Embedded Quality. Qualitätssicherung eingebetteter Software: Methoden und Best-Practices

Größe: px
Ab Seite anzeigen:

Download "Embedded Quality. Qualitätssicherung eingebetteter Software: Methoden und Best-Practices"

Transkript

1 Embedded Quality Qualitätssicherung eingebetteter Software: Methoden und BestPractices FUSIM Prof. Dr.Ing. K. Bender, Dipl.Ing. P. Jack, Dipl.Ing. A. Koç, Dipl.Ing. I. Péter, Dipl.Ing. G. Megyeri Informationstechnik im Maschinenwesen, TU München

2 'LH 'HXWVFKH %LEOLRWKHN &,3(LQKHLWVDXIQDKPH (LQ 7LWHOGDWHQVDW] I U GLHVH 3XEOLNDWLRQ LVW EHL 'HU 'HXWVFKHQ %LEOLRWKHN HUKlOWOLFK 'LHVHV :HUN LVW XUKHEHUUHFKWOLFK JHVFK W]W 'LH GDGXUFK EHJU QGHWHQ 5HFKWH LQVEHVRQGHUH GLH GHU hehuvhw]xqj GHV 1DFKGUXFNV GHU (QWQDKPH YRQ $E ELOGXQJHQ GHU :LHGHUJDEH DXI SKRWRPHFKDQLVFKHP RGHU lkqolfkhp :HJH XQG GHU 6SHLFKHUXQJ LQ 'DWHQYHUDUEHLWXQJVDQODJHQ EOHLEHQ DXFK EHL QXU DXV]XJVZHLVHU 9HUZHQGXQJ YRUEHKDOWHQ &RS\ULJKW +HUEHUW 8W] 9HUODJ *PE+,6%1 3ULQWHG LQ *HUPDQ\ +HUEHUW 8W] 9HUODJ *PE+ 0 QFKHQ 7HO )D[

3 Vorwort 'HUHQRUPHXQGVWHWLJZDFKVHQGH3UHLV/HLVWXQJVYRUWHLOYRQPLNURHOHNWURQLVFKVWDWWNRQYHQWLR QHOOHOHNWURPHFKDQLVFKJHVWHXHUWHU3URGXNWHI KUW]XUHLQHUSHUPDQHQWHQ9HUODJHUXQJGHU3UR GXNWIXQNWLRQDOLWlWLQ5LFKWXQJ6RIWZDUHGLHVLFKEHUHLWVKHXWHLP0DVFKLQHQXQG$QODJHQEDX GHU$XWRPDWLVLHUXQJVXQG3URGXNWLRQVWHFKQLNXQGGHU9HUNHKUVWHFKQLN]XHLQHU6FKO VVHOWHFK QRORJLH HQWZLFNHOW KDW%HL VROFKHQ 3URGXNWHQ PDFKW GLH HLQJHEHWWHWH 6RIWZDUH HLQHQ ZHVHQWOL FKHQ:HUWVFK SIXQJVDQWHLODXVXQGEHVWLPPW]XQHKPHQGGHQ.XQGHQQXW]HQ 1LFKW QXU GLH )XQNWLRQDOLWlW DXFK GLH.RVWHQ VROFKHU 3URGXNWH KDEHQ VLFK YRQ GHU 0HFKDQLN XQG(OHNWULN VWDUNLQ5LFKWXQJ0LNURHOHNWURQLNXQG6RIWZDUHYHUODJHUW%HLVSLHOVZHLVHOLHJWGHU $QWHLOGHU(OHNWURQLNLQGHU$XWRPRELOLQGXVWULH]ZLVFKHQ²(LQHQRFKVWlUNHUH9HUODJH UXQJ LVW LP %HUHLFK GHU.OHLQVHULH XQG 8QLNDWH ]X HUNHQQHQ ZR GLH 6RIWZDUH (QWZLFNOXQJVNRVWHQ GRPLQLHUHQ 9RQ GHQ (QWZLFNOXQJVDXIZHQGXQJHQ I U QHXH 3URGXNWH LP %HUHLFKGHV0DVFKLQHQEDXVIDOOHQELV]XDXIGLHGDULQHQWKDOWHQH6RIWZDUH,QHLQLJHQWHFK QLVFKHQ3URGXNWHQGHV0DVFKLQHQXQG$QODJHQEDXVHUUHLFKWVLHVRJDU$QWHLOHYRQ²GHU +HUVWHOOXQJVNRVWHQ6RIWZDUHLVWQLFKWQXU]XHLQHP,QQRYDWLRQVWUHLEHUVRQGHUQDXFK]XHLQHP HQWVFKHLGHQGHQ:LUWVFKDIWVIDNWRUJHZRUGHQ 'LHVHU WHFKQRORJLVFKH 'UXFN ]ZLQJW YLHOH 8QWHUQHKPHQ LKUH 3URGXNWHQWZLFNOXQJ UDGLNDO ]X lqghuqghqqglh]xqhkphqgh)xqnwlrqdolwlwlqwhooljhqwhu3urgxnwhlqghqhq6riwzduhhlqjhehw WHWLVWI KUW]XVWHLJHQGHU.RPSOH[LWlWXQGKRKHU)OH[LELOLWlWQLFKWQXUGHU3URGXNWHVHOEVWVRQ GHUQDXFKGHU(QWZLFNOXQJVSUR]HVVH'XUFKGLHHUZHLWHUWHQ)UHLKHLWVJUDGHVROFKHUHLQJHEHWWHWHU 6\VWHPH LVW HV P JOLFK HUKHEOLFK VFKQHOOHU XQG NRVWHQJ QVWLJHU DXI VLFK XQHUZDUWHW lqghuqgh $QIRUGHUXQJHQGHV0DUNWHVUHDJLHUHQ]XN QQHQ'LH(QWZLFNOXQJVSUR]HVVHZHUGHQVRPLW]X QHKPHQG]XHLQHPZHWWEHZHUEVEHVWLPPHQGHQ)DNWRU9RUGHP+LQWHUJUXQGGDVVEHUHLWVKHXWH 6RIWZDUH HLQH.HUQNRPSRQHQWH YRQ LQQRYDWLYHQ 3URGXNWHQ GDUVWHOOW KDW GHUHQ 4XDOLWlW HLQHQ HQWVFKHLGHQGHQ(LQIOXVVDXIGLH4XDOLWlWGHV*HVDPWSURGXNWV) UGHXWVFKH.08ZLUGGDPLWGLH %HKHUUVFKXQJ TXDOLWlWVVLFKHUQGHU (QWZLFNOXQJVSUR]HVVH HLQJHEHWWHWHU 6RIWZDUH OHEHQVHUKDOWHQG ]XU6LFKHUXQJHLQHVEHVWlQGLJHQZLUWVFKDIWOLFKHQ(UIROJV 'DVYRUOLHJHQGH'RNXPHQWHQWVWDQGLP5DKPHQGHV')$03URMHNWV)86,0 (VJLEWHLQHQhEHU EOLFN EHUGLH4XDOLWlWVVLFKHUXQJ46YRQHLQJHEHWWHWHU6RIWZDUH'DEHLZHUGHQQHEHQHLQHP TXDOLWlWVRULHQWLHUWHQ 6\VWHP9RUJHKHQVPRGHOO XQG GHP $EODXI GHV 7HVWSUR]HVVHV GHU 7HVWIDOO (QWZXUI 7HVWZHUN]HXJH (PXODWRUHQ VRZLH 4XDOLWlWVVLFKHUXQJVPD QDKPHQ EHVFKULHEHQ,P $QKDQJILQGHQVLFK46'RNXPHQWHGHU,QGXVWULHSDUWQHU9RUODJHQXQG&KHFNOLVWHQ]XU4XDOL WlWVVLFKHUXQJ*UXQGODJHI UGLHYRUOLHJHQGH6\VWHPDWLVLHUXQJGHU4XDOLWlWVVLFKHUXQJYRQHLQJH EHWWHWHU6RIWZDUHVWHOOWHQGLH%HVWDQGVDXIQDKPHEHLGHQ8QWHUQHKPHQXQG/LWHUDWXUTXHOOHQGDU 3URI%HQGHU JHI UGHUWYRP$,)$,)1U')$01U

4

5 Inhaltsverzeichnis Inhaltsverzeichnis 1 Einleitung Problemstellung Zielsetzung Aufbau des Handbuchs QSorientiertes SystemVorgehensmodell Vollständiges SystemVorgehensmodell Teilmodelle Iterative, inkrementelle Entwicklung von eingebetteter Software Der Testprozess Phasenplan Testdokumente Testwerkzeuge und Emulatoren Testwerkzeuge Klassifizierungsschema Übersicht Testwerkzeuge Auswahlverfahren und Bewertung von Werkzeugen InCircuitEmulatoren TestfallEntwurf Problemstellung Klassischer TestfallEntwurf Effizienter TestfallEntwurf TestdatenErmittlung mit der Klassifikationsbaummethode Spezifikation des Testablaufs mit erweiterten Message Sequence Charts Ausblick QSMaßnahmen im Vorgehensmodell Einführung in QSMaßnahmen Einordnung von QSMaßnahmen in den Entwicklungsprozess Best Practises Bestandsaufnahme bei den Projektpartnern Einleitung Softwareprojekte Entwicklungsvorgehen , itm I

6 Inhaltsverzeichnis 7.4 Testprozess Bewertung von Testwerkzeugen aus industrieller Sicht Unternehmen Unternehmen Unternehmen Anforderungen an eine entwicklungsbegleitende Testumgebung Unternehmen Unternehmen Unternehmen Unternehmen BestPractices Problemfelder Wünsche bezüglich des Handbuchs Anhang A Werkzeugübersicht 63 A.1 Testwerkzeuge A.1.1 ATTOL Coverage 63 A.1.2 ATTOL SystemTest 63 A.1.3 ATTOL UniTest 63 A.1.4 C++Test 64 A.1.5 CaliberRBT 64 A.1.6 Cantata 64 A.1.7 CCover 65 A.1.8 CodeTest 65 A.1.9 CodeWizard 65 A.1.10 CTB 65 A.1.11 IDAS TESTAT for C 66 A.1.12 LDRA Testbed 66 A.1.13 LOGISCOPE 66 A.1.14 McCabe QA 67 A.1.15 McCabe Test 67 A.1.16 MessageMaster 68 A.1.17 PClint 68 A.1.18 QA C 68 A.1.19 QADirector 69 A.1.20 Rational PureCoverage 69 A.1.21 TestDirector 69 A.1.22 TestExpert 70 A.1.23 TestQuest 70 II 2001, itm

7 Inhaltsverzeichnis A.1.24 TestRunner 70 A.1.25 TestWorks/TCAT C/C++ 71 A.1.26 Validator/Req 71 A.2 Emulatoren A.2.1 Applied Microsystems 72 A.2.2 Archimedes Software 72 A.2.3 Ashling Mikrosysteme 72 A.2.4 Ceibo Germany 73 A.2.5 Hitex 73 A.2.6 Kleinhenz 73 A.2.7 Lauterbach 74 A.2.8 MetaLink 74 A.2.9 Microtek 75 A.2.10 Nohau Elektronik 75 A.2.11 Phyton 75 A.2.12 Signum 76 A.2.13 WindRiver 76 Anhang B Qualitätssicherungsmaßnahmen 77 B.1 Konstruktive Qualitätssicherung B.2 Analytische Qualitätssicherung B.2.1 Statische Analyse 77 B.2.2 Programmverifikation 78 B.2.3 Review / Audit 79 B.2.4 Inspektion 80 B.2.5 Walkthrough 80 B.2.6 Dynamischer Test 81 B.2.7 Symbolischer Test 83 B.2.8 Schreibtischtest 84 Anhang C Dokumente der Projektpartner 85 C.1 Lenze Formblatt Review SWSpezifikation C.2 Lenze: Formblatt SWProgramminspektion Fehlerbeseitigung C.3 Lenze: Formblatt SWProgramminspektion SystemtestTestcases C.4 Lenze: Formblatt SWProgramminspektion C.5 Lenze: Formblatt SWReview Manuelle Systemtests C.6 Lenze: Formblatt Systemtes C.7 Lenze: Formblatt Testplan C.8 Lenze: SWImplementierungsrichtlinien , itm III

8 Inhaltsverzeichnis C.9 Lenze: Typprüfung C.10 Programmierrichtlinien C.11 Programmierrichtlinien II C.12 Prüfvorschriften und protokoll für den Typtest C.13 Review.Checklisten C.14 SWEntwicklungshandbuch (Entwurf) C.15 Test der CompilerUmsetzung C.16 Testplan für den Systemtest C.17 Testspezifikation C.18 Vorlage ReviewProtokoll C.19 Vorlage Testplan C.20 Vorlage Testspezifikation C.21 Vorlage VersuchsauftragVersuchsdurchführung C.22 Vorlage Versuchsplan C.23 Vorlage Versuchsterminplan Anhang D Weitergehende Dokumente 105 D.1 QSDokumente im VModell D.1.1 QSPlan 105 D.1.2 Prüfplan 106 D.1.3 Prüfspezifikation 108 D.1.4 Prüfprozedur 113 D.1.5 Prüfprotokoll 114 D.2 IEEE Standard for Software Test Documentation (IEEE ) D.2.1 Test Documentation (Overview) 116 D.2.2 Test Documentation 116 D.3 IEEE Guide for Software Quallty Assurance Planning D.4 Regeln für die Implementierung D.4.1 Regeln für die Kodierung 124 D.4.2 Regeln und Einschränkungen im Sprachumfang für die Sprache C 124 D.4.3 Programmierleitfaden für die Assemblerprogrammierung 125 D.5 NISTIR 4906 SQAssurance: Documentation and Reviews D.5.1 The Review Process 127 D.5.2 Checklists for Formal Reviews 129 D.6 IEEE Guide to Software Requirements Specifications (SRS) D.7 Software Development Checklists (from Construx Software) D.7.1 Requirements Checklist 141 D.7.2 Design 142 IV 2001, itm

9 Inhaltsverzeichnis D.7.3 Construction 143 D.7.4 QualityAssurance Checklist 156 D.7.5 Effective Inspections 156 D.7.6 Test Cases 157 Anhang E Literaturverzeichnis 159 Anhang F Glossar 163 Anhang G Abbildungen 169 Anhang H Tabellen , itm V

10

11 1 Einleitung 1 Einleitung %HVRQGHUH 0HUNPDOH LQWHOOLJHQWHU 3URGXNWH GHU $XWRPDWLVLHUXQJVWHFKQLN (LQJHEHWWHWH 6\VWHPH VLQG GLH.RPELQDWLRQYHUVFKLHGHQHUWHFKQLVFKHU'LV]LSOLQHQ0HFKDQLN3QHXPDWLN+\GUDXOLN(OHNW ULN(OHNWURQLNXQG,QIRUPDWLRQVWHFKQLNGDV(FKW]HLWYHUKDOWHQGLHHQJH.RSSOXQJ]XPWHFKQL VFKHQ3UR]HVVVRZLHGLH9LHO]DKOXQWHUVFKLHGOLFKHU.RPPXQLNDWLRQVX3UR]HVVVFKQLWWVWHOOHQ Bedienung Hardware eingebette Software Hardware Mechanik technischer Prozess Kommunikation Abbildung 1 : Intelligentes Produkt (Eingebettetes System),Q GLHVHQ 3URGXNWHQ HUIROJW HLQH SHUPDQHQWH 9HUODJHUXQJ GHU 3URGXNWIXQNWLRQDOLWlW XQG (QW ZLFNOXQJVNRVWHQLQ5LFKWXQJ6RIWZDUH'LHVHVRJHQDQQWHHLQJHEHWWHWH6RIWZDUHPDFKWHLQHQZHVHQW OLFKHQ:HUWVFK SIXQJVDQWHLODXVXQGEHVWLPPWGHQ.XQGHQQXW]HQ$OV.HUQNRPSRQHQWHHLQJH EHWWHWHU6\VWHPHKDWVLHHLQHQHQWVFKHLGHQGHQ(LQIOXVVDXIGLH4XDOLWlWGHV*HVDPWSURGXNWV>+D UGHXWVFKH.08ZLUGGDPLWGLH%HKHUUVFKXQJTXDOLWlWVVLFKHUQ GHU(QWZLFNOXQJVSUR]HVVHI UGLHHLQJHEHWWHWH6RIWZDUHOHEHQVHUKDOWHQG]XU6LFKHUXQJHLQHVEH VWlQGLJHQ ZLUWVFKDIWOLFKHQ (UIROJV GHQQ GLH ]XQHKPHQGH )XQNWLRQDOLWlW LQWHOOLJHQWHU 3URGXNWH I KUW]XVWHLJHQGHU.RPSOH[LWlWXQGKRKHU)OH[LELOLWlWGHU3URGXNWHVRZLHGHU(QWZLFNOXQJVSUR GH0D 1.1 Problemstellung 2EZRKO GLH PHLVWHQ 8QWHUQHKPHQ HLQ GHILQLHUWHV E]Z VWDQGDUGLVLHUWHV 9RUJHKHQVPRGHOO 4XDOL WlWVPDQDJHPHQWV\VWHP I U GLH (QWZLFNOXQJ WHFKQLVFKHU 6\VWHPH EHVLW]HQ JHEHQ GLH GRUW EH VFKULHEHQHQ (QWZLFNOXQJVSUR]HVVH YRUQHKPOLFK GLH 0HFKDQLN E]Z 0DVFKLQHQEDXHUVLFKW DXI GDV3URGXNWZLHGHU'DV6RIWZDUHHQWZLFNOXQJV9RUJHKHQZLUGPHLVWDX HU$FKWJHODVVHQE]Z QXUVHKUJUREEHVFKULHEHQ'LH)ROJHLVWGDVVHVNHLQHV\VWHPDWLVFKH3ODQXQJXQG'XUFKI KUXQJ YRQ4XDOLWlWVPD QDKPHQ EHUDOOH(QWZLFNOXQJVSKDVHQKLQZHJJLEW 'HU(QWZLFNOXQJVSUR]HVVHLQHVWHFKQLVFKHQ6\VWHPVGXUFKOlXIWDXVGHP%OLFNZLQNHOGHU6WHXHUXQJ W\SLVFKHUZHLVH GLH 3KDVHQ.RQVWUXNWLRQ 6WHXHUXQJVSURMHNWLHUXQJ (OHNWURNRQVWUXNWLRQ )HUWL JXQJ 0RQWDJHXQG6WHXHUXQJVWHVW,QEHWULHEQDKPH$EELOGXQJ'LH]HLWOLFKH$EIROJHGHU 2001, itm 1

12 1 Einleitung Mechanikkonstruktion Steuerungsprojektierung Fertigung und Montage Abbildung 2: Entwicklungsvorgehen technischer Systeme Steuerungstest Inbetriebnahme :HQQ DXFK GLH 0HWKRGHQ GHU 6RIWZDUHHQWZLFNOXQJ KHXWH VFKRQ ZHLW IRUWJHVFKULWWHQ VLQG VR EHU FNVLFKWLJHQVLHLP$OOJHPHLQHQQXUVHOWHQGLHLQWHFKQLVFKHQ6\VWHPHQYRUKDQGHQH,QIRUPD WLRQVWHFKQLN XQG QRFK ZHQLJHU E]Z JDU QLFKW GLH PHFKDQLVFKHQ.RPSRQHQWHQ RGHU JDU GHQ WHFKQLVFKHQ3UR]HVVZHOFKHQPDQPLWGHP6\VWHPUHDOLVLHUHQP FKWH 'HP JHJHQ EHU ODVVHQ VLFK HWDEOLHUWH 9RUJHKHQVZHLVHQ UHLQHU 6RIWZDUH6\VWHPH MHGRFK QLFKW HLQIDFK DXI GLH HLQJHEHWWHWH 6RIWZDUH EHUWUDJHQ 'DV 9RUKDQGHQVHLQ YRQ GUHL.RPSRQHQWHQ 6RIWZDUH +DUGZDUH XQG*HUlWHPHFKDQLNHUIRUGHUWHLQLQWHUGLV]LSOLQlUHV(QWZLFNOXQJVWHDPXQG GDV H[SORUDWLYH (QWZLFNHOQ GHU 6RIWZDUH 'DEHL ZLUG GLH HLQJHEHWWHWH 6RIWZDUH DOV GHU IOH[LEHOVWH 3DUWYHUVWDQGHQGHUVLFKGHQ*HJHEHQKHLWHQLP*HVDPWSURMHNWXQHLQJHVFKUlQNWDQSDVVHQPXVV :HLWHUKLQH[LVWLHUHQ8QWHUVFKLHGHEHLP7HVWXQG,QEHWULHEQDKPHWHFKQLVFKHU6\VWHPH%HLGHU HLQJHEHWWHWHQ 6RIWZDUH OLHJHQ YLHOH )HKOHU LP =HLWYHUKDOWHQ XQG LP =XVDPPHQVSLHO ]ZLVFKHQ 6RIWZDUH +DUGZDUH XQG 0HFKDQLN 'DV (FKW]HLWYHUKDOWHQ GLH 1HEHQOlXILJNHLW XQG GLH HQJH.RSSOXQJPLWGHPWHFKQLVFKHQ3UR]HVVHUVFKZHUHQGLH0HVVEDUNHLWXQG%HREDFKWEDUNHLW2KQH GDVIHUWLJH$XWRPDWLVLHUXQJVV\VWHPLVWGLHHLQJHEHWWHWH6RIWZDUHQXUHLQJHVFKUlQNWWHVWEDU =XGHPNRPPWGDVVGDV:LVVHQXQGGLH)HUWLJNHLWHQI UGHQNRQVWUXNWLYHQ$QWHLOGHU6RIWZDUH HQWZLFNOXQJHLQHV8QWHUQHKPHQVZHVHQWOLFKDXVJHSUlJWHUXQGYHUEUHLWHWHUVLQGDOV]XP%HLVSLHO I UGHQ7HVWXQGGLH,QEHWULHEQDKPH(UVFKZHUHQGNRPPWKLQ]XGDVV]XPHLQHQVSH]LHOOI U HLQJHEHWWHWH6\VWHPH/ VXQJHQIHKOHQZRJHHLJQHWH0HWKRGHQXQG:HUN]HXJHEHZHUWHWZHUGHQ 'DGLH6SDQQZHLWHGHU3URMHNWXQG3URGXNWDQIRUGHUXQJHQVHKUJUR LVWPDFKWGLH(PSIHKOXQJ HLQHVDOOJHPHLQHQ9RUJHKHQVPRGHOOVZHQLJ6LQQHGRFKIHKOWGHQ.08RIWGLH0LWWHOXQG5HV VRXUFHQXPVHOEHUGLH$QSDVVXQJDQLKUHEHVRQGHUHQ%HG UIQLVVHYRU]XQHKPHQ 'HPJHJHQ EHUVWHLJWPLWGHUVWlQGLJHQ)XQNWLRQVYHUODJHUXQJLQ5LFKWXQJ6RIWZDUHDXFKGHUHQ.RPSOH[LWlW'DGXUFKQLPPWGLH4XDOLWlWGHU6RIWZDUHHLQH]HQWUDOH6WHOOXQJLQGHU3URGXNWHQW ZLFNOXQJHLQ8PGLHVLFKGDUDXVHUJHEHQGHQ+HUDXVIRUGHUXQJHQ]XEHZlOWLJHQXQGGLH5LVLNHQ ]XPLQGHUQEHGDUIHVHLQHV9RUJHKHQVPRGHOOVGDVVGHQ(QWZLFNOXQJVSUR]HVVDXV6RIWZDUHVLFKW EHVFKUHLEWXQGKLOIWTXDOLWlWVVLFKHUQGYRU]XJHKHQ 1.2 Zielsetzung 'DV+DQGEXFKJLEWHLQHQhEHUEOLFN EHUGLH4XDOLWlWVVLFKHUXQJYRQ6RIWZDUH'DEHLZLUGDXV GHU/LWHUDWXUXQGGHQÅ%HVW3UDFWLFHV GHU8QWHUQHKPHQHLQ9RUJHKHQVPRGHOOYRUJHVWHOOWLQ GHP]XMHGHU463KDVHGLHP JOLFKHQ0HWKRGHQXQG:HUN]HXJH]XJHRUGQHWZHUGHQ,QVEHVRQ GHUH LVW HLQ V\VWHPDWLVFKHU 7HVWSUR]HVV LQ VHLQHQ (LQ]HOWHLOHQ GRNXPHQWLHUW +LHU LVW DXFK HLQH EHUVLFKWOLFKH%HZHUWXQJGHU0HWKRGHQXQG:HUN]HXJHZLHGHU]XILQGHQ , itm

13 System Ebene IT Ebene System SW Ebene System Anforderungsanalys Informationstechni Anforderungsanalys System Mechanikrungsanalys IT Hardwarerungsanalys Anforderungsanalys Software Software Grobentwur Software Software Software Mechanik IT Systemtes ITIntegration Test Hardware Software Systemtes Softwareund Test SystemIntegration und QSZiel e u. Richtlinien o. Test vorb er e Test obj Testumge vor berei Testumge Projekthand Pr ojektp Spezifi ka Testp lan Risikodurc hf üh TestZiele Testdu rchfü Testobjekte Testumge defini er Testpl (Endvers Testu mgebu objekt Testsequenz/ aus wäh Test ergebnis spei c h Testpl (Ers tvers Testmethoden kri t eri e n Testprozedur Test proz Testfall Test erge bnis Test auswe Testergebnis filter Testergebnis aus wer Ress our c en Ri chtl ini en u. fes tl eg Zeit plan Test fälle Test Testobj stimulie Test daten Testfä impl ementi Testfä (Implementie Testprot Legen Aktivit Obje Dokumenti des (z. B. C h ec k 1 Einleitung qualitätsorientiertes Vorgehensmodell Testprozess Testwerkzeuge und (Emulatoren) Qualitätssicherungs Maßnahmen Abbildung 3: Zielsetzung 'DV9RUJHKHQVPRGHOOZHOFKHVGLHTXDOLWlWVGRPLQDQWH6WHOOXQJGHU6RIWZDUHEHU FNVLFKWLJWKLOIWLQ HLQHPLQWHUGLV]LSOLQlUHQ7HDPGLHHLJHQHQ(QWZLFNOXQJVSUR]HVVH]XRUGQHQXQG]XVWUXNWXULHUHQ.ODVVLVFKH9HUIDKUHQGHV7HVWIDOOHQWZXUIVHUI OOHQGLH$QIRUGHUXQJHQGHU3UD[LVKLQVLFKWOLFKGHU (IIL]LHQ] GHU JUDSKLVFKHQ 'DUVWHOOXQJ XQG +DQGKDEEDUNHLW EHL XPIDQJUHLFKHQ 7HVWSUREOHPHQ QLFKW ]XIULHGHQVWHOOHQG 'DV KLHU YRUJHVWHOOWH.RQ]HSW I U GHQ 7HVWIDOO(QWZXUI EDVLHUW DXI GHU.ODVVLILNDWLRQVEDXP0HWKRGH]XU7HVWGDWHQ(UPLWWOXQJXQGHLQHUHUZHLWHUWHQ%HVFKUHLEXQJYRQ 0HVVVDJH 6HTXHQFH &KDUWV 06& I U GLH 7HVWDEODXI%HVFKUHLEXQJ 7HVWZHUN]HXJH XQG 46 0D QDKPHQNODVVLIL]LHUWXQGEHZHUWHWVWHOOHQHEHQIDOOVHLQHZLFKWLJH+LOIHEHLGHU$XVZDKOI U GDVHLJHQH8QWHUQHKPHQ'LH]DKOUHLFKHQ'RNXPHQWHXQG9RUODJHQ]XU4XDOLWlWVVLFKHUXQJGLHVLFKEHL GHQ 3URMHNWSDUWQHUQ EHZlKUW KDEHQ N QQHQ DXIZDQGVDUP LQ GLH HLJHQHQ +DQGE FKHU EHU QRPPHQZHUGHQ 1.3 Aufbau des Handbuchs,P.DSLWHOZLUGHLQDOOJHPHLQHV6\VWHP9RUJHKHQVPRGHOOEHVFKULHEHQLQGHUGLH4XDOLWlWVVL FKHUXQJVDVSHNWHYRQ6RIWZDUHLP9RUGHUJUXQGVWHKHQ'DGLH9HUEHVVHUXQJGHV7HVWPHWKRGLN XQGV\VWHPDWLNLP0LWWHOSXQNWGHV3URMHNWHV)86,0VWHKWHUIROJWHLQH6WUXNWXULHUXQJXQGGH WDLOOLHUWH%HVFKUHLEXQJHLQHV7HVWSUR]HVVHVLQ.DSLWHO$XIEDXHQGGD]XZLUGLP.DSLWHODXI 7HVWZHUN]HXJH XQG,Q&LUFXLW(PXODWRUHQ HLQJHJDQJHQ 1HEHQ GHU.ODVVLILNDWLRQ XQG $QJDEH EHU9HUIDKUHQ]XU$XVZDKOXQG%HZHUWXQJLVWKLHUDXFKHLQHhEHUVLFKW EHUJlQJLJH7HVWZHUN ]HXJHXQG(PXODWRUHQ]XILQGHQ.DSLWHOEHVFKUHLEWGHQ7HVWIDOO(QWZXUIPLW+LOIHGHU.RP ELQDWLRQ DXV GHU.ODVVLILNDWLRQVEDXPPHWKRGH XQG HUZHLWHUWHQ 0HVVDJH6HTXHQFH&KDUWV 'LH )UDJHZHOFKH4XDOLWlWVVLFKHUXQJV0D QDKPHLQZHOFKHU(QWZLFNOXQJVSKDVHHUIROJHQNDQQZLUG LQ.DSLWHOEHKDQGHOW+LHUZHUGHQ460D QDKPHQNXU]EHVFKULHEHQ²DXVI KUOLFKH%HVFKUHL EXQJ XQG %HZHUWXQJ $QKDQJ % ² XQG LQ GDV 9RUJHKHQVPRGHOO HLQJHRUGQHW $EJHVFKORVVHQ ZLUGPLWGHQ(UJHEQLVVHQGHU%HVWDQGVDXIQDKPHEHLGHQ)86,03URMHNWSDUWQHUQ.DSLWHO,QGHQ$QKlQJHQVLQG%HVFKUHLEXQJHQXQG9RUODJHQZLHGHU]XILQGHQ$QKDQJ$HQWKlOWQHEHQ HLQHU.XU]EHVFKUHLEXQJGHU:HUN]HXJHDXFKGLH.RQWDNWDGUHVVHXPZHLWHUJHKHQGHUH,QIRUPD WLRQHQ]X HUKDOWHQ'LH 4XDOLWlWVVLFKHUXQJVPD QDKPHQ VLQG LP $QKDQJ% QDFKGHQ*HVLFKWV SXQNWHQ(LQRUGQXQJ=LHO3U IREMHNWXQGEHQ WLJWH8QWHUODJHQ9RUJHKHQVZHLVHQ%HZHUWXQJ XQGZHLWHUJHKHQGH,QIRUPDWLRQHQEHVFKULHEHQ$QKDQJ&ZLHGHUXPEHLQKDOWHW'RNXPHQWHXQG 9RUODJHQGHU3URMHNWSDUWQHUGLHYHUDOOJHPHLQHUWXQGZHLWJHKHQGDQRQ\PLVLHUWZXUGHQ:HLWHU JHKHQGH'RNXPHQWHZLH46'RNXPHQWHGHV90RGHOOVRGHUGHU,(((,PSOHPHQWLHUXQJVUH JHOQXQG&KHFNOLVWHQEHILQGHQVLFKLP$QKDQJ' 2001, itm 3

%YXSV1MGLEIP6EMXL %YJPEKIZSQ7ITXIQFIV %HQMRMWXVEXMSR F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF,

%YXSV1MGLEIP6EMXL %YJPEKIZSQ7ITXIQFIV %HQMRMWXVEXMSR F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, -7%% %YXSV1MGLEIP6EMXL %YJPEKIZSQ7ITXIQFIV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, &SHIRLIMQ -RXIVRIX[[[LIVHX]SYHIEXGL [[[LIVHXFYWMRIWWHIEXGL [[[LIVHXZLWHIEX %PPI 6IGLXI ZSVFILEPXIR /IMR 8IMP HIW ;IVOIW HEVJ

Mehr

%YXSV6SPERH&EYGL F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, %HQMRMWXVEXMSR

%YXSV6SPERH&EYGL F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, %HQMRMWXVEXMSR --7 %YXSV6SPERH&EYGL %YJPEKIZSQ2SZIQFIV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, &SHIRLIMQ -RXIVRIX[[[LIVHX]SYHIEXGL [[[LIVHXFYWMRIWWHIEXGL [[[LIVHXZLWHIEX %PPI 6IGLXI ZSVFILEPXIR /IMR 8IMP HIW ;IVOIW HEVJ MR

Mehr

%YXSV;SPJKERK7GLYP^'2-1'2) -RLEPXPMGLIW0IOXSVEX,ERW4IXIV.ELR'2-'2)1'7) %HQMRMWXVEXMSR F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF,

%YXSV;SPJKERK7GLYP^'2-1'2) -RLEPXPMGLIW0IOXSVEX,ERW4IXIV.ELR'2-'2)1'7) %HQMRMWXVEXMSR F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, 23%( %YXSV;SPJKERK7GLYP^'2-1'2) -RLEPXPMGLIW0IOXSVEX,ERW4IXIV.ELR'2-'2)1'7) %YJPEKIZSQ2SZIQFIV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, &SHIRLIMQ -RXIVRIX[[[LIVHX]SYHIEXGL [[[LIVHXFYWMRIWWHIEXGL [[[LIVHXZLWHIEX

Mehr

%YXSV4IXIV8VSTJ/EVPWVYLI +VYRHPEKIR'SQTYXIV%MHIH(IWMKR F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF,

%YXSV4IXIV8VSTJ/EVPWVYLI +VYRHPEKIR'SQTYXIV%MHIH(IWMKR F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, %' %YXSV4IXIV8VSTJ/EVPWVYLI %YJPEKIZSQ2SZIQFIV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, &SHIRLIMQ -RXIVRIX[[[LIVHX]SYHIEXGL [[[LIVHXFYWMRIWWHIEXGL [[[LIVHXZLWHIEX %PPI 6IGLXI ZSVFILEPXIR /IMR 8IMP HIW ;IVOIW

Mehr

0-2 %YXSV1EVOYW*IMPRIV /SEYXSV%VRI&ÂYQPIV ºFIVEVFIMXIXI%YWKEFIZSQ.ERYEV 2IX^[IVOEHQMRMWXVEXMSR F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF,

0-2 %YXSV1EVOYW*IMPRIV /SEYXSV%VRI&ÂYQPIV ºFIVEVFIMXIXI%YWKEFIZSQ.ERYEV 2IX^[IVOEHQMRMWXVEXMSR F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, 0-2 %YXSV1EVOYW*IMPRIV /SEYXSV%VRI&ÂYQPIV ºFIVEVFIMXIXI%YWKEFIZSQ.ERYEV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, &SHIRLIMQ -RXIVRIX[[[LIVHX]SYHIEXGL [[[LIVHXFYWMRIWWHIEXGL [[[LIVHXZLWHIEX %PPI 6IGLXI ZSVFILEPXIR

Mehr

%YXSVIR.SEGLMQ4EPPQIV,IMOS7GLVÔHIV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, %HQMRMWXVEXMSR

%YXSVIR.SEGLMQ4EPPQIV,IMOS7GLVÔHIV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, %HQMRMWXVEXMSR %;7 %YXSVIR.SEGLMQ4EPPQIV,IMOS7GLVÔHIV %YJPEKIZSQ2SZIQFIV F],)6(8:IVPEKJÚV&MPHYRKWQIHMIR+QF, &SHIRLIMQ -RXIVRIX[[[LIVHX]SYHIEXGL [[[LIVHXFYWMRIWWHIEXGL [[[LIVHXZLWHIEX %PPI 6IGLXI ZSVFILEPXIR /IMR 8IMP

Mehr

6WXGLH]XUJOREDOHQ(QWZLFNOXQJ YRQ:LVVHQVFKDIWXQG7HFKQLN )UDXQKRIHU,QVWLWXWI U6\VWHPWHFKQLNXQG,QQRYDWLRQVIRUVFKXQJ,6,

6WXGLH]XUJOREDOHQ(QWZLFNOXQJ YRQ:LVVHQVFKDIWXQG7HFKQLN )UDXQKRIHU,QVWLWXWI U6\VWHPWHFKQLNXQG,QQRYDWLRQVIRUVFKXQJ,6, 1 'HOSKL8PIUDJH 6WXGLH]XUJOREDOHQ(QWZLFNOXQJ YRQ:LVVHQVFKDIWXQG7HFKQLN =XVDPPHQIDVVXQJGHU(UJHEQLVVH )UDXQKRIHU,QVWLWXWI U6\VWHPWHFKQLNXQG,QQRYDWLRQVIRUVFKXQJ,6, LP$XIWUDJGHV%XQGHVPLQLVWHULXPVI U%LOGXQJ:LVVHQVFKDIW)RUVFKXQJXQG

Mehr

9HUEUDXFKHUNUHGLWH)UDJHQXQG$QWZRUWHQ

9HUEUDXFKHUNUHGLWH)UDJHQXQG$QWZRUWHQ 0(02 Brüssel, den 14. November 2002 9HUEUDXFKHUNUHGLWH)UDJHQXQG$QWZRUWHQ 'LH(XURSlLVFKH.RPPLVVLRQKDWDP6HSWHPEHUHLQHQ9RUVFKODJI U HLQH QHXH 9HUEUDXFKHUNUHGLW5LFKWOLQLH DQJHQRPPHQ VLHKH,3 $XI GHU7DJXQJGHV5DWHV:HWWEHZHUEDP1RYHPEHUZHUGHQGLH0LQLVWHULQ

Mehr

Verschenken oder vererben?

Verschenken oder vererben? Anwalts-u. Steuerkanzlei /W]RZ &ROOHJH 78199 BrŠunlingen Tel. 0771/9222-0 www.kanzlei-luetzow.de Verschenken oder vererben? )UGLH)UDJHREHVVLQQYROOHULVWHLQHQ7HLOVHLQHV9HUP JHQVEHUHLWV]X/HE]HLWHQ]X YHUVFKHQNHQ

Mehr

K W W S Z Z Z I H O V H U G H

K W W S Z Z Z I H O V H U G H K W W S Z Z Z I H O V H U G H *ULOOHQHLQ3KlQRPHQ LVW*ULOOHQDXFKHLQUHFKWOLFKHV3UREOHP" Deutschland grillt gerne. Nach einer Telefonumfrage des Instituts für Projektmanagement im Auftrag der CMA und ZMP

Mehr

Inhalt. 1 Einführungsveranstaltung. 2 Qualität kompakt

Inhalt. 1 Einführungsveranstaltung. 2 Qualität kompakt Inhalt 1 Einführungsveranstaltung 1.1 Ziel der Veranstaltung Warum Qualität? Inhalt der Veranstaltung 1.2 Formaler Ablauf der Veranstaltung 1.3 Übungs- und Gruppeneinteilung 1.4 Bewertungskriterien mittels

Mehr

%LQQHQPDUNWDQ]HLJHU )RUWVFKULWWH EHL GHU 8PVHW]XQJDEHUDXFKYLHOH9HUWUDJVYHUOHW]XQJHQ

%LQQHQPDUNWDQ]HLJHU )RUWVFKULWWH EHL GHU 8PVHW]XQJDEHUDXFKYLHOH9HUWUDJVYHUOHW]XQJHQ ,3 Brüssel, 19. November 2001 %LQQHQPDUNWDQ]HLJHU )RUWVFKULWWH EHL GHU 8PVHW]XQJDEHUDXFKYLHOH9HUWUDJVYHUOHW]XQJHQ 'HU 3UR]HQWVDW] GHU QRFK QLFKW LQ QDWLRQDOHV 5HFKW XPJHVHW]WHQ %LQQHQPDUNWULFKWOLQLHQ GDV

Mehr

23 Prävention in NRW. Fußball in der Schule

23 Prävention in NRW. Fußball in der Schule 23 Prävention in NRW Fußball in der Schule Prävention in NRW 23 Fußball in der Schule Liebe Leserin, lieber Leser die Sprache macht es uns oft nicht leicht, weibliche und männliche Formen gut lesbar in

Mehr

Sprachaufenthalte weltweit!

Sprachaufenthalte weltweit! Englisch Französisch Spanisch Italienisch Portugiesisch Russisch Deutsch Chinesisch Japanisch Arabisch Türkisch Hindi Sprachaufenthalte weltweit! Sprachen lernen - Erfolg erleben www.linguista.ch Hotline

Mehr

9RUVFKODJ I U HLQH 5LFKWOLQLH EHU GLH

9RUVFKODJ I U HLQH 5LFKWOLQLH EHU GLH 0(02 Brüssel, 20. Februar 2002 9RUVFKODJ I U HLQH 5LFKWOLQLH EHU GLH 3DWHQWLHUEDUNHLW FRPSXWHULPSOHPHQWLHUWHU (UILQGXQJHQ (siehe auch IP/02/277) :DVVLQGGLH+DXSWSXQNWHGHV9RUVFKODJV" Eine Erfindung, die

Mehr

=XNXQIW GHU,PPRELOLHQVXFKH QXW]HQ 2QOLQH 3ODWWIRUPHQ ]X,PPR 6XFKH QXW]HQ =HLWXQJVLQVHUDWH SHUV QOLFKHQ.RQWDNW (UIROJVIDNWRU JUR H $XVZDKO DQ 2EMHNWHQ :LFKWLJVWHQ )DNWRUHQ VLQG *UR HV $QJHERW 8QNRPSOL]LHUWH

Mehr

6LFKHUKHLW YRQ 1DKUXQJVHUJlQ]XQJHQ.RPPLVVDU %\UQHEHJU WSROLWLVFKH(LQLJXQJLP5DW

6LFKHUKHLW YRQ 1DKUXQJVHUJlQ]XQJHQ.RPPLVVDU %\UQHEHJU WSROLWLVFKH(LQLJXQJLP5DW ,3 Brüssel, 27. September 2001 6LFKHUKHLW YRQ 1DKUXQJVHUJlQ]XQJHQ.RPPLVVDU %\UQHEHJU WSROLWLVFKH(LQLJXQJLP5DW.RPPLVVDU'DYLG%\UQHHUNOlUWHVLFKKHXWH]XIULHGHQGDU EHUGDVVGHU5DW HLQH SROLWLVFKH (LQLJXQJ EHU

Mehr

Basiswissen Softwaretest

Basiswissen Softwaretest Andreas Spillner Tilo Linz Basiswissen Softwaretest Aus- und Weiterbildung zum Certified Tester Foundation Level nach ISTQB-Standard 3., überarbeitete und aktualisierte Auflage I Technische l'^vrau«! D~w.-iE*arit

Mehr

Software-Lebenszyklus

Software-Lebenszyklus Software-Lebenszyklus Inhalt Vorgehensmodell/Phasenplan Wasserfallmodell WAS-Beschreibung WIE-Beschreibung Weitere Phasenmodelle: Spiral-Modell, V-Modell, RUP Extreme Programming SW-Qualitätssicherung

Mehr

0HLQ&RPSXWHU. :LHKHL HQGLH7HLOHGHV&RPSXWHUV"2UGQHGLH:RUWNlUWFKHQ]X 0DUWLQD 0 OOHU

0HLQ&RPSXWHU. :LHKHL HQGLH7HLOHGHV&RPSXWHUV2UGQHGLH:RUWNlUWFKHQ]X 0DUWLQD 0 OOHU :LHKHL HQGLH7HLOHGHV&RPSXWHUV"2UGQHGLH:RUWNlUWFKHQ]X 0DUWLQD 0 OOHU 'UXFNHU :LHKHL HQGLH7HLOHGHV&RPSXWHUV"2UGQHGLH:RUWNlUWFKHQ]X 5HFKQHU 0RQLWRU 7DVWDWXU 0DXV 0DUWLQD 0 OOHU :RUWNlUWFKHQ]XP/HJHPDWHULDO

Mehr

1.1 Basiswissen komprimiert... 4 1.2 Praxiswissen Testmanagement Übersicht... 8. 2 Testprozess und Testwerkzeuge 11

1.1 Basiswissen komprimiert... 4 1.2 Praxiswissen Testmanagement Übersicht... 8. 2 Testprozess und Testwerkzeuge 11 xi 1 Einleitung 1 1.1 Basiswissen komprimiert.......................... 4 1.2 Praxiswissen Testmanagement Übersicht.............. 8 2 Testprozess und Testwerkzeuge 11 2.1 Fundamentaler Testprozess.........................

Mehr

Mediadaten ROMMERSKIRCHEN. Portrait 3. Verlagsangaben & Ansprechpartner 4 Technische Angaben 5. Textanzeigen 6. Ad Specials 8 Verlagsbeilagen 9

Mediadaten ROMMERSKIRCHEN. Portrait 3. Verlagsangaben & Ansprechpartner 4 Technische Angaben 5. Textanzeigen 6. Ad Specials 8 Verlagsbeilagen 9 Portrait 3 Verlagsangaben & Ansprechpartner 4 Technische Angaben 5 Textanzeigen 6 Ad Specials 8 Verlagsbeilagen 9 2011 Mediadaten Pressekontakte & Medienlinks 10 Stellenmarkt PRINT 12 Stellenmarkt ONLINE

Mehr

6\VWHPYRUDXVVHW]XQJHQ]XU,QVWDOODWLRQ. ab Pentium mit 133 MHz oder höher

6\VWHPYRUDXVVHW]XQJHQ]XU,QVWDOODWLRQ. ab Pentium mit 133 MHz oder höher +DQGEXFK zur PC-Kassensoftware (X&D6RIWŠ %DFNRIILFH.DSLWHO,QVWDOODWLRQ 6\VWHPYRUDXVVHW]XQJHQ]XU,QVWDOODWLRQ Prozessor RAM Festplatte Bildschirm Floppy Disk Anschluß parallel ab Pentium mit 133 MHz oder

Mehr

IV Software-Qualitätssicherung

IV Software-Qualitätssicherung Softwaretechnik- Praktikum: 12. Vorlesung Jun.-Prof Prof.. Dr. Holger Giese Raum E 3.165 Tel. 60-3321 Email: hg@upb.de Übersicht I II III IV V Einleitung Ergänzungen zur Software-Entwicklung Software Management

Mehr

Architektur in der Mechatronik. existierender Testwerkzeuge

Architektur in der Mechatronik. existierender Testwerkzeuge Universelle Testsystem Architektur in der Mechatronik Ansatz zur Systematisierung Ansatz zur Systematisierung existierender Testwerkzeuge Gliederung Umfeld und Problemstellung Testsystem Architektur Funktionale

Mehr

Testmanagement bei SAP-Projekten

Testmanagement bei SAP-Projekten Testmanagement bei SAP-Projekten Erfolgreich Planen Steuern Reporten bei der Einführung von SAP-Banking von Alberto Vivenzio, Domenico Vivenzio 1. Auflage Springer Vieweg Wiesbaden 2012 Verlag C.H. Beck

Mehr

Datumswerte und Zeitstempel

Datumswerte und Zeitstempel KAPITEL 10 Datumswerte und Zeitstempel In den meisten unserer Anwendungen müssen auch Datums- und Uhrzeitwerte gespeichert und verarbeitet werden. Datumswerte sind recht kompliziert: Sie sind nicht nur

Mehr

Systemen - Testprozess. Testprozess. Testprozess: Aktivitäten. Testplanung und Teststeuerung. Testplanung und Teststeuerung

Systemen - Testprozess. Testprozess. Testprozess: Aktivitäten. Testplanung und Teststeuerung. Testplanung und Teststeuerung 2007 Dr. Klaudia Dussa-Zieger P r a k t I s c h e Testprozess - Inhalt Testprozess Testen von Software-Systemen Systemen - Testprozess Lehrplan 2003 Testplanung Testausführung ierung Testendebewertung

Mehr

6FRXW0DVWHU3UHVVHPLWWHLOXQJ

6FRXW0DVWHU3UHVVHPLWWHLOXQJ 6FRXW0DVWHU3UHVVHPLWWHLOXQJ ( 4. Februar 2003) &H%,76FRXW5HVHDUFK6\VWHPV SUlVHQWLHUWNRVWHQJ QVWLJHVG\QDPLVFKHV :LVVHQVPDQDJHPHQWV\VWHP &H%,7+DOOH6WDQG* :ROIUDWVKDXVHQ GHQ )HEUXDU ± 'LH 6FRXW 5HVHDUFK 6\VWHPV

Mehr

Systemen - Testprozess. Testprozess. Testprozess: Aktivitäten. Testplanung und Teststeuerung. Lehrplan 2003 Testplanung

Systemen - Testprozess. Testprozess. Testprozess: Aktivitäten. Testplanung und Teststeuerung. Lehrplan 2003 Testplanung P r a k t I s c h e Testprozess - Inhalt Testprozess Testen von Software-Systemen Systemen - Testprozess Lehrplan 2003 Testplanung Testausführung ierung Testendebewertung Testberichterstattung Lehrplan

Mehr

1HXH %HVWLPPXQJHQ EHU 9LWDPLQH XQG 0LQHUDOLHQ DOV 1DKUXQJVHUJlQ]XQJ ± 6FKZHUSXQNW 6LFKHUKHLW XQG,QIRUPDWLRQGHU9HUEUDXFKHU

1HXH %HVWLPPXQJHQ EHU 9LWDPLQH XQG 0LQHUDOLHQ DOV 1DKUXQJVHUJlQ]XQJ ± 6FKZHUSXQNW 6LFKHUKHLW XQG,QIRUPDWLRQGHU9HUEUDXFKHU ,3 Brüssel, 10. Mai 2000 1HXH %HVWLPPXQJHQ EHU 9LWDPLQH XQG 0LQHUDOLHQ DOV 1DKUXQJVHUJlQ]XQJ ± 6FKZHUSXQNW 6LFKHUKHLW XQG,QIRUPDWLRQGHU9HUEUDXFKHU 'LH (XURSlLVFKH.RPPLVVLRQ KDW M QJVW HLQHQ 5LFKWOLQLHQYRUVFKODJ

Mehr

Sprachaufenthalte weltweit!

Sprachaufenthalte weltweit! Englisch Französisch Spanisch Italienisch Portugiesisch Russisch Deutsch Chinesisch Japanisch Arabisch Türkisch Hindi Sprachaufenthalte weltweit! Sprachen lernen - Erfolg erleben www.linguista.ch 86 FRANKREICH

Mehr

EDEKA Münster // Agentur gesucht. Steuerung B // Agentur gefunden.

EDEKA Münster // Agentur gesucht. Steuerung B // Agentur gefunden. EDEKA Münster // Agentur gesucht. Steuerung B // Agentur gefunden. Agentur-Vorstellung vom 02.04.12 Steuerung B GmbH Agentur für Kommunikation Bergmannstraße 36 44809 Bochum Tel: +49 (0)234. 338 326 0

Mehr

Inhalt. 1 Einleitung 1. 2 Grundkonzepte 11. 3 Erfahrungen systematisch nutzen 39

Inhalt. 1 Einleitung 1. 2 Grundkonzepte 11. 3 Erfahrungen systematisch nutzen 39 xi 1 Einleitung 1 1.1 Softwarequalität betrifft viele................................ 1 1.2 Für wen dieses Buch gemacht ist.............................. 1 1.3 Was Sie von diesem Buch erwarten können......................

Mehr

Peter Liggesmeyer. Software-Qualität. Testen, Analysieren und Verifizieren von Software. 2. Auflage. Spektrum k-/l AKADEMISCHER VERLAG

Peter Liggesmeyer. Software-Qualität. Testen, Analysieren und Verifizieren von Software. 2. Auflage. Spektrum k-/l AKADEMISCHER VERLAG Peter Liggesmeyer Software-Qualität Testen, Analysieren und Verifizieren von Software 2. Auflage Spektrum k-/l AKADEMISCHER VERLAG 1 Inhaltsverzeichnis 1 Einführung 1 1.1 Motivation 2 1.2 Terminologie

Mehr

,72Q'HPDQG,7*RYHUQDQFH±,72XWVRXUFLQJ,72IIVRXUFLQJ±:DVEOHLEW" 'U(OPDU3DXO6HOEDFK+&/7HFKQRORJLHV*PE+

,72Q'HPDQG,7*RYHUQDQFH±,72XWVRXUFLQJ,72IIVRXUFLQJ±:DVEOHLEW 'U(OPDU3DXO6HOEDFK+&/7HFKQRORJLHV*PE+ ,72Q'HPDQG,7*RYHUQDQFH±,72XWVRXUFLQJ,72IIVRXUFLQJ±:DVEOHLEW" 'U(OPDU3DXO6HOEDFK+&/7HFKQRORJLHV*PE+ Viele Organisationen sehen sich der Herausforderung gegenüber, ihre operationale Effizienz und Kostenstrukturen

Mehr

1.1 Basiswissen komprimiert... 4 1.2 Praxiswissen Testmanagement Übersicht... 8. 2 Fundamentaler Testprozess 11

1.1 Basiswissen komprimiert... 4 1.2 Praxiswissen Testmanagement Übersicht... 8. 2 Fundamentaler Testprozess 11 xiii 1 Einleitung 1 1.1 Basiswissen komprimiert.......................... 4 1.2 Praxiswissen Testmanagement Übersicht.............. 8 2 Fundamentaler Testprozess 11 2.1 Testplanung und -steuerung........................

Mehr

Einführung in die Softwaretechnik 9. Softwareprozesse

Einführung in die Softwaretechnik 9. Softwareprozesse 9. Softwareprozesse Klaus Ostermann (Mit Folien von Christian Kästner, Gabriele Taentzer und Wolfgang Hesse) 1 Agenda Wie kommt man vom Kundenwunsch zur fertigen Software? Wie strukturiert man ein Softwareprojekt?

Mehr

Testmanagement in IT-Projekten

Testmanagement in IT-Projekten Teil 1: Projektmagazin 05/20009 Teil 2: Projektmagazin 06/2009 1 Test: Prozess, bei dem ein Programm oder ein Software-System ausgeführt wird, um Fehler zu finden Teil 1: Projektmagazin 05/20009 Teil 2:

Mehr

Software Engineering mit Übungen. Franz-Josef Elmer, Universität Basel, HS 2015

Software Engineering mit Übungen. Franz-Josef Elmer, Universität Basel, HS 2015 Software Engineering mit Übungen Franz-Josef Elmer, Universität Basel, HS 2015 Software Engineering 2 Organisation Ort: Seminarraum 05.002, Spiegelgasse 5 Ablauf: 15:15 Vorlesung Prüfung: Schriftlich,

Mehr

Senior Consulting. Senior Consulting Strategical, Conceptual and Technical Consulting. 30.01.2011 Seite 1

Senior Consulting. Senior Consulting Strategical, Conceptual and Technical Consulting. 30.01.2011 Seite 1 30.01.2011 Seite 1 This flyer is exclusively for the use of client personnel. No part of it may be distributed, quoted or reproduced outside the client organisation without the prior written approval of

Mehr

$XWRUHQÃ%UXQRÃ:LHGHUNHKUÃ-RKDQQHVÃ6FKHXULQJÃ 0LWÃ*HQHKPLJXQJÃGHUÃ&RPSHQGLRÃ%LOGXQJVPHGLHQÃ$*Ã &+= ULFKÃ Ã&RPSHQGLRÃ%LOGXQJVPHGLHQÃ$*Ã&+= ULFKÃÃ

$XWRUHQÃ%UXQRÃ:LHGHUNHKUÃ-RKDQQHVÃ6FKHXULQJÃ 0LWÃ*HQHKPLJXQJÃGHUÃ&RPSHQGLRÃ%LOGXQJVPHGLHQÃ$*Ã &+= ULFKÃ Ã&RPSHQGLRÃ%LOGXQJVPHGLHQÃ$*Ã&+= ULFKÃÃ ,&7 $XIODJHYRP'H]HPEHU $XWRUHQ%UXQR:LHGHUNHKU-RKDQQHV6FKHXULQJ 0LW*HQHKPLJXQJGHU&RPSHQGLR%LOGXQJVPHGLHQ$* &+= ULFK &RPSHQGLR%LOGXQJVPHGLHQ$*&+= ULFK +HUDXVJHEHU+(5'79HUODJI U%LOGXQJVPHGLHQ*PE+ %RGHQKHLP,QWHUQHWZZZKHUGWFRP

Mehr

Agile Softwareentwicklung. Yelve Yakut

Agile Softwareentwicklung. Yelve Yakut Agile Softwareentwicklung Yelve Yakut Index Projekte Vorgehensmodelle Agilität Scrum Feature Driven Development 20.05.08 Agile Softwareentwicklung #2 Projektplanung Von 210 Projekten im Zeitraum von 1997

Mehr

Einführung in die ISO 26262

Einführung in die ISO 26262 Einführung in die ISO 26262 Herausforderungen für das Management von Verifikations- und Validationsdaten Dr. Ralf Nörenberg HighQSoft GmbH 19.08.2012 HighQSoft GmbH www.highqsoft.de Einführung in die ISO

Mehr

Testautomatisierung. Märchen, Möglichkeiten und praktischer Nutzen. Richard Seidl 21. Januar 2013 TU Dresden. Medizin- und Informationstechnik AG

Testautomatisierung. Märchen, Möglichkeiten und praktischer Nutzen. Richard Seidl 21. Januar 2013 TU Dresden. Medizin- und Informationstechnik AG Medizin- und Informationstechnik AG Testautomatisierung Märchen, Möglichkeiten und praktischer Nutzen Richard Seidl 21. Januar 2013 TU Dresden Kardiologische Funktionsdiagnostik Vitalfunktions-Monitoring

Mehr

Qualitätssicherung[QS] von Torsten Lindner

Qualitätssicherung[QS] von Torsten Lindner Qualitätssicherung[QS] von Torsten Lindner Gliederung [I] [II] [III] [IV] Softwarequalität Qualitätssicherung Zusammenfassung Literatur Gliederung [I] Softwarequalität [A] Begriffserklärung [B] Qualitätsmaß

Mehr

(Titel des Berichts)

(Titel des Berichts) (Titel des Berichts) Praxissemesterbericht von (Vorname Name) aus (Geburtsort) Matrikelnummer Anschrift Telefon HTW Aalen Hochschule für Technik und Wirtschaft Betreuender Professor Abgabetermin Angaben

Mehr

Qualitätssicherung in der Praxis der Softwareerstellung

Qualitätssicherung in der Praxis der Softwareerstellung Thomas Kugel Qualitätssicherung in der Praxis der Softwareerstellung Dresden 18.10.2001 Quality Quality for for Success Success Inhalt Die SQS AG Einführung / Motivation Aufwandsschätzung Testorganisation

Mehr

Einführung in die SWE

Einführung in die SWE Einführung in die SWE Inhalte der Vorlesung Allgemeine Ziele der Lehrveranstaltung Entwickeln einer kleinen Applikation nach professionellem Vorgehensmodell Erlernen des objektorientierten Herangehens

Mehr

SOFTWARETECHNIK. Kapitel 7 Vorgehensmodelle. Vorlesung im Wintersemester 2012/13 FG System- und Software-Engineering Prof. Dr.-Ing.

SOFTWARETECHNIK. Kapitel 7 Vorgehensmodelle. Vorlesung im Wintersemester 2012/13 FG System- und Software-Engineering Prof. Dr.-Ing. SOFTWARETECHNIK Kapitel 7 Vorgehensmodelle Vorlesung im Wintersemester 2012/13 FG System- und Software-Engineering Prof. Dr.-Ing. Armin Zimmermann Inhalt Vorgehensmodelle Sequenzielle Modelle Iterative

Mehr

Objektorientierte Software-Entwicklung

Objektorientierte Software-Entwicklung Objektorientierte Software-Entwicklung Priv.- Doz Dr. Rolf Hennicker 04.10.2002 Kapitel 1 Software Engineering: Überblick Kapitel 1 Software Engineering: Überblick 2 Ziele Verstehen, womit sich die Disziplin

Mehr

System Integration. and its compliance testing necessities. Automotive BUS Systems + Ethernet, Stuttgart, 10 Dec 2013.

System Integration. and its compliance testing necessities. Automotive BUS Systems + Ethernet, Stuttgart, 10 Dec 2013. System Integration and its compliance testing necessities Automotive BUS Systems + Ethernet, Stuttgart, 10 Dec 2013 Georg Janker CTO experts in automotive data communication Agenda 1. Motivation 2. Positionierung

Mehr

Block R (Rahmen): SE Aktivitäten 21.10.04 2. Vorlesung Methoden des Software Engineering. Block R Rahmen Aktivitäten der Software-Entwicklung

Block R (Rahmen): SE Aktivitäten 21.10.04 2. Vorlesung Methoden des Software Engineering. Block R Rahmen Aktivitäten der Software-Entwicklung Block R (Rahmen): SE Aktivitäten 21.10.04 1 Vorlesung Methoden des Software Engineering Block R Rahmen Aktivitäten der Software-Entwicklung Martin Wirsing Einheit R.2, 21.10.2004 Block R (Rahmen): SE Aktivitäten

Mehr

Requirements Engineering & Software Test - Synergien effektvoll nutzen

Requirements Engineering & Software Test - Synergien effektvoll nutzen Requirements Engineering & Software Test - Synergien effektvoll nutzen Software & Systems Quality Conference, 27.-29. Mai 2009 Düsseldorf, Deutschland Bernhard Rauter, BSc (Hons) Software-Test Berater

Mehr

Sprachaufenthalte weltweit!

Sprachaufenthalte weltweit! Englisch Französisch Spanisch Italienisch Portugiesisch Russisch Deutsch Chinesisch Japanisch Arabisch Türkisch Hindi Sprachaufenthalte weltweit! Sprachen lernen - Erfolg erleben www.linguista.ch 36 LAND

Mehr

Software-Test für Embedded Systems

Software-Test für Embedded Systems Software-Test für Embedded Systems Ein Praxishandbuch für Entwickler, Tester und technische Projektleiter von Stephan Grünfelder 1. Auflage Software-Test für Embedded Systems Grünfelder schnell und portofrei

Mehr

Qualitätssicherung und Testen

Qualitätssicherung und Testen Qualitätssicherung und Testen Dr. Friederike Nickl friederike.nickl@sepis.de Softwareentwicklung, Produkt- und Informations- Service GmbH Berliner Straße 85, 80805 München Gliederung 1. Qualitätsmanagement

Mehr

Seien Sie frei! Desktop, Laptop, Tablet oder Smartphone mit Halo haben Sie Ihre Kennzahlen jederzeit zur Hand.

Seien Sie frei! Desktop, Laptop, Tablet oder Smartphone mit Halo haben Sie Ihre Kennzahlen jederzeit zur Hand. Sagen Sie Hallo zu Halo (QWGHFNHQ 6LH GLH HUVWH $QDO\VHSODWWIRUP GLH ΖKUH 'DWHQHLQVLFKWHQ 0RELOLW W XQG VR]LDOH 1HW]ZHUNH PLW GHP ZHUWYROOVWHQ.DSLWDO ΖKUHV 8QWHUQHKPHQV YHUELQGHW - Ihren Mitarbeitern BI

Mehr

Agile Testing. Der agile Weg zur Qualität. von Siegfried Tanczos, Martin Klonk, Richard Seidl, Helmut Pichler, Manfred Baumgartner. 1.

Agile Testing. Der agile Weg zur Qualität. von Siegfried Tanczos, Martin Klonk, Richard Seidl, Helmut Pichler, Manfred Baumgartner. 1. Agile Testing Der agile Weg zur Qualität von Siegfried Tanczos, Martin Klonk, Richard Seidl, Helmut Pichler, Manfred Baumgartner 1. Auflage Hanser München 2013 Verlag C.H. Beck im Internet: www.beck.de

Mehr

ALLG. METHODEN DES SOFTWAREENGINEERING

ALLG. METHODEN DES SOFTWAREENGINEERING Test und Testdokumentation ALLG. METHODEN DES SOFTWAREENGINEERING Agenda Maßnahmen zur Qualitätssicherung und Steigerung Tests, Testkategorien und Fehlerarten Teststufen und Testplanung Testdokumentation

Mehr

Entwicklungs-Prozess

Entwicklungs-Prozess B e r e i c h e Software-Entwicklungs Entwicklungs-Prozess von Helmut Wolfseher (BWCE) als Partner der IndustrieHansa Kontakt Entwicklung der Kostenverhältnisse für Fehlerbeseitigung Kosten Kosten für

Mehr

Requirements-Management Ein praktisches Beispiel

Requirements-Management Ein praktisches Beispiel 2003 Eurocopter Deutschland GmbH 2003 Requirements-Management Ein praktisches Beispiel a.s.drexler@t-online.de Softwareprozesse in Luft- und Raumfahrtprojekten Workshop der DGLR am 15.10.2003 Der Vortrag

Mehr

RTLOpen - Eine Methode zur interdisziplinären Entwicklung von software-intensiven Echtzeit-Systemen

RTLOpen - Eine Methode zur interdisziplinären Entwicklung von software-intensiven Echtzeit-Systemen RTLOpen - Eine Methode zur interdisziplinären Entwicklung von software-intensiven Echtzeit-Systemen Thorsten Keuler (thorsten.keuler@iese.fraunhofer.de) IESE Fraunhofer Institut Experimentelles Software

Mehr

)RUWVFKULWWHLQDOOHQ%HUHLFKHQ

)RUWVFKULWWHLQDOOHQ%HUHLFKHQ ,3 Brüssel, den 29. Januar 2003 5HIRUP GHU.RPPLVVLRQ YRQ 0D QDKPHQ HLQJHI KUW 8PVHW]XQJ ]HLJW HUVWH 9RUWHLOH GHU 5HIRUP +HXWHKDWGLH(XURSlLVFKH.RPPLVVLRQHLQHQ%HULFKWDQJHQRPPHQDXVGHP KHUYRUJHKW GDVV EHLQDKH

Mehr

Maciej Gaweda 9702887. E-Mail. als Beweismittel im Gerichtsverfahren. Wintersemester 2002/2003

Maciej Gaweda 9702887. E-Mail. als Beweismittel im Gerichtsverfahren. Wintersemester 2002/2003 Maciej Gaweda 9702887 E-Mail als Beweismittel im Gerichtsverfahren 1 Wintersemester 2002/2003 ,1+$/769(5=(,&+1,6 (LQOHLWXQJ $OOJHPHLQHV 1RWZHQGLJH:RUWEHJULIIH 5HFKWOLFKH%HXUWHLOXQJGHV%HJULIIHVÄ(0DLO³ 9HUVXFKHLQHU'HILQLWLRQ

Mehr

Werbewirkung. Selbermachen.

Werbewirkung. Selbermachen. 6WDQG 6HSWHPEHU ơ 7HFKQLVFKH QGHUXQJHQ XQG,UUWÕPHU YRUEHKDOWHQ $OOH LP 7H[W DXIJHIÕKUWHQ 0DUNHQQDPHQ VLQG HLQJHWUDJHQH :DUHQ]HLFKHQ GHU +HUVWHOOHU Werbewirkung. Selbermachen. Die All-in-one-Lösung für

Mehr

Lehrplan: SW- Qualitätssicherung

Lehrplan: SW- Qualitätssicherung Lehrplan: SW- Qualitätssicherung Tobias Brückmann Volker Gruhn Gliederung 1 Grundlagen und Kontext im SW- Prozess 1.1 Ursachen und Risiken von SW- Fehlern 1.2 KlassifikaGon von Fehlern 1.3 Begriffe (Qualität,

Mehr

Software Qualitätssicherung durch systematischen Softwaretest

Software Qualitätssicherung durch systematischen Softwaretest Software Qualitätssicherung durch systematischen Softwaretest Innovative Techniken und aktuelle Herausforderungen Dr. Bernhard Peischl Softnet Austria Institut für Softwaretechnologie Technische Universität

Mehr

OBE R SE E-L I N T H JOURNAL

OBE R SE E-L I N T H JOURNAL AUSGABE SOMMER 2013 OBE R SE E-L I N T H JOURNAL REPORT AKTUELL Hochwasserschutz, Natur und Erholung: Nach fünfjähriger Sanierungsphase ist das Linthwerk wieder für Besucher geöffnet. FREIZEIT & REISEN

Mehr

Software-Qualität Ausgewählte Kapitel

Software-Qualität Ausgewählte Kapitel Martin Glinz Software-Qualität Ausgewählte Kapitel Kapitel 1 Einführung Universität Zürich Institut für Informatik 2009 Martin Glinz. Alle Rechte vorbehalten. Speicherung und Wiedergabe sind für den persönlichen,

Mehr

IV Software-Qualitätssicherung

IV Software-Qualitätssicherung Softwaretechnik- Praktikum: 11. Vorlesung Jun.-Prof Prof.. Dr. Holger Giese Raum E 3.165 Tel. 60-3321 Email: hg@upb.de Übersicht I II III IV V Einleitung Ergänzungen zur Software-Entwicklung Software Management

Mehr

Iterativ. Inkrementell

Iterativ. Inkrementell Iterativ Inkrementell Build Release Test Qualität Architektur & Documentation Distributed Version Control Continuous Integration TDD Design Agile Architektur Dependency Feature Branches Mocks

Mehr

Basiswissen Softwaretest

Basiswissen Softwaretest Basiswissen Softwaretest Vergleich der Vorlesung Software-Engineering Wartung und Qualitätssicherung (Stand WS13/14) mit der 4. überarbeiteten und aktualisierten Auflage von Spillner&Linz: Basiswissen

Mehr

TESTPLAN

TESTPLAN <Projektname> Firma TESTPLAN ID Version Ersteller: ------------------- Vorgesetzter des Erstellers:

Mehr

Polarion QA. POLARION ALM StartUp Training. Testmanagement in Polarion

Polarion QA. POLARION ALM StartUp Training. Testmanagement in Polarion Polarion QA POLARION ALM StartUp Training Index: Polarion QA im V-Modell TestCases / Test Steps TestRun und TestRun Template Execute Test & TestStep Table Suchabfragen Traceability Übungen Testmanagement

Mehr

Testphase. Das Testen

Testphase. Das Testen Testphase VIS Projekt Freie Universität Berlin N.Ardet - 17.4.2001 Das Testen Testen ist das Ausführen eines Software- (Teil)systems in einer definierten Umgebung und das Vergleichen der erzielten mit

Mehr

Fred Stay 2013-06-04/05. Management der Funktionalen Sicherheit KROHNE Academy Automatisierungstechnik in der Prozessindustrie

Fred Stay 2013-06-04/05. Management der Funktionalen Sicherheit KROHNE Academy Automatisierungstechnik in der Prozessindustrie Fred Stay 2013-06-04/05 Management der Funktionalen Sicherheit KROHNE Academy Automatisierungstechnik in der Prozessindustrie 1. Warum brauchen wir ein FSM 2. Vermeidung/Beherrschung von Fehlern 3. Praxisbeispiel:

Mehr

Performancetesten im BIT / LZBTI

Performancetesten im BIT / LZBTI Performancetesten im BIT / LZBTI Swiss Testing Night, Michael Steger BIT und Andreas Elsener [ipt] Innovation Process Technology AG [ipt] Baarerstrasse 63, 6300 Zug, Schweiz Bundesamt für Informatik und

Mehr

Quality Assurance in Software Development

Quality Assurance in Software Development Quality Assurance in Software Development Qualitätssicherung in der Softwareentwicklung A.o.Univ.-Prof. Dipl.-Ing. Dr. Bernhard Aichernig Graz University of Technology Austria Summer Term 2015 1 / 23 Übersicht

Mehr

.RPPLVVLRQ VWHOOW 0LWWHO I U 8PZHOWSURMHNWH LQ 'ULWWOlQGHUQEHUHLW

.RPPLVVLRQ VWHOOW 0LWWHO I U 8PZHOWSURMHNWH LQ 'ULWWOlQGHUQEHUHLW ,3 Brüssel, den 25. September 2002.RPPLVVLRQ VWHOOW 0LWWHO I U 8PZHOWSURMHNWH LQ 'ULWWOlQGHUQEHUHLW 'LH (XURSlLVFKH.RPPLVVLRQ KDW 8PZHOWSURMHNWH JHQHKPLJW I U GLH 0LWWHO GHV 3URJUDPPV /,)('ULWWOlQGHU I

Mehr

Testen II. (Management, Tools) Daniela Rose. Software Engineering Projekt WS07/08 Fachgebiet Softwaretechnik und Systemgestaltung

Testen II. (Management, Tools) Daniela Rose. Software Engineering Projekt WS07/08 Fachgebiet Softwaretechnik und Systemgestaltung Testen II (Management, Tools) Daniela Rose Fachgebiet Softwaretechnik und Systemgestaltung 12.12.2007 Gliederung 1. Motivation 2. Der grundlegende Testprozess 3. Testen im Softwareentwicklungsprozess 4.

Mehr

Software Engineering. Prof. Dr. Stefan Enderle NTA Isny

Software Engineering. Prof. Dr. Stefan Enderle NTA Isny Software Engineering Prof. Dr. Stefan Enderle NTA Isny 3 Software Entwicklungsprozesse Softwareentwicklung Systematisches Vorgehen wichtig Zeitlicher Ablauf durch Vorgehensmodell Meist grundlegender Aufbau:

Mehr

-Kommentare ein-und ausschalten. -Kommentare ein-und ausschalten. Seite 1 DI Christian Eggbauer mobilkom austria

-Kommentare ein-und ausschalten. -Kommentare ein-und ausschalten. Seite 1 DI Christian Eggbauer mobilkom austria Diese Diese Kommentarfelder Kommentarfelder können können Sie Sie über über das das Menü Menü Ansicht Ansicht -Kommentare ein-und ausschalten. -Kommentare ein-und ausschalten. Dies Dies ist ist die die

Mehr

T-Systems Enterprise Services GmbH. Test Factory. Testen nach ISTQB-Standard, Gastvortrag Fontys Hogescholen Venlo, April 2008

T-Systems Enterprise Services GmbH. Test Factory. Testen nach ISTQB-Standard, Gastvortrag Fontys Hogescholen Venlo, April 2008 T-Systems Enterprise Services GmbH. Test Factory. Testen nach ISTQB-Standard, Gastvortrag Fontys Hogescholen Venlo, April 2008 Kennzahlen unserer Leistung. zur Zeit 50 Projekte mit 1 bis zu 300 Mitarbeitern

Mehr

2 Qualitätssicherung [ohne 2.3]

2 Qualitätssicherung [ohne 2.3] 1 Software-Qualitätssicherung 2 Qualitätssicherung [ohne 2.3] 2 Lernziele Die Prinzipien der Software-Qualitätssicherung aufzählen, erklären und begründen können. Prof. Dr. Helmut Balzert Lehrstuhl für

Mehr

9HUVRUJXQJVZHUN GHU3V\FKRWKHUDSHXWHQNDPPHU6FKOHVZLJ+ROVWHLQ

9HUVRUJXQJVZHUN GHU3V\FKRWKHUDSHXWHQNDPPHU6FKOHVZLJ+ROVWHLQ 9HUVRUJXQJVZHUN GHU3V\FKRWKHUDSHXWHQNDPPHU6FKOHVZLJ+ROVWHLQ,QIRUPDWLRQHQ]XU0LWJOLHGVFKDIW Die Psychotherapeutenkammer Schleswig-Holstein hat seit dem 14. Februar 2005 ein eigenes Versorgungswerk für alle

Mehr

3.4 Unified Process. 1999 Ivar Jacobson, Grady Booch, James Rumbaugh: The Unified Software Development Process.

3.4 Unified Process. 1999 Ivar Jacobson, Grady Booch, James Rumbaugh: The Unified Software Development Process. 1999 Ivar Jacobson, Grady Booch, James Rumbaugh: The Unified Software Development Process. 1996 Philippe Kruchten: Rational Unified Process Produkt der Firma Seit 2002 Teil des IBM Konzerns Objektorientiertes

Mehr

Wir schützen Ihre Investitionen. Qualitätssicherung nach Maß. IT Quality Services

Wir schützen Ihre Investitionen. Qualitätssicherung nach Maß. IT Quality Services Wir schützen Ihre Investitionen Qualitätssicherung nach Maß IT Quality Services Sicherheit, die senkt Mit den IT Quality Services schützen Sie Ihre Investitionen Ohne Qualitätssicherung Mit Qualitätssicherung

Mehr

Projektplan. Software Engineering Projekt. November 11 Fachbereich Informatik Software Engineering Projekt Sebastian Proksch 1

Projektplan. Software Engineering Projekt. November 11 Fachbereich Informatik Software Engineering Projekt Sebastian Proksch 1 Projektplan Software Engineering Projekt November 11 Fachbereich Informatik Software Engineering Projekt Sebastian Proksch 1 Der Projektplan Grundlage der gemeinsamen Arbeit innerhalb des Teams und mit

Mehr

Testmanagement. Q-Day. Frank Böhr Fraunhofer IESE frank.boehr@iese.fraunhofer.de

Testmanagement. Q-Day. Frank Böhr Fraunhofer IESE frank.boehr@iese.fraunhofer.de Frank Böhr Fraunhofer IESE frank.boehr@iese.fraunhofer.de Agenda Warum Testmanagement? Was sind die wichtigsten Schritte beim Testmanagement? Wie funktioniert Testmanagement Toolunterstützung Page 1/15

Mehr

Mitarbeiterprofil. Banken, Versicherung, Finanzen, Automotive, IT-Dienstleister Geburtsjahr 1964 Ausbildung Weitere Qualifikationen/ Zertifikate

Mitarbeiterprofil. Banken, Versicherung, Finanzen, Automotive, IT-Dienstleister Geburtsjahr 1964 Ausbildung Weitere Qualifikationen/ Zertifikate Mitarbeiterprofil Josef Fusser Funktion Beratung seit 1987 Senior Consultant Schwerpunkte - und Teilprojektmanagement (+++) Software-Entwicklung und Qualitätssicherung (+++) Testmethodik, Testvorgehen

Mehr

Ziele. Qualitätsmanagement. Wiederholung: Qualitätsmerkmale von Software. Qualitätszyklus. QS-Maßnahmen. Vorlesung Methoden des Software Engineering

Ziele. Qualitätsmanagement. Wiederholung: Qualitätsmerkmale von Software. Qualitätszyklus. QS-Maßnahmen. Vorlesung Methoden des Software Engineering Block D (Qualitätssicherung): Qualitätsmanagement und SW-Test 12.12.03 1 Block D (Qualitätssicherung): Qualitätsmanagement und SW-Test 12.12.03 2 Ziele Vorlesung Methoden des Software Engineering Grundlegende

Mehr

Validierung und Verifikation!

Validierung und Verifikation! Martin Glinz Thomas Fritz Software Engineering Kapitel 7 Validierung und Verifikation 2005-2013 Martin Glinz. Alle Rechte vorbehalten. Speicherung und Wiedergabe für den persönlichen, nicht kommerziellen

Mehr

Qualitätsmanagement. Menschen mit Lösungen

Qualitätsmanagement. Menschen mit Lösungen Qualitätsmanagement Menschen mit Lösungen Qualitätsmanagement Qualitätsma Was ist Qualität? Qualität wird definiert als die Gesamtheit von Merkmalen einer Einheit bezüglich ihrer Eignung, festgelegte und

Mehr

Vector Software. Test Automation mit VectorCAST während der gesamten Softwareentwicklung W H I T E P A P E R

Vector Software. Test Automation mit VectorCAST während der gesamten Softwareentwicklung W H I T E P A P E R Vector Software W H I T E P A P E R Test Automation mit VectorCAST während der gesamten Softwareentwicklung VectorCAST Produktfamilie Die VectorCAST Produktfamilie automatisiert Testaktivitäten über den

Mehr

Kenntnisse: P R O F I L. Dr. Michael Kuß Beethovenstraße 10 50858 Köln. Tel. 0174 / 3234279 e-mail: Michael.Kuss@PerfCon.de

Kenntnisse: P R O F I L. Dr. Michael Kuß Beethovenstraße 10 50858 Köln. Tel. 0174 / 3234279 e-mail: Michael.Kuss@PerfCon.de P R O F I L Dr. Michael Kuß Beethovenstraße 10 50858 Köln Tel. 0174 / 3234279 e-mail: Michael.Kuss@PerfCon.de Alter: 33 Jahre Verfügbarkeit: ab Nov. 2005 Schwerpunkte: Konzeption, Koordination und Durchführung

Mehr

Projektmanagement. Dokument V 1.1. Oliver Lietz - Projektmanagement. Wie kommt es zu einem Projektauftrag? Ausführung

Projektmanagement. Dokument V 1.1. Oliver Lietz - Projektmanagement. Wie kommt es zu einem Projektauftrag? Ausführung Projektmanagement Management- und Phasen-Modelle Vom Wasserfall bis Extreme Programming / Scrum Dokument V 1.1 Wie kommt es zu einem Projektauftrag? Auftraggeber Projekt-Idee / Ziele [Anforderungen/Spezifikation/

Mehr

Software Engineering (SE) 2) Phasenübergreifende Verfahren

Software Engineering (SE) 2) Phasenübergreifende Verfahren Software Engineering (SE) 2) Phasenübergreifende Verfahren Prof. Dr. Anja Metzner Hochschule Augsburg, Fakultät für Informatik Kontakt: anja.metzner@hs-augsburg.de Studiengang IBac 1 (Stand: 01.10.2014),

Mehr

Rechnergestützter VLSI-Entwurf

Rechnergestützter VLSI-Entwurf Schaltungsanalyse Dipl.-Ing. e-mail: rgerndt@iam.de Seite ANA/1 Analyse - Übersicht Überprüfen des Entwurfs auf: - Funktion - Zeitverhalten - Kosten - Leistungsaufnahme - EMV -... Vergleich der Spezifikation

Mehr