Größe: px
Ab Seite anzeigen:

Download ""

Transkript

1 UberrelativeNormgleichungenin algebraischenzahlkorpern Diplom-Mathematiker ClausFieker vorgelegtvon aushaan zurerlangungdesakademischengradeseines dertechnischenuniversitatberlin DoktorsderNaturwissenschaften VomFachbereich3Mathematik genehmigtedissertation. Berlin1997 D83

2 ii Promotionsausschu Vorsitzender: Berichter: ProfessorDr.M.E.Pohst ProfessorDr.J.Becker TagderwissenschaftlichenAussprache:29.April1997 ProfessorDr.G.M.Ziegler

3 Inhaltsverzeichnis Einleitung KapitelI.Grundlagen 1 1.Bezeichnungen 2.BewertungenundPrimideale 43 KapitelII.Einheiten 3.Matrizen 75 2.EineuntereRegulatorabschatzung 1.StrukturderEinheitengruppeinRelativerweiterungen KonstruktionvonEinheiten KapitelIII.Gitter GitteruberoE 1.GitteruberZ 26 iii 29

4 iv 3.AuszahlalgorithmenfuroE-Gitter 3.1.DualeBasis INHALTSVERZEICHNIS 3.2.Ellipse 37 4.EinReduktionsalgorithmusfuroE-Gitter 3.3.Simplex 3.4.Mischformen KapitelIV.Normgleichungen 44 2.NennervonnichtganzenLosungen 1.Grundlagen 51 3.LosenvonNormgleichungen(inRelativerweiterungen) Reduktion KapitelV.Beispiele 1.1."Schonere\Polynome 1.2.SchnelleresAuszahlen 69 Symbolverzeichnis 2.Normgleichungen 76 Literaturverzeichnis Zusammenfassung 87

5 Einleitung mit EinederaltestenDiophantischenGleichungenistdieNormgleichung;furZahlkorperF=E=QsowieeineZahl2E:=Q()wirdeineZahlx2F:=E() esz.b.inderalgebrentheorie([1,chapter7]und[44,lemmata6.1,6.2]). gesuchtoderdernachweis,daeskeinesolchegibt.anwendungenhiervongibt NF=E(x)= InspeziellenSituationenistschonlangebekannt,daobigesProbleminendlich vielenschrittengelostwerdenkann;z.b.fuhrtdiesfurfreellquadratischuber NennerundalleKoezienteneinerLosungangegebenunddamitgezeigt,dadie Fur(relativ-)Galois'scheErweiterungenF=EhatSiegel[48]Schrankenfurden QaufPell'scheGleichungen,dieschonGaussbehandelthat. Gleichungkonstruktivgelostwerdenkann.SpaterhatBartels[3]dieseErgebnisse aufbeliebigeerweiterungenverallgemeinert.mitanderenmethodenalssiegelhat dreiarbeitenistjedochgemeinsam,dadieschrankenvielzugrosind,umdamit Garbanati[25]fur(absolut)Abel'scheKorperebenfallsSchrankenerhalten.Allen inderpraxislosungenzunden. BeidiesendreiAnsatzenwirdzunachstderNennereinermoglichenLosungbeschrankt.IneinemzweitenSchrittwerdendann(endlichviele)Normgleichungen Ordnungen oderallgemeinerinmoduln zulosen,istjedochauchausanderen indenganzenalgebraischenzahlengelost.derspezialfall,normgleichungenin GrundenvonInteresse:UmThue-Gleichungenzulosen,sindwirandenLosungeninteressiert,dieinderGleichungsordnungoE[]uberderMaximalordnungoE voneliegen[5],genauergesagtaneinerparametrisierungalldieserlosungen. FurHauptidealtests(imFalleE=Q)muxeinElementdeszutestendenIdeals 1

6 2sein[20,(1.7)Lemma].Hieristesausreichend,"bisaufVorzeichen\zulosen NF=E(x)=?istauchzulassig;auchreichteshier,eineLosungzunden. EINLEITUNG WeitereSpezialfalleergebensichausEinschrankungenan,i.allg.wirdganz IndieserArbeitistdervonFinckeimRahmenseinerDissertationentwickelteAlgorithmuszumLosenvonNormgleichungeninOrdnungenabsoluterZahlkorper aquivalentzumbestimmenderrelativ-einheiten. algebraischsein.wenneinetorsionseinheitist,istdaslosendernormgleichung (E=Q,[20])verallgemeinert,wobeidieArbeitvonJurk[31]fortgesetztunderweitertwird.FernerwerdenMethodenvonGarbanati[24]verallgemeinert,umigleichungeninKorpernlost. FallvonrelativGalois'schenKorperneinenAlgorithmuszuerhalten,derNorm- NachdemimerstenKapitelzunachsteinigeNotationenvereinbartwerden,untersuchenwirimzweitenKapiteldieWirkungderNormabbildungaufdieEin- wichtigeinvariante,derrelativeregulator,eingefuhrt. heitengruppe.diehiergewonnenenergebnissewerdeneinerseitsfurdieparame- trisierungderlosungsmengebenotigtundandererseits,umdasproblemaufein endlicheszureduzieren.fernerwirddorteinefurdiekomplexitatdesverfahrens ImdrittenKapitelwirddienotigeGittertheoriefurGitteruberZahlkorperneinziellstellenwireineVerallgemeinerungdesLLL-AlgorithmuszurGitterreduktiogefuhrt,diebenotigtwird,umdasEllipsoidverfahrenentwickelnzukonnen.Spe- unddesfincke-pohst-algorithmuszumauszahlenvonellipsoidenvor. aufrelativerweiterungenzuverallgemeinern.furrelativgalois'scheerweiterungebnissedazubenutzt,dasellipsoid-verfahrenzurlosungvonnormgleichungen ImviertenKapitelwerdendanndieindenletztenbeidenKapitelngewonnenenErgenentwickelnwirdanneinVerfahren,umdieLosbarkeitimKorperzuentscheidenundggf.eineLosungzunden.ZusatzlichgebenwirdorteinVerfahrenan, welchesnichtaufdemauszahlalgorithmusberuht,umnormgleichungenmittels S-Einheitenzulosen. ZumSchlugebenwireinigeBeispielean,diesowohldieMachtigkeitdervorgestelltenVerfahrenalsauchderenGrenzendemonstrieren. AndieserStellemochteichmichbeiHerrnProfessorDr.M.E.Pohstherzlich ProfessorDr.G.M.ZieglerfurdieUbernahmedesKoreferatssowiebeiMartin,KlausundJurgenfurdieDurchsichteinervorlaugenFassungdieserArbeit. Gruppebedanken,ohnederenKooperationeineArbeitwiediesenichtentstehen kann. furdiebetreuungwahrendderarbeitdanken.fernerbedankeichmichbeiherrn SchlielichmochteichmichandieserStelleauchbeiallenMitgliedernderKant-

7 Grundlagen KAPITELI Hierwerdenwirzunachstdie(wichtigsten)indieserArbeitverwendetenBezeichnungenfestlegenundeinigetheoretischeVorbemerkungenmachen. WirwollenNormgleichungeninRelativerweiterungenalgebraischerZahlkorperun- 1.Bezeichnungen tersuchen,dazubetrachtenwirdiefolgendesituation(alleangegebeneneigen- schaftenkonnenz.b.in[10,35,42,46]nachgelesenwerden). F=E()Esseif2Z[t]einnormiertes,irreduziblesPolynomvomGrad E=Q() n mundeinenullstellehiervonineinemgeeignetenerweiterungskorper.danniste:=q()einalgebraischerzahlkorper Qm belvomgradnundeinenullstellevongineinempassenden vomgradmuberq.denringderganzenzahlenvonebezeichnenwirmitoe.fernerseinung2oe[t]normiert,irreduzi- Erweiterungskorper,dannsetzenwirF:=E().BezeichneoF jedochi.allg.nichtmehrfreiuberoe.spaterwerdenwirkriterienangeben,um einoe-modulvonrangn.fallsdieklassenzahlvonoegroerals1ist,istof freierz-modulvomrangm,ofistebenfallsdedekind'schund denringderganzenzahlen,oeistdanneindedekindringund entscheidenzukonnen,oboffreiuberoeist.analogesgiltauchfurdie(gebrochenen)idealevoneundf:idealeavonesindfreivomrangmuberz,ideale bvonfsindi.allg.nichtfreiuberoe.hier,wieauchinderganzenarbeit,sind Idealestetsvonf0gverschieden. 3

8 4NF=EseidieIdealnormbezeichnet.Esgiltdann NF=E:F!E:x7!NF=E(x)seidiegewohnlicheNormabbildung,ebenfallsmit I.GRUNDLAGEN NE=QNF=E. NF=QundNE=QseiendieentsprechendenNormabbildungennachQ,esgiltNF=Q= (NF=E(x)):=NF=E(x)oE=NF=E(xoF)=:NF=E((x)): :::,(r1+r2)=(r1+2r2)2cnrdiekomplexennullstellen(r1,r22n0geeignet). genvonenache(i):=(e)(i)cindiekonjugiertenkorpervone.nunsetzenwir DieFortsetzungenderAbbildungen(:)(i):7!(i)aufElieferndannEinbettun- Seiennun(1);:::;(r1)2RdiereellenNullstellenvonfund(r1+1)=(r1+r2+1), dieabbildungennochaufdenzugehorigenpolynomringe[t]fort,indemwirsie nehmen(si,ti2n0geeignet).wegenf(i)=f(i+r2)konnenwirzusatzlichnoch fur1jsiund(i;j)=(i;j+ti)2cmitn=si+2ti,si<jsi+tian- aufdenkoezientenoperierenlassen.dienullstellenderpolynomeg(i)2e(i)[t] (i;j)=(i+r2;j)furr1<ir1+r2und1jnerreichen.nachjurk[31, seien(i;j)mit1jn.dag(i)2r[t]fur1ir1gilt,konnenwir(i;j)2r Bemerkung3.4]nennenwir(si;ti)1ir1dierelativeSignaturvonF=E. In[49]isteinAlgorithmusangegeben,umeinPolynomgZ2Z[t]mitL:= Q[t]=gZQ[t]=Fzubestimmen,sodawirFauchalseinfacheErweiterungvon QzurVerfugunghaben.FernerliefertdieserAlgorithmusauchEinbettungenvon EnachL,vonFnachLundvonLnachF,sodawirbeideDarstellungen(L Zahlkorpern,algebraischenZahlenundalleindieserArbeitvorgestelltenundbenutztenAlgorithmensindinKANTimplementiertundkonnenuberKASH[32] aufgerufenwerden. DieserAlgorithmus,sowieAlgorithmenfurOperationenmitOrdnungen,Idealen, undf)benutzenkonnen,umbeibedarfdiegeeigneterezuwahlen. SeiVQ=Vn. zujederprimzahlp2pqgibtesgenaueinv=vp2vn. Q_[V1QdiekanonischeMengeexponentiellerBewertungenaufQ,d.h., 2.BewertungenundPrimideale FureinenbeliebigenZahlkorperkseiVn. Q3v6=vpistv(p)=0,undesgiltV1Q=f?logjjg. kdiemengederdiskretenbewertungen Qmitvp(p)=1.Furjedes genaueinv2vn. V1Qfortsetzen.Furjedesv2Vn. aufk,dieeinebewertungausvn. QmitVjQ=v.AnalogseiV1 kdenierenwirdenfolgendenp-adischenbetrag: Qfortsetzen,d.h.,furjedesV2Vn. kdiemengederbewertungen,die k gibtes

9 Seip2PQdiejenigePrimzahlmitv(p)6=0,dannsetzenwirjjv:=p?v().Fur v2v1 kseijjv:=exp(?v()),fernerseij0jv:=0furjedesv2vk. 3.MATRIZEN 5 SeinunKeineendlicheErweiterungvonk.AufgrundunsererNormierungbesteht VKausschlielichausFortsetzungenvonElementenausVk.WirschreibenVjvfalls V2VKeineFortsetzungvonv2Vkist.IndiesemFallsei wobeikvwievervollstandigungvonkbzgl.dervonvinduziertentopologieist nvjv:=nv;k:=[kv:kv]=nv;q undkvdievervollstandigungvonkbzgl.v.esgiltderfurdiesearbeitwichtige nv;q; ZusammenhangzwischendenBetragen,ihrenFortsetzungenundderNorm: jnk=k(x)jv=(y V2VK VjvjxjnV;Q V)1=nv;Q=Y oder(additivgeschrieben)v(nk=k(x))=x V2VK VjvjxjnV;k V (1-1) furx2kundv2vk. V2VK VjvnV;kV(x) FernergiltdieProduktformel: v2vkjxjnv;q Y 3.Matrizen v =1: SeiReinRing.FureinebeliebigeMatrixM2Rn0m0istMi;jdasj-teElement AbkurzungenundSchreibweisenvereinbaren. DawirimnachstenAbschnittvielmitMatrizenarbeitenwerden,wollenwireinige deri-tenzeile,esgiltm=(mi;j)1in0 1jm0.Mtr:=(M0i;j)1im0 Eintragegleichrsind,furRunitarbezeichneIn02Rn0n0dieEinheitsmatrix,d.h. FureinRingelementr2RseiRn0n03rn0:=(r)1in0 1jn0dieMatrix,beideralle 1jn0mitM0i;j=Mj;i. bezeichnenwirdiematrixausrn0(m0+m00),derenspaltendurchanhangender (In0)i;j=i;j:=8<:1i=j 0sonst..SeinunN2Rn0m00eineweitereMatrix.Mit(MjN)

10 6SpaltenvonNandievonMentstehen,(MjN)i;j=8<:Mi;j I.GRUNDLAGEN ist Mtr Ntr!=(MjN)tr.FurMatrizenMi2Rnimi(1io)ist Ni;j?m0sonst..Analog jm0 diag(m1;:::;mo):= 0 M Mo 0. 1 CA2RPoi=1niPoi=1mi:

11 EinheiteninRelativerweiterungen KAPITELII ObwohlRelativerweiterungenschonlangeruntersuchtwerden,gibtesbisherkaum Ansatze,diebesondereStrukturdieserKorperbeiderBerechnungderEinheiten dergaloisgruppegibteshierkaumeigenschaften,diesichmitrelativenmethodenuntersuchenlassen.diewesentlicheschwierigkeitliegtdarinbegrundet,da Strukturinformationist,diewirzusatzlichbenutzenwollen. dieeigenschafteinerzahlx2of,eineeinheitzusein,nichtvonderstruktur auszunutzen.imgegensatzzuz.b.derberechnungdermaximalordnungoder vonofalsoe-moduloderz-modulabhangtund,daesimwesentlichendiese FurdieStrukturderEinheitengruppeUkinbeliebigenZahlkorpernkgiltzunachst einmalderdirichlet'scheeinheitensatz: Satz2.1.SeikeinZahlkorper.DanngibtesEinheiteni2ok(1i#V1 1=:r)und2okmit Uk=hih1ihri; k? wobeidasproduktdirektistundhiiunendlichezyklischegruppensind.furdie GruppederTorsionseinheitenTUkvonkgilt:TUk=hi. HierauserhaltenwireineDarstellungvonUF,dievolligunabhangigvonderStrukturvonoFalsoE-Modulist.IndiesemKapitelwerdenwireineandereDarstellung Rollespielen.DieseEinheitensindauchfurdasLosenvonNormgleichungenwichtig. SchonsehrfruhhatsichArtin[2]mitEinheitenderNorm1inrelativ-galoisschen stemimwesentlichendurchdieanwendungdergalois-automorphismenaufeine Zahlkorpernbeschaftigt.Erzeigte,daeinmaximalesunabhangigesEinheitensy- vonufnden,diediezusatzlichestrukturinformationberucksichtigt.speziell dieeinheiten,derennormtorsionseinheitensind,werdendorteineentscheidende 7

12 8kleineMengevonEinheitenausEerhaltenwerdenkann.IndiesemSpezialfall erhaltersoauchdennachfolgendensatz2.5. II.EINHEITEN EsgibtverschiedeneAnsatze,dieEinheitengruppeUk oderwenigstenseine stimmtetypenvonabel'schenzahlkorpernhatz.b.leopoldt[37,38]einmaxi- malessystemunabhangigereinheitenauszyklischenteilkorpernbestimmt.fur dadieeinheitengeeigneterteilkorperentsprechend"geliftet\werden.furbe- UntergruppeUUkvonendlichemIndex(Uk:U) dadurchzuerhalten, ist,hatholzberg[27]gezeigt,daeineuntergruppevonendlichemindeximmer ausdeneinheitenderteilkorpererhaltenwerdenkann.indiesemfallgibtes denfall,dafdiegalois'schehulleeinesnichtabel'schenquartischenkorpers auchabschatzungenfurdenindex. FurCM-Korperistschonlangebekannt,dadieEinheitengruppeeinfachausder EinheitengruppedesmaximalenreellenTeilkorperskonstruiertwerdenkann,da esauchkriterien,umdenindexzubestimmen. dieeinheitenrangeidentischsind.weiteristbekannt,daderindex(imwesentlichen)maximal2ist[52,theorem4.12].imfallvonkreisteilungskorperngibt Hierwerdenwirgenaueruntersuchen,wiedieEinheitengruppevonFvonder deutungfurdaslosenvonnormgleichungeninrelativerweiterungen.ahnliche KonstruktionensindvonKlebel[33]zumLosenvonbestimmtenEinheitengleichungenbenutztworden.Esistzuerwarten,damitHilfedieserErgebnissesich zumindestdietheoriezumlosenvonthue-gleichungenaufdenrelativenfall DernachfolgenddenierterelativeRegulatorunterscheidetsichvonderin[14] gegebenendenitiondadurch,dahierkeineabsoluteninvariantenvonf=qin ubertragenlat. vonebeeinutwird.diehiervorgestelltenergebnissesindvonzentralerbeschlielich"relativeinvarianten\benutzt.in[4]wirdeinevariantevonsatz2.9 derdenitionbenutztwerden.inderhiergegebenendenition2.8werdenaus- alsdenitionverwendet. FurdasLosenvonNormgleichungenistdieKenntnisderEinheitenausF,deren NormenbestimmteEigenschaftenhaben,wichtig.Imfolgendenwerdenwirdaher 1.StrukturderEinheitengruppeinRelativerweiterungen (2-1) dieoperationdernormabbildungaufdereinheitengruppeuntersuchen. FurdasganzeKapitelxierenwireineendlicheMengeV1 SF:=fV2VFj9v2SE:Vjvg: ESEVEundsetzen

13 Furjedesv2VEsei Pv:=fV2VFjVjvg: 1.STRUKTUR 9 FixierenuneinbeliebigesVv2Pv(8v2VE)undsetze Definition2.2.SeienSEundSFwieobengegeben.DannnennenwirdieElementevon SF:=Sv2SE_ Pv. UF;SF:=fx2Fj8V2VFnSF:V(x)=0g UE;SE:=fx2Ej8v2VEnSE:v(x)=0g (2-2) FernerseienrE:=#SE,rF:=#SFund_ Pv:=PvnfVvg;rv:=#Pv: _ diese-einheitenvonebzw.sf-einheitenvonf. Bemerkung2.3. FureineUntergruppeAUE;SEdenierenwirUAF;SF:=NF=E?1(A)\UF;SF. (2)EsgiltderDirichlet'scheEinheitensatz:UE;SE=hih1ihrE?1i[35, UF=UF;SF. V,x1],wobeieinegeeigneteEinheitswurzelist(esgiltTUE=TUE;SE= (1)FurSE=V1 E(undSF=V1F)giltUE=UE;SEund (4)OenbargiltAUAF;SF,daNF=E(A)=Anist. (3)Nach(2-1)und(1-1)geltenNF=E(UF;SF)UE;SEundUE;SEUF;SF. hi)und1;:::;re?1grundeinheitensind(d.h.,siehabenunendlicheordnung,dasproduktistdirektundsieerzeugendieganzegruppe). AlsnachsteswollenwirdieStrukturvonUAF;SFbestimmen.Dazubenotigenwir folgendeslemma: Lemma2.4.FurATUEgilt:UAF;SF=TUFistfreivomRangrF?rE. Beweis.NachBemerkung2.3.(2)sindUF;SF=TUFunddaherauchjedeUntergruppehiervonfrei.EsbleibtdahernochdieDimensionsaussagezuzeigen:Da undausnf=e(x)=xnfurjedesx2e:(bezeichnethierz-modulisomorphien) einmodulhomomorphismusist,folgtausdemisomorphiesatzfurfreiez-moduln ~NF=E:UF;SF=TUF!UE;SE=TUE:xTUF7!NF=E(x)TUE unddaherrgkern~nf=e=rf?re.mittuseafureingeeignetess2nfolgt danndiebehauptung. UE;SE=TUEBild~NF=EUF=TUF=Kern~NF=E;

14 10 Satz2.5.SeiUUAF;SFeineUntergruppevonendlichemIndex.Danngibtes unabhangigeeinheiteni2u(1irf?re+rga=:r)sowieeinetorsionseinheit,soda SeienATUEbeliebig,UUF;SFvonendlichemIndex.DanngibtesEinheiten i2u(1irf?re),~i2u(1ire?1)sowieeinetorsionseinheit,so U=hih1ihri: II.EINHEITEN da und UF;SF\U=(UAF;SF\U)h~1ih~rE?1i UAF;SF\U=hih1ihrF?rEi gelten. FurdenFallE=QundA=f1g=TUQerhaltenwirwiederdenDirichlet'schen EinheitensatzalsSpezialfall. Beweis.DirekteKonsequenzausBemerkung2.3.(4)undLemma2.4. ImweiterenseienATUEbeliebigundUUF;SF,vonendlichemIndexxiert. WirwerdenimfolgendeneinenRegulatorfurUAF;SF\Uerklaren,derdieklassische Denitionerweitert.Diesermoglichtunsdann,AbschatzungenfurdenIndex (UTUE einmafurdiekomplexitatdesspatervorgestelltenalgorithmuszumlosenvon wegenderhohenkorpergradesehraufwendigist[55].fernerwirddieserregulator zubestimmen,wasspeziellimletztenschritt(aufstiegzufundamentaleinheiten) F;SF:(UTUE F;SF\U))anzugeben,umUTUE F;SFauszurechnen,ohnezunachstUF;SF (2-3) Normgleichungendarstellen. Seiennun LF:UF;SF!RSF:7!(nV;EV())V2SF; daheristdannlf(uaf;sf)eingittervomrangrf?re. (2-4) deniert.nach[35,v,x1]istlf(uf;sf)eingittervomrangrf?1imrsf; _LF:UF;SF!R_ SF:7!(nV;EV())V2_ Lemma2.6. (1)SeiB2Rn0n0mitBi;j=a+i;jbi,a;bi2R.Danngilt detb=(n0 Yi=1bi)(an0 Xi=11bi+1):

15 (2)SeienB2Rn0n0,C2Rm0n0beliebig.FurB0:=B 1.STRUKTUR CBgeltendann 11 B0trB0=Btr(In0+CtrC)Bunddet(B0trB0)=det2Bdet(In0+CtrC). Speziellgiltfurm0=1,d.h.C=(c1;:::;cn0): det(in0+ctrc)=1+n0 Xi=1c2i: Beweis.(1):Siehe[46,5.6Exercise1]. (2):Esgilt: (B0trB0)i;j=n0+m0 =(BtrB)i;j+((CB)tr(CB))i;j=(Btr(In0+CtrC)B)i;j Xl=1B0l;iB0l;j=n0 Xl=1Bl;iBl;j+m0 Xl=1(CB)l;i(CB)l;j DaalleMatrizenquadratischsind,folgtdieAussageuberdieDeterminanten. Seinunm0=1undD:=diag(c1;:::;cn0).Wirerhalten: Mit(1)angewendetaufa=1,bi=c?2 In0+CtrC=In0+((1;:::;1)D)tr(1;:::;1)D =D(D?2+1n0)D: det(in0+ctrc)=det2(d)n0 ifolgtdaher: =n0 Xi=1c2i+1: Yi=1c?2 i(n0 Xi=1c2i+1) (1irF?rE),~i2U(1irE?1)und2TUFmit WirxierennuneinmaximalesunabhangigesEinheitensystemi2UTUE U=hih1ihrF?rEih~1ih~rE?1i: F;SF\U NachSatz2.5gibtessolcheEinheiten.Deniere :UTUE F;SF\U!ZrF?rE:=rF?rE Yi=1ni i7!(ni)1irf?re;

16 12 sowiemitfv1;:::;vreg=se,fv1;:::;vrv?1g=_ II.EINHEITEN :SF!N:V7!8<:Pi?1 l=1(rvl?1)+j?1furv=vj2_ PveineAnordnung Damitist(SF)=[1;rF]und(_ rf?re+i SF)=[1;rF?rE].Furx2RSFseiRrF3 furv=vviwiein(2-2): Pvi (x):=(x(i))1irf.mit und L:=(n?1(i);E?1(i)(j))1irF 1jrF?rE2RrF(rF?rE) erhaltenwirdanndiebeidenkommutativendiagramme: L:=(n?1(i);E?1(i)(j))1irF?rE _ 1jrF?rE2R(rF?rE)(rF?rE) UTUE F;SF\U?y???!RSF LF ZrF?rE???!RrF L?y und UTUE F;SF\U?y???!R LF?y SF ZrF?rE???!RrF?rE: Lemma2.7.Sei?:=[0;1]rF?rE.Danngelten: L_ (2)vol(_ (1)volrF?rE(L?)=qQv2SErvvol(_ ziellgewahlteneinheitensystem. L?)istunabhangigvonderAnordnungderBewertungenunddemspe- Beweis.(1):Sei (2-5) z} {?1;:::;?1 rv 1?1 0 z} {?1;:::;?1 rv2?1 :::rvre?1 0 z} { Danngilt:?1;:::;?1 0 1 A: NachLemma2.6.(1)und[23,x5(67)]giltdann: (2-6) det(irf?re+ctrc)=y CtrC=diag(1rv1?1;:::;1rvrE?1): v2serv:

17 Aus(1-1)zusammenmitDenition2.2undBemerkung2.3.(3)folgtfurjedes v2seundjedes2utue F;SF: 1.STRUKTUR 13 (2-7) V2PvnV;EV()=v(NF=E())=0: X AusL= C_ L_ L!,(2-6)undLemma2.6.(2)erhaltenwirdaher Wegenvol2rF?rE(L?)=det(LtrL)[34,AppendixII]undvol2(_ det(ltrl)=det(_ Ltr_ L)Y v2serv: (2):DadieentsprechendenTransformationenunimodularbzw.unitarsind,folgt det2(_ L)istdann(1)bewiesen. L?)=det(_ Ltr_ L)= Definition2.8.WirnennenregF=E(U):=vol(_L?) diebehauptung. Satz2.9.Esgilt: FernerseiregF=E(F):=regF=E(UTUE den(sf-)regulatorvonu(bezuglichf=e). regf=q(u)=(reyi=1nrvi?1 vi;q)regf=e(u)rege=q(nf=e(u)): F;SF). eseins2gl(rf?1;r)mit~l= Beweis.Setze~L:=(LjLF(~1);:::;LF(~rE?1)).Darg_ L0rF?rE L=rF?rEgilt,gibt wobei(wiein(2-7))furjedesv2se B!S; und V2PvnV;EV(i)=v(NF=E(i))=0 X geltenunddahero.b.d.a.bvonfolgenderformist: V2PvnV;EV(~i)=v(NF=E(~i)) X B=(vi(NF=E(~j)))1irE 1jrE?1:

18 14 SeienL0,~L0undB0durchStreichenderletztenZeilevonL,~LundBdeniert. Danngelten: II.EINHEITEN ~L0= Sei 0 D1:=diag(n?1(1);Q n?1(1);e;:::;n?1(rf?1);q n?1(rf?1);e)2rrf?1rf?1 *B01AS: Dannsinddenitionsgema sowie D2:=diag(nv1;Q;:::;nvrE?1;Q)2RrE?1rE?1: und det(d2b0)=rege=q(nf=e(u)) Daherfolgt: regf=q(u)=det(d1)det(~l0) det(d1~l0)=regf=q(u): =det(d1)det(_l)det(b0) =rf?1 det(d2)regf=e(u)rege=q(nf=e(u)) undmitnv;q nv;e=nv;qfurjedesvjvkonnenwirweiterschlieen: Yi=1n?1(i);Q n?1(i);ere?1 Yi=11 nvi;qregf=e(u)rege=q(nf=e(u)); =reyi=1nrvi?1 vi;qnvren?1(rf);e vi;qregf=e(u)rege=q(nf=e(u)): n?1(rf);qregf=e(u)rege=q(nf=e(u)) Bemerkung2.10. DenitiondesRegulators,d.h.,esgilt: (1)FurE=QundSE=V1 reg(u)=regf=q(u): Eerhaltenwirwiederdiealte (2)FurSE=V1 reg(u)=2r2(n?1)regf=e(u)rege=q(nf=e(u)) Egilt=2r2(n?1)regF=E(U)(UE:TUENF=E(U))reg(UE):

19 2.EINEUNTEREREGULATORABSCHATZUNG 15 (3)Beiderin[14]gegebenenDenitionentfalltderFaktor2r2(n?1).Diedort gegebenedenitionunterscheidetsichvonunsererindernormierungder FunktionLF(2-3);dortwirdstattmitnV;EmitnV;Qmultipliziert.Ferner wirddortnurderfallse=v1 Ebetrachtet. 2.EineuntereRegulatorabschatzung IndiesemAbschnittseienA:=TUEundSE:=V1 E.Wirwolleneineuntere AbschatzungfurregF=E(F)herleiten,dieesunsermoglicht,mitdenin[55]dargestelltenMethoden,ausgehendvoneinerUntergruppevonendlichemIndex,zuder volleneinheitengruppe"aufzusteigen\.imgegensatzzuunterenschrankenwie z.b.in[22,14]werdenwirkeinea-priori-schrankenerhalten;dafurwirdunsere i.allg.groer,d.h.scharfer,sein. Lemma2.11.DieAbbildung: q:utue F!R0:7!mXi=1nXj=1jlog(j(i;j)j)j2 isteinepositivdenitequadratischeformmitdeterminante dq=2r2(n?1)?pr1 i=1tinr1+r2reg2f=e(f): Beweis.Sei1;:::;rF?rEeinunabhangigesErzeugendensystemfurUTUE F.Dann giltfurx2utue F mitx=0qrf?re i=1i i: q(x)=q(rf?re Yl=1l l) =mxi=1nxj=1(rf?re Xl=1llogj(i;j) lj)2 =rf?re X k;l=1kl(mxi=1nxj=1logj(i;j) kjlogj(i;j) lj) =(l)tr 1lrF?rE(logj(i;j) kj)tr 1im;1jn 1krF?rE (logj(i;j) kj)1im;1jn 1krF?rE (l)1lrf?re =:(l)tr 1lrF?rEB0trB0(l)1lrF?rE:

20 16 Daq(x)alsSummenichtnegativerZahlennichtnegativist,habenwirqalspositivsemidenitnachgewiesen.Daq(x)=0aquivalentzux2TUFist,istdererste II.EINHEITEN TeilderAussagegezeigt. gilt,mussenwirnundetb0trb0berechnen.umdielemmata2.6.(1)und2.6.(2) Weildenitionsgema betrachtenwirdiefolgendenmatrizen: anwendenzukonnen,benotigenwirzunachsteinigehilfsmatrizen:fur1ir1 det(b0trb0)=dq B0i:= 0 logj(i;si+ti) (i;1) 1j j :::logj(i;1) :::logj(i;si+ti) logj(i;si+2ti) logj(i;si+ti+1) j:::logj(i;si+2ti). j:::logj(i;si+ti+1) rf?rej logj(i;si+2ti?1) 1 j:::logj(i;si+2ti?1). rf?re j 1 jca =:0 logj(i;si+ti) Bi logj(i;si+2ti) logj(i;si+ti+1) j j :::logj(i;si+ti) :::logj(i;si+2ti). j:::logj(i;si+ti+1) rf?rej logj(i;si+2ti?1) 1 j:::logj(i;si+2ti?1). rf?re j 1 jca und Ci:= 8 >< > : 0 z?1=2:::?1=2 } { z ti?1 } { 0?1 Iti?1 :::?11CAti>0 Furr1<ir1+r2denierenwiranalog:?1:::?1 n?1 {z } ti=0 1j:::logj(i;1) :. logj(i;n) 1j:::logj(i;n). und rf?rej logj(i;n) 1j:::logj(i;n) Bi rf?rej1a Damitgiltfur1ir1+r2: Ci:=z?1:::?1: n?1 } { B0i=Bi CiBi

21 und 2.EINEUNTEREREGULATORABSCHATZUNG 17 B0=S0 0 B0r1+r2 B 01 B0r1+r2 B0r CA=S 0 Br1+r2 B1 1CA Cr1+r2Br1+r2 Br1+1 C1B1 Cr1+1Br1+1 Br1+r2. Cr1+r2Br1+r2 ; wobeis0,sdienotwendigenzeilenvertauschungendarstellenunddeswegenunitar sind.schlielichseiennoch Br1+r2. 1 CAundC:= 0 C10 :::0 C20... Cr1+10 ::: ::: :::00 1CA :::0 ::: In? Cr1+r2 :::0 :::0 ::: Cr :::... 0In?1 0Cr1+r2 :::0 Damitfolgt : habenwir NachLemma2.6.(2)giltdet(B0trB0)=det2(B)det(I+CtrC).Oensichtlich B0=SB r1yi=12max(0;ti?1)det(b)=regf=e(f) CB: und(mit[23,x5(67)]) det(i+ctrc)=r1yi=1(isi+t1?1+ctr ici)r1+r2 i=r1+1(in?1+2ctr Y ici+in?1):

22 18 bestimmen.fur1r1;ti=0folgtauslemma2.6.(2): Esverbleibtalsonurnochdet(Isi+ti?1+Ctr II.EINHEITEN det(isi+ti?1+ctr ici)=n?1 Xl=1(ci)2l+1=n: ici)bzw.det(2in?1+2ctr ici)zu MirLemma2.6.(1)folgt: Schlielichsei1ir1undti>0.Mit det(2i+2ctr ici)=2n?1(n?1 Xl=11+1)=2n?1n: D:=diag( z} { 12;:::;12;ti?1 si und 1;:::;1) z} { folgtdanndet(isi+ti?1+ctr~ci= 0?1:::?1 Iti?1! ic)=det2(d)det(d?2+~ctr =14si4si2ti?1(2si Xl=114+2si+ti?1 i~ci) =2ti(si 4+ti?1 l=si+112+1) X aus =2tin ) Insgesamtgilt ~Ctr i~ci=diag( 0;:::;0;ti?1 z} { si z} { 1;:::;1)+2si+ti?1: dq=r1yi=14?max(0;ti?1)reg2f=e(f)r1yi=1 =2?Pr1 ti=0nr1yi=1 ti>02ti?2nr1+r2 i=1tinr12(n?1)r2nr2reg2f=e(f) i=r1+12n?1n Y unddiebehauptungfolgt. =2r2(n?1)?Pr1 i=1tinr1+r2reg2f=e(f)

23 Lemma2.12.Fur2.EINEUNTEREREGULATORABSCHATZUNG h1:r0!r:x7!cosh(px)?1; 19 x,y2r0,1gelten: (1)h1(x+y)h1(x)+h1(y), Beweis.(1):Esgiltcosh(x)=P1k=0x2k (2)h1(x)h1(x), (3)h1iststrengmonotonwachsend. h1(x+y)=1xk=11 (2k)!unddaher: 1Xk=11 (2k)!(x+y)k =h1(x)+h1(y): (2k)!(xk+yk) (2):Dakgilt,folgtdieBehauptungwiein(1). Lemma2.13.Seienn02N,n0K2Rund sageunmittelbar. (3):Dasowohlcosh()alsauchpstrengmonotonwachsendsind,folgtdieAus- gegeben.furdasminimummvonh2unterdennebenbedingungen h2:rn0!r:x=(x1;:::;xn0)7!n0 Xi=1x2i (1)Pn0 gilt: (2)Pn0 i=1e?2xik i=1e2xik, Beweis.DurchAdditionderBedingungen(1)und(2)erhaltenwir(cosh(x)= 12(ex+e?x)): M14arcosh2(K?n0+1): (3)Pn0 i=1cosh(2xi)k.

24 20 Lemma2.12.(1)gilt: NachLemma2.12.(3)reichtes,dasMinimumvoncosh(p4h2)abzuschatzen.Mit II.EINHEITEN coshq4h2(x)?1=cosh(vutn0 n0 Xi=1(cosh(j2xij)?1) Xi=1(2xi)2)?1 worausdiebehauptungdannunmittelbarfolgt. =n0 Xi=1(cosh(2xi)?1)K?n0; Lemma2.14.SeiUUFeineUntergruppevonendlichemIndexmitUE<U. Danngilt: Beweis.UnmittelbareFolgeausNF=E(UE)=UnEunddemSatzvonLagrange[40, (UE:TUENF=E(UF))j(UE:TUENF=E(U))jnr1+r2: untereschrankefurregf=e(f):seienr:=pr1 Analog[55,Kapitel2]erhaltenwirnunausLemma2.11undLemma2.13eine Satz1.7.7.]. sukzessivenminimavonqundrdier-tehermiteschekonstante.danngilt: vut2pr1 i=1ti?r2(n?1)qri=1mii=1(si+ti)+r2n?1,m1;:::;mrdie (2-8) eineuntereregulatorschrankebestimmen.dortwerden mittelsdesauszahl- NunkonnenwirmitHilfeeinermodiziertenVersionvon[55,Algorithmus2.7] nr1+r2r regf=e(f): untereschrankefurdiefehlendenminimaermittelt.alternativhierzukonnenwir auchdenungeandertenalgorithmusverwenden,umeineschrankefurregf(f) Algorithmus3.6 diesukzessivenminimateilweisebestimmtundgleichzeitigeine zuerhalten.nachdemwirdien-maximaleobergruppe(d.h.p-maximalfurjedes p2pqmitpjn)vonueinufbestimmthaben,konnenwirmithilfevonsatz2.9 eineuntereschrankeerhalten. InderPraxissolltenbeideSchrankenparallelberechnetwerden,waseinfachzu implementierenist,dadiehauptarbeitimauszahlenundtesteneinergroen MengevonalgebraischenZahlenliegt.

25 Bemerkung2.15.In[45]wirddasMinimumvonRn03x7!Pn0 zudeninlemma2.13gegebenennebenbedingungennochunter 3.KONSTRUKTIONVONEINHEITEN i=1x2izusatzlich 21 abgeschatzt.diedortangegebeneuntereschrankeerforderti.allg.nochdaslosen Xi=1xi=0 n0 mehrereralgebraischergleichungssysteme.furdenfalln0=5istdieschranke Wegenarcosh0(x)!0furx!1gilt explizit,esgilt h212arcosh2(k?5+2 arcosh2(k?n+2 2) 2 ): ImGegensatzzuderin[45]istunsereSchrankejedochexplizitgegeben. d.h.,unsereregulatorschrankeistfurgroeketwahalbsogrowiediein[45]. arcosh2(k?n+1)!1; Hierwollenwirkurzdaraufeingehen,wiedieindenletztenAbschnittenvorgestelltenErgebnissefurpraktischeBerechnungengenutztwerdenkonnen.Zunachst 3.KonstruktionvonEinheiten benotigenwirjedochnochein Lemma2.16. (2)Seienc>0undMc:=fx2oFj8v2V1x (1)Furjedesx2oFgilt:NF=E(x) E:v(NF=E(x))cg: 2oF. Beweis.(1):Konsequenzaus(1-1). DannenthaltMcnurendlichvielebezuglichU1FnichtassoziierteElemente. (2):Analog[46,5(2.3)]:Setze Dannistoensichtlich#~Mc<1,undesreichtzuzeigen,dafurjedes2~Mc diemengen:=fx2ofj8v2v1 ~Mc:=fx2oEj8v2V1 E:NF=E(x)=gnurendlichvielenicht E:v(x)cg: zeigennun,da=2u1fausmodfolgt.seiendazumod assoziierteelementeenthalt.wirxierenein2~mcundsetzet:=of=().wir beliebigausngegebenund2ofmit?=.danngilt:=1+2of

26 22 nach(1).analogfolgt2of.wegennf=e()=nf=e()folgtdann2u1f, mit#t=nf=q()=ne=q()n<1wasdiebehauptungimpliziert. II.EINHEITEN MitHilfediesesLemmasistesmoglich,diein[55,Kapitel3]vorgestelltenMethoden unterzuhilfenahmederimnachstenkapitelvorgestelltenideen auch inrelativerweiterungenzubenutzen.jedochsinddiese"relativenmethoden\viel aufwendigeralsdieentsprechenden"absoluten\.daherlohnensiesichnur,wenn Index)indementsprechendenabsolutenZahlkorperauszurechnen. dierelativestruktureinewesentlicherollespielt.esscheintsinnvollzusein,zuersteinmaximalesunabhangigeseinheitensystem(d.h.uufmitendlichem Erzeugendensystem1;:::;rE?1unddeniereneinenZ-Modulisomorphismus rangvoneundrf?1dervonf.wirxiereninue=tueeinunabhangiges SeinunUUFmitendlichemIndexgegeben,fernerseirE?1derEinheiten- E:UE=TUE!ZrE?1:=rE?1 Yi=1ni i7!(ni)re?1 abhangigenerzeugernvonu=tuf.fernersein2zre?1rf?1=hom(zrf?1;zre?1) AnalogdenierenwirF:U=TUF!ZrF?1fureinbeliebigesfestesSystemvonun- i=1: sogewahlt,dadasfolgendediagrammkommutativist: U=TUFNF=E F?y???!UE=TUE WennwirnundiespaltenreduzierteHermite-NormalformHNF(N)ausrechnen,???!ZrE?1: N?yE erhaltenwireinebasisvonzrf?1undeinsystemvoneinheitenwieinsatz2.5. DieMatrixNkanndadurcherhaltenwerden,dawirdieNormenderErzeuger vonualspotenzproduktderi(1ire?1)darstellen.diesemethodelat zudenfundamentaleinheitenbzw.dernachweis,da(uf:u)=1gilt.o.b.d.a. sichnaturlichauchanwenden,wennsev1 AlsletzterSchrittinderBerechnungderEinheitengruppebleibtnochderAufstieg Egilt. nehmenwirvonnunueuan(ggf.mussenwiruentsprechenderweitern). Mit[55,Algorithmus4.10]vergroernwirnunUso,daUp-maximalfurpjn wird.mitobigemalgorithmusberechnenwirutue erklart,konnenwirnunutue denerforderlichenwurzeltests[55,algorithmus4.20]nichtalleerzeugervonu berucksichtigtwerdenmussen,sondern"nur\dievonutue F bestimmen.einvorteildiesermethodeist,dabei F\U.WieimletztenAbschnitt F \U.

27 WennwirstattUTUE beidesmit[55,algorithmus4.22]erhalten.f\ointeressiertsind,sokonnenwir oderaneinemvertretersystemfurutue F,UTUE 3.KONSTRUKTIONVONEINHEITEN F\ofureinebeliebigeOrdnungooFbestimmenwollen F=UTUE 23

28 24 II.EINHEITEN

29 GitteruberZahlkorpern KAPITELIII FurdasLosenvonNormgleichungen(wieauchfurdiealgorithmischeBehandlung abbildung[46,6(2.6)] additiveuntergruppendesrn,vongroerbedeutung.vermogederminkowski- zahlreicherandererzahlentheoretischerprobleme)sindz-gitter,d.h.diskrete ':E!R m:x7! 0 p2re(x(r1+1)) x(r1) x(1) 1CA p2re(x(r1+r2)) p2im(x(r1+1)) wirdderz-moduloeisomorphzueinemgitterimrmvomrangm. p2im(x(r1+r2)). AufEbetrachtenwirdievon induziertemetrikundauf:='(oe)dievondemskalarproduktdesrminduzierte euklidische.vermogedieserabbildung'kanndievonminkowskibegrundete T2:E!R0:x7!mXi=1jx(i)j2 Methodengibt,umallex2mitxtrxc(0<c2R)zubestimmen[20,(2.15) SpeziellfurdasLosenvonNormgleichungenisteswichtig,daessehreziente "GeometriederZahlen\[41]aufZahlkorperangewendetwerden. Algorithmus]. 25

30 26 ImfolgendenwerdenwirnundieGitterdenitionsoverallgemeinern,daauch RelativordnungenkanonischmitGitternidentiziertwerdenkonnen.Obwohles III.GITTER verschiedenetheoretischeansatzeinderliteraturgibt,gitteruberanderenstrukturenalszzubetrachten[8,11,17,29,39,47,54]undgeometrischemethoden aufrelativerweiterungenzuubertragen[6],gibtesbisherkaumalgorithmische Betrachtungen.Jurk[31]hatinseinerDissertationeineersteVariantefureinen rithmenentwickeln.teiledieseskapitelssindbereitsindenants-iiproceedings AuszahlalgorithmusfurGitteruberZahlkorperngegeben. [19]erschienen. FurdieseneuenGitterwerdenwirdanngeeigneteAuszahl-undReduktionsalgo- WirgebenhiereinenkurzenUberblickuberspaterverwendeteEigenschaftenund AlgorithmenfurGitteruberZ. 1.GitteruberZ Definition3.1.EinZ-GitteristeinediskreteadditiveUntergruppedesRn0. Imweiterenwerdenwirnochzusatzlich[]R=Rn0fordern,d.h.,Z-Gittersollen Satz3.2.SeieinZ-Gitter.Danngibtesi2(1in0)so,da= vollenranghaben.danngiltderfolgende SeinunBeinSkalarproduktaufdemRn0,Q(x):=B(x;x)diezugehorigequadratischeForm.WennwirnuneineGitterbasis1;:::;n0xieren,gibteseine i=1zigilt.dieelemente1;:::;n0bildeneinegitterbasisfur. Pn0 vonderwahlderspeziellenbasisab. (1in0).dZ():=qdet(G)istdieGitterdiskriminantevon,siehangtnicht positivdenitematrixg2rn0n0mitb(x;y)=(x1;:::;xn0)trg(y1;:::;yn0) (x=pn0 i=1xii,y=pn0 i=1yii),gheitdiegram-matrixzudergitterbasisi Seien1;:::;n02linearunabhangig,danngilt Definition3.3.DieZahlenYi=1Q(i)d2Z(): n0 (1in0)heiendiesukzessivenMinimavon. FurdieMinimavongiltderfolgende Mi:=inff2R>0j9x1;:::;xi2Z-lin.unabh.mitQ(xj)(1ji)g

Über relative Normgleichungen in algebraischen Zahlkörpern

Über relative Normgleichungen in algebraischen Zahlkörpern Über relative Normgleichungen in algebraischen Zahlkörpern vorgelegt von Diplom-Mathematiker Claus Fieker aus Haan Vom Fachbereich 3 Mathematik der Technischen Universität Berlin zur Erlangung des akademischen

Mehr

klar. Um die zweite Bedingung zu zeigen, betrachte u i U i mit u i = 0. Das mittlere -Zeichen liefert s

klar. Um die zweite Bedingung zu zeigen, betrachte u i U i mit u i = 0. Das mittlere -Zeichen liefert s Nachtrag zur allgemeinen Vektorraum-Theorie. 1.5.15. Direkte Summen. Sei V ein Vektorraum, seien U 1,..., U t Unterräume, wir schreiben V = U 1 U 2 U t = t i=1 U i falls die folgenden beiden Bedingungen

Mehr

Elemente der Analysis II

Elemente der Analysis II Elemente der Analysis II Kapitel 3: Lineare Abbildungen und Gleichungssysteme Informationen zur Vorlesung: http://www.mathematik.uni-trier.de/ wengenroth/ J. Wengenroth () 15. Mai 2009 1 / 35 3.1 Beispiel

Mehr

Division Für diesen Abschnitt setzen wir voraus, dass der Koeffizientenring ein Körper ist. Betrachte das Schema

Division Für diesen Abschnitt setzen wir voraus, dass der Koeffizientenring ein Körper ist. Betrachte das Schema Division Für diesen Abschnitt setzen wir voraus, dass der Koeffizientenring ein Körper ist. Betrachte das Schema 2x 4 + x 3 + x + 3 div x 2 + x 1 = 2x 2 x + 3 (2x 4 + 2x 3 2x 2 ) x 3 + 2x 2 + x + 3 ( x

Mehr

Chemische Bindung. Wie halten Atome zusammen? Welche Atome können sich verbinden? Febr 02

Chemische Bindung. Wie halten Atome zusammen? Welche Atome können sich verbinden? Febr 02 Chemische Bindung locker bleiben Wie halten Atome zusammen? positiv Welche Atome können sich verbinden? power keep smiling Chemische Bindung Die chemischen Reaktionen spielen sich zwischen den Hüllen der

Mehr

TechnischeUniversitatMunchen ZentrumMathematik Kreditrisiko ModelleundDerivatebewertung Diplomarbeit AlexanderSzimayer von Abgabetermin:12.Mai1999 Betreuer: Themensteller:Prof.Dr.C.Kluppelberg Dr.M.Borkovec

Mehr

9.2. DER SATZ ÜBER IMPLIZITE FUNKTIONEN 83

9.2. DER SATZ ÜBER IMPLIZITE FUNKTIONEN 83 9.. DER SATZ ÜBER IMPLIZITE FUNKTIONEN 83 Die Grundfrage bei der Anwendung des Satzes über implizite Funktionen betrifft immer die folgende Situation: Wir haben eine Funktion f : V W und eine Stelle x

Mehr

KAPITEL 4. Lineare Ausgleichsrechnung Beispiel 4.1. Das Ohmsche Gesetz: U = RI. Eine Meßreihe von Daten:

KAPITEL 4. Lineare Ausgleichsrechnung Beispiel 4.1. Das Ohmsche Gesetz: U = RI. Eine Meßreihe von Daten: KAPITEL 4 Lineare Ausgleichsrechnung Beispiel 41 Das Ohmsche Gesetz: Eine Meßreihe von Daten: U = RI (U i, I i ) (Spannung, Stromstärke), i = 1,, m Aufgabe: man bestimme aus diesen Meßdaten den Widerstand

Mehr

Seminar Analysis Konvexe Funktionen und einige wichtige Ungleichungen

Seminar Analysis Konvexe Funktionen und einige wichtige Ungleichungen Seminar Analysis Konvexe Funktionen und einige wichtige Ungleichungen Michael Schaeer 3.04.03 Abstract This seminar is about convex functions and several imortant ineualities. At the beginning the term

Mehr

Beispiel 11.2. Wenn p ein Polynom vom Grad größer gleich 1 ist, ist q : C Ĉ definiert durch q (z) =

Beispiel 11.2. Wenn p ein Polynom vom Grad größer gleich 1 ist, ist q : C Ĉ definiert durch q (z) = Funktionentheorie, Woche Funktionen und Polstellen. Meromorphe Funktionen Definition.. Sei U C offen und sei f : U gilt, nennt man f meromorph auf U: Ĉ eine Funktion. Wenn folgendes. P := f hat keine Häufungspunkte;.

Mehr

2 Die Darstellung linearer Abbildungen durch Matrizen

2 Die Darstellung linearer Abbildungen durch Matrizen 2 Die Darstellung linearer Abbildungen durch Matrizen V und V seien Vektorräume über einem Körper K. Hom K (V, V ) bezeichnet die Menge der K linearen Abbildungen von V nach V. Wir machen Hom K (V, V )

Mehr

Advanced Encryption Standard. Copyright Stefan Dahler 20. Februar 2010 Version 2.0

Advanced Encryption Standard. Copyright Stefan Dahler 20. Februar 2010 Version 2.0 Advanced Encryption Standard Copyright Stefan Dahler 20. Februar 2010 Version 2.0 Vorwort Diese Präsentation erläutert den Algorithmus AES auf einfachste Art. Mit Hilfe des Wissenschaftlichen Rechners

Mehr

Diskrete Strukturen. Wilfried Buchholz. Skriptum einer 3-std. Vorlesung im Sommersemester 2009 Mathematisches Institut der Universität München

Diskrete Strukturen. Wilfried Buchholz. Skriptum einer 3-std. Vorlesung im Sommersemester 2009 Mathematisches Institut der Universität München Disrete Struturen Wilfried Buchholz Sriptum einer 3-std. Vorlesung im Sommersemester 2009 Mathematisches Institut der Universität München 1 Vollständige Indution Wir setzen hier das System Z = {..., 2,

Mehr

BMU 2005-673. J.A.C. Broekaert. J. Feuerborn. A. Knöchel. A.-K. Meyer. Universität Hamburg, Institut für Anorganische und Angewandte Chemie

BMU 2005-673. J.A.C. Broekaert. J. Feuerborn. A. Knöchel. A.-K. Meyer. Universität Hamburg, Institut für Anorganische und Angewandte Chemie BMU 2005-673 Hochaufgelöste ortsabhängige Multielemtanalysen von mit allgemeintoxischen und radiotoxischen Elementen belasteten Organen/Geweben mit Hilfe der Röntgenmikrosonde und Elektronenmikroskopie

Mehr

3.3 Eigenwerte und Eigenräume, Diagonalisierung

3.3 Eigenwerte und Eigenräume, Diagonalisierung 3.3 Eigenwerte und Eigenräume, Diagonalisierung Definition und Lemma 3.3.1. Sei V ein K-Vektorraum, φ End K (V ), λ K. Wir defnieren den zu λ gehörigen Eigenraum von φ als Dies ist ein Unterraum von V.

Mehr

Projektive Moduln. Lemma/Definition 1.1. Folgende Aussagen für einen R-Modul P sind äquivalent: (i) P erfüllt folgende Liftungseigenschaft:

Projektive Moduln. Lemma/Definition 1.1. Folgende Aussagen für einen R-Modul P sind äquivalent: (i) P erfüllt folgende Liftungseigenschaft: Seminar Summen von Quadraten und K-Theorie Projektive Moduln Im Folgenden sei R ein assoziativer Ring mit Eins, nicht notwendigerweise kommutativ. R-Modul ist im Folgenden stets ein Rechts-R-Modul. Ein

Mehr

Mathematics. - Ueber die Difterentialkovariante erster Ordnung der binären kubischen Difterentialform. Von P. G. MOLENAAR.

Mathematics. - Ueber die Difterentialkovariante erster Ordnung der binären kubischen Difterentialform. Von P. G. MOLENAAR. Mathematics. - Ueber die Difterentialkovariante erster Ordnung der binären kubischen Difterentialform. Von P. G. MOLENAAR. (Communicated by Prof. R. WEITZENBÖCK.) (Communicated at the meeting of December

Mehr

Die Anforderungen der Bankenäufsieht an das haftende Eigenkapital der Kreditinstitute

Die Anforderungen der Bankenäufsieht an das haftende Eigenkapital der Kreditinstitute Die Anforderungen der Bankenäufsieht an das haftende Eigenkapital der Kreditinstitute Eine Untersuchung unter besonderer Berücksichtigung des relevanten Belastungsfalles Von Dr. Jürgen Bauer junstisene

Mehr

! nendes Berufsfeld und die Menschen, die dort arbeiten kennenzulernen. Erlebe ein Stück ihrer täglichen Arbeit mit!

! nendes Berufsfeld und die Menschen, die dort arbeiten kennenzulernen. Erlebe ein Stück ihrer täglichen Arbeit mit! Ty 2020 W W L v W L v W ö K WG I B ö W G K L F F Hy W Ty ö N! : D - B v: E 350 v v. T J ö. I P E B B. I. J v v E V v W. Kö K W K- - W V- T U F E! U B v j By Dy! E T ö -! B. E! ß Z - L....! H P Z F L v

Mehr

Rechtsanwalt Michael Drasdo, Fachanwalt für Miet- und Wohnungseigentumsrecht. Die ordnungsrechtliche Verantwortung des Wohnungseigentumsverwalters

Rechtsanwalt Michael Drasdo, Fachanwalt für Miet- und Wohnungseigentumsrecht. Die ordnungsrechtliche Verantwortung des Wohnungseigentumsverwalters Die ordnungsrechtliche Verantwortung des Wohnungseigentumsverwalters I. Einleitung II. Grundsätze der Ordnungspflicht II. Grundsätze der Ordnungspflicht 1. Gefahrenquelle II. Grundsätze der Ordnungspflicht

Mehr

Übungen zur Ingenieur-Mathematik III WS 2009/10 Blatt 10 21.12.2009

Übungen zur Ingenieur-Mathematik III WS 2009/10 Blatt 10 21.12.2009 Übungen zur Ingenieur-Mathematik III WS 2009/10 Blatt 10 21.12.2009 Aufgabe 35: Thema: Singulärwertzerlegung und assoziierte Unterräume Sei A eine m n Matrix mit Rang r und A = UDV T ihre Singulärwertzerlegung.

Mehr

Typische Eigenschaften von Metallen

Typische Eigenschaften von Metallen Typische Eigenschaften von Metallen hohe elektrische Leitfähigkeit (nimmt mit steigender Temperatur ab) hohe Wärmeleitfähigkeit leichte Verformbarkeit metallischer Glanz Elektronengas-Modell eines Metalls

Mehr

2 Lineare Gleichungssysteme

2 Lineare Gleichungssysteme Beispiel.5: Funktion von Runge (V) Beispiel Martin-Luther-Universität Halle-Wittenberg, NWF III, Institut für Mathematik Martin Arnold: Grundkurs Numerische Mathematik (WiS 27/8) Abbildung.3: Interpolation

Mehr

t r Lineare Codierung von Binärbbäumen (Wörter über dem Alphabet {, }) Beispiel code( ) = code(, t l, t r ) = code(t l ) code(t r )

t r Lineare Codierung von Binärbbäumen (Wörter über dem Alphabet {, }) Beispiel code( ) = code(, t l, t r ) = code(t l ) code(t r ) Definition B : Menge der binären Bäume, rekursiv definiert durch die Regeln: ist ein binärer Baum sind t l, t r binäre Bäume, so ist auch t =, t l, t r ein binärer Baum nur das, was durch die beiden vorigen

Mehr

Von. Dr. Christopher Hilgenstock, LL.M. (Wellington) Rechtsanwalt Fachanwalt für Arbeitsrecht, Hannover

Von. Dr. Christopher Hilgenstock, LL.M. (Wellington) Rechtsanwalt Fachanwalt für Arbeitsrecht, Hannover Das Mindestlohngesetz Von Dr. Christopher Hilgenstock, LL.M. (Wellington) Rechtsanwalt Fachanwalt für Arbeitsrecht, Hannover Verlag C.H. Beck München 2014 Vorwort Inhaltsverzeichnis Literaturverzeichnis

Mehr

PRAKTIKUM REGELUNGSTECHNIK 2

PRAKTIKUM REGELUNGSTECHNIK 2 FACHHOCHSCHULE LANDSHUT Fachbereich Elektrotechnik Prof. Dr. G. Dorn PRAKTIKUM REGELUNGSTECHNIK 2 1 Versuch 2: Übertragungsfunktion und Polvorgabe 1.1 Einleitung Die Laplace Transformation ist ein äußerst

Mehr

Beispiel. Bsp.: Betrachte Schlussweise in: (3) folgt aus (1) und (2), siehe z.b. Resolutionsregel. was ist mit folgender Schlußweise:

Beispiel. Bsp.: Betrachte Schlussweise in: (3) folgt aus (1) und (2), siehe z.b. Resolutionsregel. was ist mit folgender Schlußweise: Theoretische Informatik: Logik, M. Lange, FB16, Uni Kassel: 5.4 Prädikatenlogik mit Gleichheit Resolution 192 Beispiel Bsp.: Betrachte Schlussweise in: 1 Wenn es regnet, dann wird die Straße nass. R N

Mehr

Zylindrisch DC cylindric DC

Zylindrisch DC cylindric DC Ø 6,5 mm bündig flush Stecker M8 connector M8 Ø6.5 Ø6.5 50 45 mm PNP-NO KDCL-65-PSK-ST3 KDCL-65-PSK-2m 93 Ø 6,5 mm nicht bündig non flush Stecker M8 connector M8 Ø6.5 Ø6.5 46 56 4 45 4 2 mm PNP-NO KDCL-065-PSK-ST3

Mehr

II. Klein Gordon-Gleichung

II. Klein Gordon-Gleichung II. Klein Gordon-Gleichung Dieses Kapitel und die zwei darauf folgenden befassen sich mit relativistischen Wellengleichungen, 1 für Teilchen mit dem Spin 0 (hiernach), 2 (Kap. III) oder 1 (Kap. IV). In

Mehr

5. Varianten des Turingmaschinen-Konzeptes I: Varianten der Programmstruktur

5. Varianten des Turingmaschinen-Konzeptes I: Varianten der Programmstruktur 5. Varianten des Turingmaschinen-Konzeptes I: Varianten der Programmstruktur In der Literatur findet sich eine Vielzahl von Varianten des Turingmaschinen-Konzeptes, die sich alle als äquivalent zum Grundkonzept

Mehr

Lineare Algebra - alles was man wissen muß

Lineare Algebra - alles was man wissen muß Statistik für Bioinformatiker SoSe 3 Rainer Spang Lineare Algebra - alles was man wissen muß Der Titel ist natürlich gelogen, aber was wir hier zusammengetragen haben ist zumindest ein Anfang. Weniger

Mehr

Finanzmathematik - Wintersemester 2007/08. http://code.google.com/p/mitgetexed/

Finanzmathematik - Wintersemester 2007/08. http://code.google.com/p/mitgetexed/ Finanzmathematik - Wintersemester 2007/08 http://code.google.com/p/mitgetexed/ Stand: 4. November 2007 Inhaltsverzeichnis 1 Motivation und erste Begriffe 2 2 Endliche Finanzmärkte 4 3 Das Cox-Ross-Rubinstein-Modell

Mehr

Rechtliche Rahmenbedingungen für Internet-Auktionen

Rechtliche Rahmenbedingungen für Internet-Auktionen Juristische Reihe TENEA/ 102 Enno Goldmann Rechtliche Rahmenbedingungen für Internet-Auktionen ENNO GOLDMANN Rechtliche Rahmenbedingungen für Internet-Auktionen Juristische Reihe TENEA/ Bd. 102 Die vorliegende

Mehr

Ein Transfer-Paradoxon bei besteuerten Matrixspielen

Ein Transfer-Paradoxon bei besteuerten Matrixspielen Ein Transfer-Paradoxon bei besteuerten Matrixspielen Diplomarbeit zur Erlangung des akademischen Grades Diplom-Mathematikerin Friedrich-Schiller-Universität Jena Fakultät für Mathematik und Informatik

Mehr

ab (a wird gefunden als die Abcisse des Minimums). so erhält man eine

ab (a wird gefunden als die Abcisse des Minimums). so erhält man eine 24 ab (a wird gefunden als die Abcisse des Minimums). so erhält man eine gerade Linie. Die (:~). Kurve (verg I. Fig. 5) ist ein Parabel. Wenn nun d gröszer als a wird. wird die Kurve wieder steigen. Die

Mehr

Satz 25 A sei eine (n n)-matrix über K

Satz 25 A sei eine (n n)-matrix über K Satz 25 Satz 25 A sei eine (n n)-matrix über K Satz 25 A sei eine (n n)-matrix über K mit paarweise verschiedenen Eigenwerten λ 1,...,λ m. Satz 25 A sei eine (n n)-matrix über K mit paarweise verschiedenen

Mehr

Codierungstheorie Rudolf Scharlau, SoSe 2006 9

Codierungstheorie Rudolf Scharlau, SoSe 2006 9 Codierungstheorie Rudolf Scharlau, SoSe 2006 9 2 Optimale Codes Optimalität bezieht sich auf eine gegebene Quelle, d.h. eine Wahrscheinlichkeitsverteilung auf den Symbolen s 1,..., s q des Quellalphabets

Mehr

2-teilige Wandplatte - FCP. Gewicht Artikelnummer SI US A O.D. (B) Tiefe (C)

2-teilige Wandplatte - FCP. Gewicht Artikelnummer SI US A O.D. (B) Tiefe (C) 2-teilige Wandplatte FCP Für Rohrdurchmesser von DN15/½ bis DN200/8 Material : 1,17mm (0.046 ) kaltgewalzter Stahl A B C 2-teilige Wandplatte - FCP Technische Daten Nominalr Rohrdurchmesser Maße (mm/zoll)

Mehr

Herzlich Willkommen ! " $' #$% (!)% " * +,'-. ! 0 12" 12'" " #$%"& /!' '- 2! 2' 3 45267 2-5267

Herzlich Willkommen !  $' #$% (!)%  * +,'-. ! 0 12 12'  #$%& /!' '- 2! 2' 3 45267 2-5267 Page 1/1 Herzlich Willkommen! " #$%"&! " $' #$% (!)% " * +,'-. /!' '-! 0 12" 12'" 2! 2' 3 45267 2-5267 -26 89 : 9; ;/!!' 0 '6'!!2' 2(' '' ' &! =>! = / 5,?//'6 20%! ' 6', 62 '! @ @! &> $'( #'/

Mehr

Definition 27 Affiner Raum über Vektorraum V

Definition 27 Affiner Raum über Vektorraum V Definition 27 Affiner Raum über Vektorraum V Definition 27 Affiner Raum über Vektorraum V ist die Menge A = Definition 27 Affiner Raum über Vektorraum V ist die Menge A = mit einer Abbildung + : A V A,

Mehr

ssionspapiere der zeppelin university u schnitt diskussionspapiere der zepp

ssionspapiere der zeppelin university u schnitt diskussionspapiere der zepp zeppelin university Hochschule zwischen Wirtschaft, Kultur und Politik ussionspapiere der zeppelin university zu schnitt diskussionspapiere der zepp lin university zu schnitt diskussionspa iere der zeppelin

Mehr

Geometrische Mannigfaltigkeiten

Geometrische Mannigfaltigkeiten Geometrische Mannigfaltigkeiten Thilo Kuessner Abstract Kurzfassung der Vorlesung: Definitionen, Beispiele und Sätze, keine Beweise. Definition 1. Ein topologischer Raum ist eine Menge X mit einer Familie

Mehr

TI II. Sommersemester 2008 Prof. Dr. Mesut Güneş 5. Exercise with Solutions

TI II. Sommersemester 2008 Prof. Dr. Mesut Güneş 5. Exercise with Solutions Distributd mbddd 5. Exrcis with olutions Problm 1: Glitkomma-Darstllung (2+2+2+2+2+2=12) Ghn i bi dr binärn Glitkommadarstllung von 2-Byt großn Zahln aus. Dr Charaktristik sthn 4 Bit zur Vrfügung, dr Mantiss

Mehr

Bewertung von exotischen Optionen im CRR Modell

Bewertung von exotischen Optionen im CRR Modell Bewertung von exotischen Optionen im CRR Modell Bachelorarbeit von Stefanie Tiemann 11. 08. 2010 Betreuer: Privatdozent Dr. Volkert Paulsen Institut für mathematische Statistik Fachbereich Mathematik und

Mehr

Lenstras Algorithmus für Faktorisierung

Lenstras Algorithmus für Faktorisierung Lenstras Algorithmus für Faktorisierung Bertil Nestorius 9 März 2010 1 Motivation Die schnelle Faktorisierung von Zahlen ist heutzutage ein sehr wichtigen Thema, zb gibt es in der Kryptographie viele weit

Mehr

Rechnerstrukturen WS 2012/13

Rechnerstrukturen WS 2012/13 Rechnerstrukturen WS 2012/13 Repräsentation von Daten Repräsentation natürlicher Zahlen (Wiederholung) Repräsentation von Texten Repräsentation ganzer Zahlen Repräsentation rationaler Zahlen Repräsentation

Mehr

Alle Produkte für PKW & LKW finden Sie in unserem Online-Shop www.kuda-phonebase.de

Alle Produkte für PKW & LKW finden Sie in unserem Online-Shop www.kuda-phonebase.de A P ü & S m O-S www.-b. Km b. I Pv v E! KUDA Km KUDA Km KUDA Km KUDA Km M L-. Gä & Nv M L-. Gä, Nv + Nvä Uv F Fü B- F www.-b. KUDA Km M L-. Gä & Nv P m E S G S Nmm S. Nvä b ßb S b. E m, m. L- Gä Km H B,

Mehr

Abschnitt: Algorithmendesign und Laufzeitanalyse

Abschnitt: Algorithmendesign und Laufzeitanalyse Abschnitt: Algorithmendesign und Laufzeitanalyse Definition Divide-and-Conquer Paradigma Divide-and-Conquer Algorithmen verwenden die Strategien 1 Divide: Teile das Problem rekursiv in Subproblem gleicher

Mehr

Theoretische Informatik 2

Theoretische Informatik 2 Theoretische Informatik 2 Johannes Köbler Institut für Informatik Humboldt-Universität zu Berlin WS 2009/10 Entscheidbare und semi-entscheidbare Sprachen Definition Eine NTM M hält bei Eingabe x, falls

Mehr

ANMELDEFORMUL. Fax: +49 30 479 89 800. 29. + 30. September 2015 Frankfurt. sind u.a. Keynotes h gestalte. Intranetp. nungsfeld.

ANMELDEFORMUL. Fax: +49 30 479 89 800. 29. + 30. September 2015 Frankfurt. sind u.a. Keynotes h gestalte. Intranetp. nungsfeld. LDUL PX 9 + 30 p 015 x: +49 30 479 89 800 J, ii i i Pxi ii 0 pi i ii B1 V i ö i ii : iy Vpi 1509015 i : 50 i : 995 Vi ß Pi i 1808015 i : 470 i : 895 60313 /i pi i 1708015 i : 40 i : 795 9 30 p 015 9 p

Mehr

2 3 x3 17. x k dx = x k x k+1 k +1. Mit jeder weiteren partiellen Integration reduziert sich der Grad des Faktors x n, induktiv erhalten wir also

2 3 x3 17. x k dx = x k x k+1 k +1. Mit jeder weiteren partiellen Integration reduziert sich der Grad des Faktors x n, induktiv erhalten wir also Universität Konstanz Fachbereich Mathematik und Statistik Repetitorium Analysis 0 Dr DK Huynh Blatt 8 Aufgabe 6 Bestimmen Sie (a) (x + x 7x+)dx (c) (f) x n exp(x)dx (n N fest) sin (x)dx (g) (b) (d) ln(x)dx

Mehr

III Stochastische Analysis und Finanzmathematik

III Stochastische Analysis und Finanzmathematik III Stochastische Analysis und Finanzmathematik Ziel dieses Kapitels ist es, eine Einführung in die stochastischen Grundlagen von Finanzmärkten zu geben. Es werden zunächst Modelle in diskreter Zeit behandelt,

Mehr

Wettbewerbspolitische Aspekte der Neuregelung des haftenden Eigenkapitals der Sparkassen im Banken aufsichtsrecht

Wettbewerbspolitische Aspekte der Neuregelung des haftenden Eigenkapitals der Sparkassen im Banken aufsichtsrecht Wettbewerbspolitische Aspekte der Neuregelung des haftenden Eigenkapitals der Sparkassen im Banken aufsichtsrecht Von Prof. Dr. Manfred Hieber Universität Bonn DUNCKER & H U M B L O T / BERLIN Inhaltsverzeichnis

Mehr

17. Penalty- und Barriere-Methoden

17. Penalty- und Barriere-Methoden H.J. Oberle Optimierung SoSe 01 17. Penalty- und Barriere-Methoden Penalty- und Barriere Methoden gehören zu den ältesten Ansätzen zur Lösung allgemeiner restringierter Optimierungsaufgaben. Die grundlegende

Mehr

5. Verschiedene Repräsentanten

5. Verschiedene Repräsentanten 5. Verschiedene Repräsentanten 5.1. Die Sätze Hall und König Sei I := {1,...,n}, und sei A(I) = (A 1,...,A n ) eine Familie von Teilmengen einer endlichen Menge E. Zu K I seien A(K) := (A i : i K) und

Mehr

Lösung des Kleinste-Quadrate-Problems

Lösung des Kleinste-Quadrate-Problems Lösung des Kleinste-Quadrate-Problems Computergestützte Statistik Lisakowski, Christof 15.05.2009 Lisakowski, Christof ()Lösung des Kleinste-Quadrate-Problems 15.05.2009 1 / 34 Themen 1 Problemstellung

Mehr

Neubegründung der Lehre vom gedehnten Versicherungsfall und ihre Bedeutung für moderne versicherungsrechtliche Probleme

Neubegründung der Lehre vom gedehnten Versicherungsfall und ihre Bedeutung für moderne versicherungsrechtliche Probleme Veröffentlichungen des Seminars für Versicherungswissenschaft der Universität Hamburg und des Vereins zur Förderung der Versicherungswissenschaft in Hamburg e.v. Reihe A Rechtswissenschaft Heft 86 Herausgeber

Mehr

Globaler Freihandel und Markenrecht

Globaler Freihandel und Markenrecht Reihe: Steuer, Wirtschaft und Recht Band 206 Herausgegeben von vbp StB Prof. Dr. Johannes Georg Bischoff, Wuppertal, Dr. Alfred Kellermann, Vorsitzender Richter (a. D.) am BGH, Karlsruhe, Prof. Dr. Günter

Mehr

Seminararbeit für das SE Reine Mathematik- Graphentheorie

Seminararbeit für das SE Reine Mathematik- Graphentheorie Seminararbeit für das SE Reine Mathematik- Graphentheorie Der binäre Rang, der symplektische Graph, die Spektralzerlegung und rationale Funktionen Vortrag am 24.01.2012 Heike Farkas 0410052 Inhaltsverzeichnis

Mehr

CR 15, CRI 15, CRN-15, CRT 15, CRE 15, CRIE 15, CRNE -15,

CR 15, CRI 15, CRN-15, CRT 15, CRE 15, CRIE 15, CRNE -15, Lenntech info@lenntech.com www.lenntech.com GRUNDFOS DATENEFT CR 15, CRI 15, CRN-15, CRT 15, CRE 15, CRIE 15, CRNE -15, Pumpen nach Maß Kundenspezifische CR-Pumpen für industrielle Anwendungen aller Art

Mehr

. 976. 9. To. 2364/1995 «.,,» ( 252//06121995). 10.. 3//11346/30062003 . 3//.6598. 500mbar.

. 976. 9. To. 2364/1995 «.,,» ( 252//06121995). 10.. 3//11346/30062003 . 3//.6598. 500mbar. 16787 976 28 2012 3//6598 500mbar : 1 63/2005 ( 98// 22042005) 2 381/1989 ( 168// 16061989) 3 2876/7102009 ( 2234// 7102009) 4 110/2011 ( 243//11112011) 5 189/2009 ( 221//5112009) 6 24/2010 189/ 2009 (

Mehr

IMS Isulated Metallic Substrate

IMS Isulated Metallic Substrate Am Euro Platz 1 A1120 Wien Tel +43 (0) 1 683 000 Fax +43 (0) 1 683 009290 Email info@ats.net www.ats.net IMS Isulated Metallic Substrate Ferdinand Lutschounig, Product Manager AT&S Technologieforum, 4.5.

Mehr

Satz 2.8.3: Sei Q eine Intensitätsmatrix. Dann hat die

Satz 2.8.3: Sei Q eine Intensitätsmatrix. Dann hat die Satz 2.8.3: Sei Q eine Intensitätsmatrix. Dann hat die Rückwärtsgleichung P (t) = QP (t), P (0) = E eine minimale nicht negative Lösung (P (t) : t 0). Die Lösung bildet eine Matrix Halbgruppe, d.h. P (s)p

Mehr

Verbraucherkreditgesetz: Anwendungsbereich, Formanforderungen und Pflichtangaben

Verbraucherkreditgesetz: Anwendungsbereich, Formanforderungen und Pflichtangaben Wilhelm Busse Verbraucherkreditgesetz: Anwendungsbereich, Formanforderungen und Pflichtangaben Am Beispiel der Hypothekendarlehensverträge des Landwirts PETER LANG Europäischer Verlag der Wissenschaften

Mehr

Jetzt auch als E-Journal 5 / 2013. www.productivity-management.de. Besuchen Sie uns: glogistikprozesse. Logistiktrends.

Jetzt auch als E-Journal 5 / 2013. www.productivity-management.de. Besuchen Sie uns: glogistikprozesse. Logistiktrends. Jv J -J J J -J -J L L L L L 5 v- - v Nv - v v- IN 868-85 x OUCTIV % G - IN 868-85 L v JN868-85 I J 6 8-85 v- IN 8 -- IZ G T 5 ß G T 68-8 Fä ßvU 8V G T % IN G L ßv ß J T NLGTTGI 5 V IV Fx v v V I ö j L

Mehr

Basis und Dimension. Als nächstes wollen wir die wichtigen Begriffe Erzeugendensystem und Basis eines Vektorraums definieren.

Basis und Dimension. Als nächstes wollen wir die wichtigen Begriffe Erzeugendensystem und Basis eines Vektorraums definieren. Basis und Dimension Als nächstes wollen wir die wichtigen Begriffe Erzeugendensystem und Basis eines Vektorraums definieren. Definition. Sei V ein K-Vektorraum und (v i ) i I eine Familie von Vektoren

Mehr

Das Lastverteilungsproblem

Das Lastverteilungsproblem Das Lastverteilungsproblem Approximationsalgorithmen Referent Franz Brauße Veranstaltung Proseminar Theoretische Informatik Universität Trier, FB IV Dozent Prof. Dr. Henning Fernau 23.02.2012 Übersicht

Mehr

Codierung. Auszug aus dem Skript von Maciej Liśkiewicz und Henning Fernau

Codierung. Auszug aus dem Skript von Maciej Liśkiewicz und Henning Fernau Codierung Auszug aus dem Skript von Maciej Liśkiewicz und Henning Fernau Ein bisschen Informationstheorie Betrachten wir das folgende Problem: Wie lautet eine sinnvolle Definition für das quantitative

Mehr

X = {x 1,x 2,...} sei ein Symbolalphabet eines Kodes. In diesem Kode sind card(x) = X Sachverhalte darstellbar

X = {x 1,x 2,...} sei ein Symbolalphabet eines Kodes. In diesem Kode sind card(x) = X Sachverhalte darstellbar 3. Kodierung Wir wollen Kodierung nicht als Verschlüsselung zum Zwecke der Geheimhaltung auffassen, sondern als Mittel zur Darstellung von Sachverhalten so, daß eine Rechner mit diesen Sachverhalten umgehen

Mehr

3 Stöchiometrie. Teil I: Chemische Formeln. 3.1 Moleküle und Ionen

3 Stöchiometrie. Teil I: Chemische Formeln. 3.1 Moleküle und Ionen 25 3 Stöchiometrie Teil I: Chemische Formeln Zusammenfassung Die Zusammensetzung einer Verbindung wird durch ihre chemische Formel zum Ausdruck gebracht. Wenn die Verbindung aus Molekülen besteht, so gibt

Mehr

MAGAZIN. Sonne im Netz EWG INFORMATIONEN DER BKW GRUPPE. Mitmachen und gewinnen! Begegnung mit der Sonnenkraft

MAGAZIN. Sonne im Netz EWG INFORMATIONEN DER BKW GRUPPE. Mitmachen und gewinnen! Begegnung mit der Sonnenkraft K MZ /1. /01 MZ M D K z y pk bb k D k z: ä? M! MZ /1 MZ /1, Vpä kzäk pv k Köp. bk k bü b. ö v V D,, Db, K. D p, z v bbk, k b. b, b D b k. D x bzm ä, b üb- v k, p. j b ä kp. - z k. pz : b b -Mz kä v vk,

Mehr

Kostenmaße. F3 03/04 p.188/395

Kostenmaße. F3 03/04 p.188/395 Kostenmaße Bei der TM nur ein Kostenmaß: Ein Schritt (Konfigurationsübergang) kostet eine Zeiteinheit; eine Bandzelle kostet eine Platzeinheit. Bei der RAM zwei Kostenmaße: uniformes Kostenmaß: (wie oben);

Mehr

Frank Buchner. Die IT-Versicherung

Frank Buchner. Die IT-Versicherung Frank Buchner Die IT-Versicherung Eine rechtliche Untersuchung der Versicherung von Risiken der Informationstechnologie unter Berücksichtigung bisher angebotener Versicherungskonzepte und deren versicherungsrechtlichen

Mehr

Amerikanischen Optionen

Amerikanischen Optionen Die Bewertung von Amerikanischen Optionen im Mehrperiodenmodell Universität-Gesamthochschule Paderborn Fachbereich 17 Seminar Finanzmathematik SS 2001 Referentin: Christiane Becker-Funke Dozent: Prof.

Mehr

Transistoren. Datensammlung für den praktischen Einsatz. NF-Transistoren bis 30 khz NF-Leistungstransistoren

Transistoren. Datensammlung für den praktischen Einsatz. NF-Transistoren bis 30 khz NF-Leistungstransistoren Ausgabe 2008-04 Transistoren Datensammlung für den praktischen Einsatz NF-Transistoren bis 30 khz NF-Leistungstransistoren Darlingtontransistoren Darlingtonleistungstransistoren HF-Transistoren bis 10

Mehr

LINEARE ALGEBRA Ferienkurs. Hanna Schäfer Philipp Gadow

LINEARE ALGEBRA Ferienkurs. Hanna Schäfer Philipp Gadow LINEARE ALGERA Ferienkurs Hanna Schäfer Philipp Gadow INHALT Eigenwerte und Eigenvektoren. asiswechsel.2 Eigenwertgleichung 2.3 Diagonalisierbarkeit 5.4 Trigonalisierung 8.5 Zusatzmaterial 8 Aufgaben 9

Mehr

3. Regionaltreffen SÜDWEST der Financial Expert Association e.v. (FEA) Der Prüfungsausschuss der Aktiengesellschaft. Dr.

3. Regionaltreffen SÜDWEST der Financial Expert Association e.v. (FEA) Der Prüfungsausschuss der Aktiengesellschaft. Dr. 3. Rff SÜDWES d Ep.V. (E) D üfh d khf zh fü Bd (f Objk) D. Bh 11. Okb 2011, S Übbk 1. Gd d üf- d Übwhpfh 2. fb d üfh 3. Bhhw: D üfh d khf: fd fü d fh 4. W Hw 2 2011 D h GmbH Whfpüfhf 1. Gd d üf- d Übwhpfh

Mehr

Anwendungsübersicht. Allgemeine Befestigungen. Rahmen - Befestigungen. fixing technology. Hohlblocksteine. Vollgips-Platten Lochsteine Hlz, KSL

Anwendungsübersicht. Allgemeine Befestigungen. Rahmen - Befestigungen. fixing technology. Hohlblocksteine. Vollgips-Platten Lochsteine Hlz, KSL Allgemeine Befestigungen Spreizdübel SUPER KEW SD S 18 n n n n n SUPER Universaldübel KEW SU 20 n n n n n n n n n Universaldübel KEW UD 22 n n n n n n n n n Langspreizdübel KEW LSD 24 n n n n n n n Spreizpatrone

Mehr

Descriptor headline. formenbau aluminium Legierungen Weldural & Hokotol

Descriptor headline. formenbau aluminium Legierungen Weldural & Hokotol Descriptor headline formenbau aluminium Legierungen Weldural & Hokotol weldural anwendungsbereiche Blas- und Spritzgussformen für die kunststoffverarbeitende Industrie Formen und hochtemperaturbeanspruchte

Mehr

10 Lesen und Schreiben von Dateien

10 Lesen und Schreiben von Dateien 10 Lesen und Schreiben von Dateien 10 Lesen und Schreiben von Dateien 135 10.1 Mit load und save Binäre Dateien Mit save können Variableninhalte binär im Matlab-Format abgespeichert werden. Syntax: save

Mehr

% &#'! (! )% *'! +,! -! &./# 0 1 2 3 (4 3 5'! 3! 34#'! ( 1# 6'! 7 6 1# " 8 9: &6.$ 5'! ## ";)6$ <, "6;$ #=> 5 7# "6;$

% &#'! (! )% *'! +,! -! &./# 0 1 2 3 (4 3 5'! 3! 34#'! ( 1# 6'! 7 6 1#  8 9: &6.$ 5'! ## ;)6$ <, 6;$ #=> 5 7# 6;$ 953! "#$ % &#'! (! )% *'! +,! -! &./# 0 1 2 3 (4 3 5'! 3! 34#'! ( 1# 6'! 7 6 1# " 8 9: &6.$ 5'! ## ";)6$

Mehr

Herr laß deinen Segen fließen

Herr laß deinen Segen fließen = 122 sus2 1.rr 2.rr lss wir i bit rr lß inn Sgn flißn nn tn 7 S gn fli ßn, ic um i lung, 7 wi in wo Strom ins r wi S sus4 t l Txt un Mloi: Stpn Krnt Mr. wint. sus2 nn Lß wirst u ic spü rn wi i 7 r spi

Mehr

Einführung in MATLAB

Einführung in MATLAB Kapitel 4 Einführung in MATLAB 41 Allgemeines MATLAB ist eine kommerzielle mathematische Software zur Lösung mathematischer Probleme und zur graphischen Darstellung der Ergebnisse Die Verfahren in MATLAB

Mehr

Semidiskretisierung der PDA-Systeme

Semidiskretisierung der PDA-Systeme Kapitel 4 Semidisretisierung der PDA-Systeme Eine Möglicheit zur numerischen Behandlung von Anfangsrandwertproblemen partieller Differentialgleichungen ist die Linienmethode method of lines, MOL, vgl.

Mehr

EN 13479 AWS ER 308L (SI)

EN 13479 AWS ER 308L (SI) AWS ER 308L (SI) Drahtelektrode, filler wire fil dàpport EN ISO 14343 : G 19 9 L Si where. BÖHLER 2,5 Ni-IG Drahtelektrode, filler wire fil dàpport EN ISO 14341-A : G 46 8 M G2Ni2 / EN ISO 14341-A : G

Mehr

WebEDI-Vorschlag. ASCII-Schnittstelle Anbindung von Lieferanten an Handelsunternehmen bewerteter Lieferavis

WebEDI-Vorschlag. ASCII-Schnittstelle Anbindung von Lieferanten an Handelsunternehmen bewerteter Lieferavis ASCII-Schnittstelle Anbindung von Lieferanten an Handelsunternehmen bewerteter Lieferavis Erstellt im August 2003 quibiq.de Internet-Handels-Plattform GmbH Heßbrühlstr. 11 D-70565 Stuttgart email info@quibiq.de

Mehr

11. Dezember 2012, Berlin Industrieworkshop zur Verfügbarkeit von Zirkon für den Industriestandort Deutschland. Die Deutsche Rohstoffagentur (DERA)

11. Dezember 2012, Berlin Industrieworkshop zur Verfügbarkeit von Zirkon für den Industriestandort Deutschland. Die Deutsche Rohstoffagentur (DERA) 11. Dezember 2012, Berlin Industrieworkshop zur Verfügbarkeit von Zirkon für den Industriestandort Deutschland Die Deutsche Rohstoffagentur (DERA) Peter Buchholz Deutsche Rohstoffagentur (DERA) in der

Mehr

Druckmessgeräte SITRANS P

Druckmessgeräte SITRANS P Übersicht Druckmessgeräte STRANS P Aufbau Die Hauptbauteile des Druckmessumformers sind: Messinggehäuse mit Siliziummesszelle und Elektronikplatte Prozessanschluss Elektrischer Anschluss Die Siliziummesszelle

Mehr

Die Liquidation von Personengesellschaften

Die Liquidation von Personengesellschaften Die Liquidation von Personengesellschaften Gewinn- und Verlustverteilung bei der Liquidation der Gesellschaft und beim Ausscheiden eines Gesellschafters Von Dr. jur. Dr. rer. pol. Jürgen Ensthaler B V3

Mehr

Wie löst man Mathematikaufgaben?

Wie löst man Mathematikaufgaben? Wie löst man Mathematikaufgaben? Manfred Dobrowolski Universität Würzburg Wie löst man Mathematikaufgaben? 1 Das Schubfachprinzip 2 Das Invarianzprinzip 3 Das Extremalprinzip Das Schubfachprinzip Verteilt

Mehr

NE-METALLE NE-METALLE

NE-METALLE NE-METALLE NE-METALLE NE-METALLE Inhalt NE-METALLE Allgemeines Werkstoffübersicht... 3 Technische Daten... 4 Aluminium Bleche... 6 Lochbleche... 8 Warzenbleche... 8 Stangen Flachstangen... 9 Rundstangen... 11 Vierkantstangen...

Mehr

Quaternionen, Kampfflugzeuge und Computerspiele

Quaternionen, Kampfflugzeuge und Computerspiele Quaternionen, Kampfflugzeuge und Computerspiele Nikolai Nowaczyk http://math.nikno.de/ Lars Wallenborn http://www.wallenborn.net/ 29.06.-05.07. 2012 Inhaltsverzeichnis

Mehr

ENTWICKLUNG / FERTIGUNG / VERTRIEB

ENTWICKLUNG / FERTIGUNG / VERTRIEB ENTWICKLUNG / FERTIGUNG / VERTRIEB www.endres-seidl.de Excellence in automation Mit Sorgfalt fürs Detail und Blick aufs große Ganze Immer dort vor Ort, wo Sie uns brauchen 25 Jahre Erfahrung im Bereich

Mehr

m RWS Verlag Kommunikationsforum GmbH Köln

m RWS Verlag Kommunikationsforum GmbH Köln Factoring in Krise und Insolvenz 2. Auflage 2011 von RA Dr. Jan Achsnick, Köln RA Dr. Stefan Krüger, Köln m RWS Verlag Kommunikationsforum GmbH Köln Rz. Seite Vorwort V Literaturverzeichnis ~. XIII A.

Mehr

AufderlogischenEbenesollteesmoglichsein,denAusschnittdermodelliertenWeltzu

AufderlogischenEbenesollteesmoglichsein,denAusschnittdermodelliertenWeltzu InformatikIII Datenbanken Sommersemester1992 Prof.Dr.R.Laue GraphikenvonWalterDorwald,HelmutHahnundMartinDobmann ErstelltvonWalterDorwald,MartinDobmannundHelmutHahn Inhalt: A.Literaturverzeichnis...90

Mehr

Ausbildungseinrichtung. Beratungseinrichtung. Zertifizierungsstelle Ausbildungseinrichtung Beratungseinrichtung. QM-System nach ISO 9001/DVWO

Ausbildungseinrichtung. Beratungseinrichtung. Zertifizierungsstelle Ausbildungseinrichtung Beratungseinrichtung. QM-System nach ISO 9001/DVWO Checkliste / Formale Prüfung der Unterlagen zur Zulassung Einrichtung: Bildungsgesellschaft für berufliche Qualifizierung mbh Schotten Zulassung als: Zertifizierungsstelle seinrichtung Beratungseinrichtung

Mehr

13. Binäre Suchbäume

13. Binäre Suchbäume 1. Binäre Suchbäume Binäre Suchbäume realiesieren Wörterbücher. Sie unterstützen die Operationen 1. Einfügen (Insert) 2. Entfernen (Delete). Suchen (Search) 4. Maximum/Minimum-Suche 5. Vorgänger (Predecessor),

Mehr

GNS-Konstruktion und normale Zustände. 1 Rückblick. 2 Beispiel für einen Typ-II 1 -Faktor

GNS-Konstruktion und normale Zustände. 1 Rückblick. 2 Beispiel für einen Typ-II 1 -Faktor GNS-Konstruktion und normale Zustände 1 Rückblick Wir betrachten von-neumann-algebren M B(H), d.h. Unteralgebren mit 1 H M, die in der schwachen Operatortopologie (und damit in jeder der anderen) abgeschlossen

Mehr

Rechtliche Probleme im Streit urn Internet-Domain-Names

Rechtliche Probleme im Streit urn Internet-Domain-Names Susanne Neumann Rechtliche Probleme im Streit urn Internet-Domain-Names PETER LANG Europaischer Veriag der Wissenschaften IX Inhaltsverzeichnis Abkiirzungsverzeichnis Literaturverzeichnis Rechtsprechungsverzeichnis

Mehr

Delisting, Rückzug aus dem amtlichen Handel oder dem geregelten Markt auf Wunsch des Emittenten aus kapitalmarktrechtlicher Sicht

Delisting, Rückzug aus dem amtlichen Handel oder dem geregelten Markt auf Wunsch des Emittenten aus kapitalmarktrechtlicher Sicht Michael Radtke Delisting, Rückzug aus dem amtlichen Handel oder dem geregelten Markt auf Wunsch des Emittenten aus kapitalmarktrechtlicher Sicht PETER LANG Europäischer Verlag der Wissenschaften Inhaltsübersicht

Mehr