$*&+= ULFK +HUDXVJHEHU+(5'79HUODJI U%LOGXQJVPHGLHQ*PE+ %RGHQKHLP,QWHUQHWZZZKHUGWFRP

Mehr

Software Engineering mit Übungen. Franz-Josef Elmer, Universität Basel, HS 2015

Software Engineering mit Übungen. Franz-Josef Elmer, Universität Basel, HS 2015 Software Engineering mit Übungen Franz-Josef Elmer, Universität Basel, HS 2015 Software Engineering 2 Organisation Ort: Seminarraum 05.002, Spiegelgasse 5 Ablauf: 15:15 Vorlesung Prüfung: Schriftlich,

Mehr

Programmiersprache kann WEKA auf vielen Bertriebs- wird kostenlos unter der GNU General Public License

Programmiersprache kann WEKA auf vielen Bertriebs- wird kostenlos unter der GNU General Public License 5.3 WEKA 3.6.3 Beispiele für letztere Variante sind die in den mayato Data Mining Studien 2009 bzw. 2010 getesteten 5.3.1 Grundkonzept, neue Funktionen und Erweiterungen Open-Source-Suiten RapidMiner und

Mehr

EBS-Lehrgang. Allgemeines. EBS (EPB) im Motorwagen. EBS im Kraftomnibus. ESC Elektron. Stabilitätsregelung. T-EBS im Anhängefahrzeug

EBS-Lehrgang. Allgemeines. EBS (EPB) im Motorwagen. EBS im Kraftomnibus. ESC Elektron. Stabilitätsregelung. T-EBS im Anhängefahrzeug Allgemeines 1 EBS-Lehrgang Ausgabe Oktober 2002 EBS (EPB) im Motorwagen EBS im Kraftomnibus 2 3 ESC Elektron. Stabilitätsregelung im Nutzfahrzeug 4 T-EBS im Anhängefahrzeug 5 Schutzgebühr 26,00 Nachdruck,

Mehr

6WDQGDUGYHUWUDJVNODXVHOQ I U GLH hehuplwwoxqj SHUVRQHQEH]RJHQHU 'DWHQ DQ 9HUDUEHLWHU LQ 'ULWWOlQGHUQ+lXILJ*HVWHOOWH)UDJHQ)$4

6WDQGDUGYHUWUDJVNODXVHOQ I U GLH hehuplwwoxqj SHUVRQHQEH]RJHQHU 'DWHQ DQ 9HUDUEHLWHU LQ 'ULWWOlQGHUQ+lXILJ*HVWHOOWH)UDJHQ)$4 0(02 Brüssel, 18. Juni 2001 6WDQGDUGYHUWUDJVNODXVHOQ I U GLH hehuplwwoxqj SHUVRQHQEH]RJHQHU 'DWHQ DQ 9HUDUEHLWHU LQ 'ULWWOlQGHUQ+lXILJ*HVWHOOWH)UDJHQ)$4 Gemäß der Richtlinie 95/46/EG zum Schutz natürlicher

Mehr