Größe: px
Ab Seite anzeigen:

Download ""


1 UberrelativeNormgleichungenin algebraischenzahlkorpern Diplom-Mathematiker ClausFieker vorgelegtvon aushaan zurerlangungdesakademischengradeseines dertechnischenuniversitatberlin DoktorsderNaturwissenschaften VomFachbereich3Mathematik genehmigtedissertation. Berlin1997 D83

2 ii Promotionsausschu Vorsitzender: Berichter: ProfessorDr.M.E.Pohst ProfessorDr.J.Becker TagderwissenschaftlichenAussprache:29.April1997 ProfessorDr.G.M.Ziegler

3 Inhaltsverzeichnis Einleitung KapitelI.Grundlagen 1 1.Bezeichnungen 2.BewertungenundPrimideale 43 KapitelII.Einheiten 3.Matrizen 75 2.EineuntereRegulatorabschatzung 1.StrukturderEinheitengruppeinRelativerweiterungen KonstruktionvonEinheiten KapitelIII.Gitter GitteruberoE 1.GitteruberZ 26 iii 29

4 iv 3.AuszahlalgorithmenfuroE-Gitter 3.1.DualeBasis INHALTSVERZEICHNIS 3.2.Ellipse 37 4.EinReduktionsalgorithmusfuroE-Gitter 3.3.Simplex 3.4.Mischformen KapitelIV.Normgleichungen 44 2.NennervonnichtganzenLosungen 1.Grundlagen 51 3.LosenvonNormgleichungen(inRelativerweiterungen) Reduktion KapitelV.Beispiele 1.1."Schonere\Polynome 1.2.SchnelleresAuszahlen 69 Symbolverzeichnis 2.Normgleichungen 76 Literaturverzeichnis Zusammenfassung 87

5 Einleitung mit EinederaltestenDiophantischenGleichungenistdieNormgleichung;furZahlkorperF=E=QsowieeineZahl2E:=Q()wirdeineZahlx2F:=E() esz.b.inderalgebrentheorie([1,chapter7]und[44,lemmata6.1,6.2]). gesuchtoderdernachweis,daeskeinesolchegibt.anwendungenhiervongibt NF=E(x)= InspeziellenSituationenistschonlangebekannt,daobigesProbleminendlich vielenschrittengelostwerdenkann;z.b.fuhrtdiesfurfreellquadratischuber NennerundalleKoezienteneinerLosungangegebenunddamitgezeigt,dadie Fur(relativ-)Galois'scheErweiterungenF=EhatSiegel[48]Schrankenfurden QaufPell'scheGleichungen,dieschonGaussbehandelthat. Gleichungkonstruktivgelostwerdenkann.SpaterhatBartels[3]dieseErgebnisse aufbeliebigeerweiterungenverallgemeinert.mitanderenmethodenalssiegelhat dreiarbeitenistjedochgemeinsam,dadieschrankenvielzugrosind,umdamit Garbanati[25]fur(absolut)Abel'scheKorperebenfallsSchrankenerhalten.Allen inderpraxislosungenzunden. BeidiesendreiAnsatzenwirdzunachstderNennereinermoglichenLosungbeschrankt.IneinemzweitenSchrittwerdendann(endlichviele)Normgleichungen Ordnungen oderallgemeinerinmoduln zulosen,istjedochauchausanderen indenganzenalgebraischenzahlengelost.derspezialfall,normgleichungenin GrundenvonInteresse:UmThue-Gleichungenzulosen,sindwirandenLosungeninteressiert,dieinderGleichungsordnungoE[]uberderMaximalordnungoE voneliegen[5],genauergesagtaneinerparametrisierungalldieserlosungen. FurHauptidealtests(imFalleE=Q)muxeinElementdeszutestendenIdeals 1

6 2sein[20,(1.7)Lemma].Hieristesausreichend,"bisaufVorzeichen\zulosen NF=E(x)=?istauchzulassig;auchreichteshier,eineLosungzunden. EINLEITUNG WeitereSpezialfalleergebensichausEinschrankungenan,i.allg.wirdganz IndieserArbeitistdervonFinckeimRahmenseinerDissertationentwickelteAlgorithmuszumLosenvonNormgleichungeninOrdnungenabsoluterZahlkorper aquivalentzumbestimmenderrelativ-einheiten. algebraischsein.wenneinetorsionseinheitist,istdaslosendernormgleichung (E=Q,[20])verallgemeinert,wobeidieArbeitvonJurk[31]fortgesetztunderweitertwird.FernerwerdenMethodenvonGarbanati[24]verallgemeinert,umigleichungeninKorpernlost. FallvonrelativGalois'schenKorperneinenAlgorithmuszuerhalten,derNorm- NachdemimerstenKapitelzunachsteinigeNotationenvereinbartwerden,untersuchenwirimzweitenKapiteldieWirkungderNormabbildungaufdieEin- wichtigeinvariante,derrelativeregulator,eingefuhrt. heitengruppe.diehiergewonnenenergebnissewerdeneinerseitsfurdieparame- trisierungderlosungsmengebenotigtundandererseits,umdasproblemaufein endlicheszureduzieren.fernerwirddorteinefurdiekomplexitatdesverfahrens ImdrittenKapitelwirddienotigeGittertheoriefurGitteruberZahlkorperneinziellstellenwireineVerallgemeinerungdesLLL-AlgorithmuszurGitterreduktiogefuhrt,diebenotigtwird,umdasEllipsoidverfahrenentwickelnzukonnen.Spe- unddesfincke-pohst-algorithmuszumauszahlenvonellipsoidenvor. aufrelativerweiterungenzuverallgemeinern.furrelativgalois'scheerweiterungebnissedazubenutzt,dasellipsoid-verfahrenzurlosungvonnormgleichungen ImviertenKapitelwerdendanndieindenletztenbeidenKapitelngewonnenenErgenentwickelnwirdanneinVerfahren,umdieLosbarkeitimKorperzuentscheidenundggf.eineLosungzunden.ZusatzlichgebenwirdorteinVerfahrenan, welchesnichtaufdemauszahlalgorithmusberuht,umnormgleichungenmittels S-Einheitenzulosen. ZumSchlugebenwireinigeBeispielean,diesowohldieMachtigkeitdervorgestelltenVerfahrenalsauchderenGrenzendemonstrieren. AndieserStellemochteichmichbeiHerrnProfessorDr.M.E.Pohstherzlich ProfessorDr.G.M.ZieglerfurdieUbernahmedesKoreferatssowiebeiMartin,KlausundJurgenfurdieDurchsichteinervorlaugenFassungdieserArbeit. Gruppebedanken,ohnederenKooperationeineArbeitwiediesenichtentstehen kann. furdiebetreuungwahrendderarbeitdanken.fernerbedankeichmichbeiherrn SchlielichmochteichmichandieserStelleauchbeiallenMitgliedernderKant-

7 Grundlagen KAPITELI Hierwerdenwirzunachstdie(wichtigsten)indieserArbeitverwendetenBezeichnungenfestlegenundeinigetheoretischeVorbemerkungenmachen. WirwollenNormgleichungeninRelativerweiterungenalgebraischerZahlkorperun- 1.Bezeichnungen tersuchen,dazubetrachtenwirdiefolgendesituation(alleangegebeneneigen-[10,35,42,46]nachgelesenwerden). F=E()Esseif2Z[t]einnormiertes,irreduziblesPolynomvomGrad E=Q() n mundeinenullstellehiervonineinemgeeignetenerweiterungskorper.danniste:=q()einalgebraischerzahlkorper Qm belvomgradnundeinenullstellevongineinempassenden vomgradmuberq.denringderganzenzahlenvonebezeichnenwirmitoe.fernerseinung2oe[t]normiert,irreduzi- Erweiterungskorper,dannsetzenwirF:=E().BezeichneoF jedochi.allg.nichtmehrfreiuberoe.spaterwerdenwirkriterienangeben,um einoe-modulvonrangn.fallsdieklassenzahlvonoegroerals1ist,istof freierz-modulvomrangm,ofistebenfallsdedekind'schund denringderganzenzahlen,oeistdanneindedekindringund entscheidenzukonnen,oboffreiuberoeist.analogesgiltauchfurdie(gebrochenen)idealevoneundf:idealeavonesindfreivomrangmuberz,ideale bvonfsindi.allg.nichtfreiuberoe.hier,wieauchinderganzenarbeit,sind Idealestetsvonf0gverschieden. 3

8 4NF=EseidieIdealnormbezeichnet.Esgiltdann NF=E:F!E:x7!NF=E(x)seidiegewohnlicheNormabbildung,ebenfallsmit I.GRUNDLAGEN NE=QNF=E. NF=QundNE=QseiendieentsprechendenNormabbildungennachQ,esgiltNF=Q= (NF=E(x)):=NF=E(x)oE=NF=E(xoF)=:NF=E((x)): :::,(r1+r2)=(r1+2r2)2cnrdiekomplexennullstellen(r1,r22n0geeignet). genvonenache(i):=(e)(i)cindiekonjugiertenkorpervone.nunsetzenwir DieFortsetzungenderAbbildungen(:)(i):7!(i)aufElieferndannEinbettun- Seiennun(1);:::;(r1)2RdiereellenNullstellenvonfund(r1+1)=(r1+r2+1), dieabbildungennochaufdenzugehorigenpolynomringe[t]fort,indemwirsie nehmen(si,ti2n0geeignet).wegenf(i)=f(i+r2)konnenwirzusatzlichnoch fur1jsiund(i;j)=(i;j+ti)2cmitn=si+2ti,si<jsi+tian- aufdenkoezientenoperierenlassen.dienullstellenderpolynomeg(i)2e(i)[t] (i;j)=(i+r2;j)furr1<ir1+r2und1jnerreichen.nachjurk[31, seien(i;j)mit1jn.dag(i)2r[t]fur1ir1gilt,konnenwir(i;j)2r Bemerkung3.4]nennenwir(si;ti)1ir1dierelativeSignaturvonF=E. In[49]isteinAlgorithmusangegeben,umeinPolynomgZ2Z[t]mitL:= Q[t]=gZQ[t]=Fzubestimmen,sodawirFauchalseinfacheErweiterungvon QzurVerfugunghaben.FernerliefertdieserAlgorithmusauchEinbettungenvon EnachL,vonFnachLundvonLnachF,sodawirbeideDarstellungen(L Zahlkorpern,algebraischenZahlenundalleindieserArbeitvorgestelltenundbenutztenAlgorithmensindinKANTimplementiertundkonnenuberKASH[32] aufgerufenwerden. DieserAlgorithmus,sowieAlgorithmenfurOperationenmitOrdnungen,Idealen, undf)benutzenkonnen,umbeibedarfdiegeeigneterezuwahlen. SeiVQ=Vn. zujederprimzahlp2pqgibtesgenaueinv=vp2vn. Q_[V1QdiekanonischeMengeexponentiellerBewertungenaufQ,d.h., 2.BewertungenundPrimideale FureinenbeliebigenZahlkorperkseiVn. Q3v6=vpistv(p)=0,undesgiltV1Q=f?logjjg. kdiemengederdiskretenbewertungen Qmitvp(p)=1.Furjedes genaueinv2vn. V1Qfortsetzen.Furjedesv2Vn. aufk,dieeinebewertungausvn. QmitVjQ=v.AnalogseiV1 kdenierenwirdenfolgendenp-adischenbetrag: Qfortsetzen,d.h.,furjedesV2Vn. kdiemengederbewertungen,die k gibtes

9 Seip2PQdiejenigePrimzahlmitv(p)6=0,dannsetzenwirjjv:=p?v().Fur v2v1 kseijjv:=exp(?v()),fernerseij0jv:=0furjedesv2vk. 3.MATRIZEN 5 SeinunKeineendlicheErweiterungvonk.AufgrundunsererNormierungbesteht VKausschlielichausFortsetzungenvonElementenausVk.WirschreibenVjvfalls V2VKeineFortsetzungvonv2Vkist.IndiesemFallsei wobeikvwievervollstandigungvonkbzgl.dervonvinduziertentopologieist nvjv:=nv;k:=[kv:kv]=nv;q undkvdievervollstandigungvonkbzgl.v.esgiltderfurdiesearbeitwichtige nv;q; ZusammenhangzwischendenBetragen,ihrenFortsetzungenundderNorm: jnk=k(x)jv=(y V2VK VjvjxjnV;Q V)1=nv;Q=Y oder(additivgeschrieben)v(nk=k(x))=x V2VK VjvjxjnV;k V (1-1) furx2kundv2vk. V2VK VjvnV;kV(x) FernergiltdieProduktformel: v2vkjxjnv;q Y 3.Matrizen v =1: SeiReinRing.FureinebeliebigeMatrixM2Rn0m0istMi;jdasj-teElement AbkurzungenundSchreibweisenvereinbaren. DawirimnachstenAbschnittvielmitMatrizenarbeitenwerden,wollenwireinige deri-tenzeile,esgiltm=(mi;j)1in0 1jm0.Mtr:=(M0i;j)1im0 Eintragegleichrsind,furRunitarbezeichneIn02Rn0n0dieEinheitsmatrix,d.h. FureinRingelementr2RseiRn0n03rn0:=(r)1in0 1jn0dieMatrix,beideralle 1jn0mitM0i;j=Mj;i. bezeichnenwirdiematrixausrn0(m0+m00),derenspaltendurchanhangender (In0)i;j=i;j:=8<:1i=j 0sonst..SeinunN2Rn0m00eineweitereMatrix.Mit(MjN)

10 6SpaltenvonNandievonMentstehen,(MjN)i;j=8<:Mi;j I.GRUNDLAGEN ist Mtr Ntr!=(MjN)tr.FurMatrizenMi2Rnimi(1io)ist Ni;j?m0sonst..Analog jm0 diag(m1;:::;mo):= 0 M Mo 0. 1 CA2RPoi=1niPoi=1mi:

11 EinheiteninRelativerweiterungen KAPITELII ObwohlRelativerweiterungenschonlangeruntersuchtwerden,gibtesbisherkaum Ansatze,diebesondereStrukturdieserKorperbeiderBerechnungderEinheiten dergaloisgruppegibteshierkaumeigenschaften,diesichmitrelativenmethodenuntersuchenlassen.diewesentlicheschwierigkeitliegtdarinbegrundet,da Strukturinformationist,diewirzusatzlichbenutzenwollen. dieeigenschafteinerzahlx2of,eineeinheitzusein,nichtvonderstruktur auszunutzen.imgegensatzzuz.b.derberechnungdermaximalordnungoder vonofalsoe-moduloderz-modulabhangtund,daesimwesentlichendiese FurdieStrukturderEinheitengruppeUkinbeliebigenZahlkorpernkgiltzunachst einmalderdirichlet'scheeinheitensatz: Satz2.1.SeikeinZahlkorper.DanngibtesEinheiteni2ok(1i#V1 1=:r)und2okmit Uk=hih1ihri; k? wobeidasproduktdirektistundhiiunendlichezyklischegruppensind.furdie GruppederTorsionseinheitenTUkvonkgilt:TUk=hi. HierauserhaltenwireineDarstellungvonUF,dievolligunabhangigvonderStrukturvonoFalsoE-Modulist.IndiesemKapitelwerdenwireineandereDarstellung Rollespielen.DieseEinheitensindauchfurdasLosenvonNormgleichungenwichtig. SchonsehrfruhhatsichArtin[2]mitEinheitenderNorm1inrelativ-galoisschen stemimwesentlichendurchdieanwendungdergalois-automorphismenaufeine Zahlkorpernbeschaftigt.Erzeigte,daeinmaximalesunabhangigesEinheitensy- vonufnden,diediezusatzlichestrukturinformationberucksichtigt.speziell dieeinheiten,derennormtorsionseinheitensind,werdendorteineentscheidende 7

12 8kleineMengevonEinheitenausEerhaltenwerdenkann.IndiesemSpezialfall erhaltersoauchdennachfolgendensatz2.5. II.EINHEITEN EsgibtverschiedeneAnsatze,dieEinheitengruppeUk oderwenigstenseine stimmtetypenvonabel'schenzahlkorpernhatz.b.leopoldt[37,38]einmaxi- malessystemunabhangigereinheitenauszyklischenteilkorpernbestimmt.fur dadieeinheitengeeigneterteilkorperentsprechend"geliftet\werden.furbe- UntergruppeUUkvonendlichemIndex(Uk:U) dadurchzuerhalten, ist,hatholzberg[27]gezeigt,daeineuntergruppevonendlichemindeximmer ausdeneinheitenderteilkorpererhaltenwerdenkann.indiesemfallgibtes denfall,dafdiegalois'schehulleeinesnichtabel'schenquartischenkorpers auchabschatzungenfurdenindex. FurCM-Korperistschonlangebekannt,dadieEinheitengruppeeinfachausder EinheitengruppedesmaximalenreellenTeilkorperskonstruiertwerdenkann,da esauchkriterien,umdenindexzubestimmen. dieeinheitenrangeidentischsind.weiteristbekannt,daderindex(imwesentlichen)maximal2ist[52,theorem4.12].imfallvonkreisteilungskorperngibt Hierwerdenwirgenaueruntersuchen,wiedieEinheitengruppevonFvonder deutungfurdaslosenvonnormgleichungeninrelativerweiterungen.ahnliche KonstruktionensindvonKlebel[33]zumLosenvonbestimmtenEinheitengleichungenbenutztworden.Esistzuerwarten,damitHilfedieserErgebnissesich zumindestdietheoriezumlosenvonthue-gleichungenaufdenrelativenfall DernachfolgenddenierterelativeRegulatorunterscheidetsichvonderin[14] gegebenendenitiondadurch,dahierkeineabsoluteninvariantenvonf=qin ubertragenlat. vonebeeinutwird.diehiervorgestelltenergebnissesindvonzentralerbeschlielich"relativeinvarianten\[4]wirdeinevariantevonsatz2.9 derdenitionbenutztwerden.inderhiergegebenendenition2.8werdenaus- alsdenitionverwendet. FurdasLosenvonNormgleichungenistdieKenntnisderEinheitenausF,deren NormenbestimmteEigenschaftenhaben,wichtig.Imfolgendenwerdenwirdaher 1.StrukturderEinheitengruppeinRelativerweiterungen (2-1) dieoperationdernormabbildungaufdereinheitengruppeuntersuchen. FurdasganzeKapitelxierenwireineendlicheMengeV1 SF:=fV2VFj9v2SE:Vjvg: ESEVEundsetzen

13 Furjedesv2VEsei Pv:=fV2VFjVjvg: 1.STRUKTUR 9 FixierenuneinbeliebigesVv2Pv(8v2VE)undsetze Definition2.2.SeienSEundSFwieobengegeben.DannnennenwirdieElementevon SF:=Sv2SE_ Pv. UF;SF:=fx2Fj8V2VFnSF:V(x)=0g UE;SE:=fx2Ej8v2VEnSE:v(x)=0g (2-2) FernerseienrE:=#SE,rF:=#SFund_ Pv:=PvnfVvg;rv:=#Pv: _ diese-einheitenvonebzw.sf-einheitenvonf. Bemerkung2.3. FureineUntergruppeAUE;SEdenierenwirUAF;SF:=NF=E?1(A)\UF;SF. (2)EsgiltderDirichlet'scheEinheitensatz:UE;SE=hih1ihrE?1i[35, UF=UF;SF. V,x1],wobeieinegeeigneteEinheitswurzelist(esgiltTUE=TUE;SE= (1)FurSE=V1 E(undSF=V1F)giltUE=UE;SEund (4)OenbargiltAUAF;SF,daNF=E(A)=Anist. (3)Nach(2-1)und(1-1)geltenNF=E(UF;SF)UE;SEundUE;SEUF;SF. hi)und1;:::;re?1grundeinheitensind(d.h.,siehabenunendlicheordnung,dasproduktistdirektundsieerzeugendieganzegruppe). AlsnachsteswollenwirdieStrukturvonUAF;SFbestimmen.Dazubenotigenwir folgendeslemma: Lemma2.4.FurATUEgilt:UAF;SF=TUFistfreivomRangrF?rE. Beweis.NachBemerkung2.3.(2)sindUF;SF=TUFunddaherauchjedeUntergruppehiervonfrei.EsbleibtdahernochdieDimensionsaussagezuzeigen:Da undausnf=e(x)=xnfurjedesx2e:(bezeichnethierz-modulisomorphien) einmodulhomomorphismusist,folgtausdemisomorphiesatzfurfreiez-moduln ~NF=E:UF;SF=TUF!UE;SE=TUE:xTUF7!NF=E(x)TUE unddaherrgkern~nf=e=rf?re.mittuseafureingeeignetess2nfolgt danndiebehauptung. UE;SE=TUEBild~NF=EUF=TUF=Kern~NF=E;

14 10 Satz2.5.SeiUUAF;SFeineUntergruppevonendlichemIndex.Danngibtes unabhangigeeinheiteni2u(1irf?re+rga=:r)sowieeinetorsionseinheit,soda SeienATUEbeliebig,UUF;SFvonendlichemIndex.DanngibtesEinheiten i2u(1irf?re),~i2u(1ire?1)sowieeinetorsionseinheit,so U=hih1ihri: II.EINHEITEN da und UF;SF\U=(UAF;SF\U)h~1ih~rE?1i UAF;SF\U=hih1ihrF?rEi gelten. FurdenFallE=QundA=f1g=TUQerhaltenwirwiederdenDirichlet'schen EinheitensatzalsSpezialfall. Beweis.DirekteKonsequenzausBemerkung2.3.(4)undLemma2.4. ImweiterenseienATUEbeliebigundUUF;SF,vonendlichemIndexxiert. WirwerdenimfolgendeneinenRegulatorfurUAF;SF\Uerklaren,derdieklassische Denitionerweitert.Diesermoglichtunsdann,AbschatzungenfurdenIndex (UTUE einmafurdiekomplexitatdesspatervorgestelltenalgorithmuszumlosenvon wegenderhohenkorpergradesehraufwendigist[55].fernerwirddieserregulator zubestimmen,wasspeziellimletztenschritt(aufstiegzufundamentaleinheiten) F;SF:(UTUE F;SF\U))anzugeben,umUTUE F;SFauszurechnen,ohnezunachstUF;SF (2-3) Normgleichungendarstellen. Seiennun LF:UF;SF!RSF:7!(nV;EV())V2SF; daheristdannlf(uaf;sf)eingittervomrangrf?re. (2-4) deniert.nach[35,v,x1]istlf(uf;sf)eingittervomrangrf?1imrsf; _LF:UF;SF!R_ SF:7!(nV;EV())V2_ Lemma2.6. (1)SeiB2Rn0n0mitBi;j=a+i;jbi,a;bi2R.Danngilt detb=(n0 Yi=1bi)(an0 Xi=11bi+1):

15 (2)SeienB2Rn0n0,C2Rm0n0beliebig.FurB0:=B 1.STRUKTUR CBgeltendann 11 B0trB0=Btr(In0+CtrC)Bunddet(B0trB0)=det2Bdet(In0+CtrC). Speziellgiltfurm0=1,d.h.C=(c1;:::;cn0): det(in0+ctrc)=1+n0 Xi=1c2i: Beweis.(1):Siehe[46,5.6Exercise1]. (2):Esgilt: (B0trB0)i;j=n0+m0 =(BtrB)i;j+((CB)tr(CB))i;j=(Btr(In0+CtrC)B)i;j Xl=1B0l;iB0l;j=n0 Xl=1Bl;iBl;j+m0 Xl=1(CB)l;i(CB)l;j DaalleMatrizenquadratischsind,folgtdieAussageuberdieDeterminanten. Seinunm0=1undD:=diag(c1;:::;cn0).Wirerhalten: Mit(1)angewendetaufa=1,bi=c?2 In0+CtrC=In0+((1;:::;1)D)tr(1;:::;1)D =D(D?2+1n0)D: det(in0+ctrc)=det2(d)n0 ifolgtdaher: =n0 Xi=1c2i+1: Yi=1c?2 i(n0 Xi=1c2i+1) (1irF?rE),~i2U(1irE?1)und2TUFmit WirxierennuneinmaximalesunabhangigesEinheitensystemi2UTUE U=hih1ihrF?rEih~1ih~rE?1i: F;SF\U NachSatz2.5gibtessolcheEinheiten.Deniere :UTUE F;SF\U!ZrF?rE:=rF?rE Yi=1ni i7!(ni)1irf?re;

16 12 sowiemitfv1;:::;vreg=se,fv1;:::;vrv?1g=_ II.EINHEITEN :SF!N:V7!8<:Pi?1 l=1(rvl?1)+j?1furv=vj2_ PveineAnordnung Damitist(SF)=[1;rF]und(_ rf?re+i SF)=[1;rF?rE].Furx2RSFseiRrF3 furv=vviwiein(2-2): Pvi (x):=(x(i)) und L:=(n?1(i);E?1(i)(j))1irF 1jrF?rE2RrF(rF?rE) erhaltenwirdanndiebeidenkommutativendiagramme: L:=(n?1(i);E?1(i)(j))1irF?rE _ 1jrF?rE2R(rF?rE)(rF?rE) UTUE F;SF\U?y???!RSF LF ZrF?rE???!RrF L?y und UTUE F;SF\U?y???!R LF?y SF ZrF?rE???!RrF?rE: Lemma2.7.Sei?:=[0;1]rF?rE.Danngelten: L_ (2)vol(_ (1)volrF?rE(L?)=qQv2SErvvol(_ ziellgewahlteneinheitensystem. L?)istunabhangigvonderAnordnungderBewertungenunddemspe- Beweis.(1):Sei (2-5) z} {?1;:::;?1 rv 1?1 0 z} {?1;:::;?1 rv2?1 :::rvre?1 0 z} { Danngilt:?1;:::;?1 0 1 A: NachLemma2.6.(1)und[23,x5(67)]giltdann: (2-6) det(irf?re+ctrc)=y CtrC=diag(1rv1?1;:::;1rvrE?1): v2serv:

17 Aus(1-1)zusammenmitDenition2.2undBemerkung2.3.(3)folgtfurjedes v2seundjedes2utue F;SF: 1.STRUKTUR 13 (2-7) V2PvnV;EV()=v(NF=E())=0: X AusL= C_ L_ L!,(2-6)undLemma2.6.(2)erhaltenwirdaher Wegenvol2rF?rE(L?)=det(LtrL)[34,AppendixII]undvol2(_ det(ltrl)=det(_ Ltr_ L)Y v2serv: (2):DadieentsprechendenTransformationenunimodularbzw.unitarsind,folgt det2(_ L)istdann(1)bewiesen. L?)=det(_ Ltr_ L)= Definition2.8.WirnennenregF=E(U):=vol(_L?) diebehauptung. Satz2.9.Esgilt: FernerseiregF=E(F):=regF=E(UTUE den(sf-)regulatorvonu(bezuglichf=e). regf=q(u)=(reyi=1nrvi?1 vi;q)regf=e(u)rege=q(nf=e(u)): F;SF). eseins2gl(rf?1;r)mit~l= Beweis.Setze~L:=(LjLF(~1);:::;LF(~rE?1)).Darg_ L0rF?rE L=rF?rEgilt,gibt wobei(wiein(2-7))furjedesv2se B!S; und V2PvnV;EV(i)=v(NF=E(i))=0 X geltenunddahero.b.d.a.bvonfolgenderformist: V2PvnV;EV(~i)=v(NF=E(~i)) X B=(vi(NF=E(~j)))1irE 1jrE?1:

18 14 SeienL0,~L0undB0durchStreichenderletztenZeilevonL,~LundBdeniert. Danngelten: II.EINHEITEN ~L0= Sei 0 D1:=diag(n?1(1);Q n?1(1);e;:::;n?1(rf?1);q n?1(rf?1);e)2rrf?1rf?1 *B01AS: Dannsinddenitionsgema sowie D2:=diag(nv1;Q;:::;nvrE?1;Q)2RrE?1rE?1: und det(d2b0)=rege=q(nf=e(u)) Daherfolgt: regf=q(u)=det(d1)det(~l0) det(d1~l0)=regf=q(u): =det(d1)det(_l)det(b0) =rf?1 det(d2)regf=e(u)rege=q(nf=e(u)) undmitnv;q nv;e=nv;qfurjedesvjvkonnenwirweiterschlieen: Yi=1n?1(i);Q n?1(i);ere?1 Yi=11 nvi;qregf=e(u)rege=q(nf=e(u)); =reyi=1nrvi?1 vi;qnvren?1(rf);e vi;qregf=e(u)rege=q(nf=e(u)): n?1(rf);qregf=e(u)rege=q(nf=e(u)) Bemerkung2.10. DenitiondesRegulators,d.h.,esgilt: (1)FurE=QundSE=V1 reg(u)=regf=q(u): Eerhaltenwirwiederdiealte (2)FurSE=V1 reg(u)=2r2(n?1)regf=e(u)rege=q(nf=e(u)) Egilt=2r2(n?1)regF=E(U)(UE:TUENF=E(U))reg(UE):

19 2.EINEUNTEREREGULATORABSCHATZUNG 15 (3)Beiderin[14]gegebenenDenitionentfalltderFaktor2r2(n?1).Diedort gegebenedenitionunterscheidetsichvonunsererindernormierungder FunktionLF(2-3);dortwirdstattmitnV;EmitnV;Qmultipliziert.Ferner wirddortnurderfallse=v1 Ebetrachtet. 2.EineuntereRegulatorabschatzung IndiesemAbschnittseienA:=TUEundSE:=V1 E.Wirwolleneineuntere AbschatzungfurregF=E(F)herleiten,dieesunsermoglicht,mitdenin[55]dargestelltenMethoden,ausgehendvoneinerUntergruppevonendlichemIndex,zuder volleneinheitengruppe"aufzusteigen\.imgegensatzzuunterenschrankenwie[22,14]werdenwirkeinea-priori-schrankenerhalten;dafurwirdunsere i.allg.groer,d.h.scharfer,sein. Lemma2.11.DieAbbildung: q:utue F!R0:7!mXi=1nXj=1jlog(j(i;j)j)j2 isteinepositivdenitequadratischeformmitdeterminante dq=2r2(n?1)?pr1 i=1tinr1+r2reg2f=e(f): Beweis.Sei1;:::;rF?rEeinunabhangigesErzeugendensystemfurUTUE F.Dann giltfurx2utue F mitx=0qrf?re i=1i i: q(x)=q(rf?re Yl=1l l) =mxi=1nxj=1(rf?re Xl=1llogj(i;j) lj)2 =rf?re X k;l=1kl(mxi=1nxj=1logj(i;j) kjlogj(i;j) lj) =(l)tr 1lrF?rE(logj(i;j) kj)tr 1im;1jn 1krF?rE (logj(i;j) kj)1im;1jn 1krF?rE (l)1lrf?re =:(l)tr 1lrF?rEB0trB0(l)1lrF?rE:

20 16 Daq(x)alsSummenichtnegativerZahlennichtnegativist,habenwirqalspositivsemidenitnachgewiesen.Daq(x)=0aquivalentzux2TUFist,istdererste II.EINHEITEN TeilderAussagegezeigt. gilt,mussenwirnundetb0trb0berechnen.umdielemmata2.6.(1)und2.6.(2) Weildenitionsgema betrachtenwirdiefolgendenmatrizen: anwendenzukonnen,benotigenwirzunachsteinigehilfsmatrizen:fur1ir1 det(b0trb0)=dq B0i:= 0 logj(i;si+ti) (i;1) 1j j :::logj(i;1) :::logj(i;si+ti) logj(i;si+2ti) logj(i;si+ti+1) j:::logj(i;si+2ti). j:::logj(i;si+ti+1) rf?rej logj(i;si+2ti?1) 1 j:::logj(i;si+2ti?1). rf?re j 1 jca =:0 logj(i;si+ti) Bi logj(i;si+2ti) logj(i;si+ti+1) j j :::logj(i;si+ti) :::logj(i;si+2ti). j:::logj(i;si+ti+1) rf?rej logj(i;si+2ti?1) 1 j:::logj(i;si+2ti?1). rf?re j 1 jca und Ci:= 8 >< > : 0 z?1=2:::?1=2 } { z ti?1 } { 0?1 Iti?1 :::?11CAti>0 Furr1<ir1+r2denierenwiranalog:?1:::?1 n?1 {z } ti=0 1j:::logj(i;1) :. logj(i;n) 1j:::logj(i;n). und rf?rej logj(i;n) 1j:::logj(i;n) Bi rf?rej1a Damitgiltfur1ir1+r2: Ci:=z?1:::?1: n?1 } { B0i=Bi CiBi

21 und 2.EINEUNTEREREGULATORABSCHATZUNG 17 B0=S0 0 B0r1+r2 B 01 B0r1+r2 B0r CA=S 0 Br1+r2 B1 1CA Cr1+r2Br1+r2 Br1+1 C1B1 Cr1+1Br1+1 Br1+r2. Cr1+r2Br1+r2 ; wobeis0,sdienotwendigenzeilenvertauschungendarstellenunddeswegenunitar sind.schlielichseiennoch Br1+r2. 1 CAundC:= 0 C10 :::0 C20... Cr1+10 ::: ::: :::00 1CA :::0 ::: In? Cr1+r2 :::0 :::0 ::: Cr :::... 0In?1 0Cr1+r2 :::0 Damitfolgt : habenwir NachLemma2.6.(2)giltdet(B0trB0)=det2(B)det(I+CtrC).Oensichtlich B0=SB r1yi=12max(0;ti?1)det(b)=regf=e(f) CB: und(mit[23,x5(67)]) det(i+ctrc)=r1yi=1(isi+t1?1+ctr ici)r1+r2 i=r1+1(in?1+2ctr Y ici+in?1):

22 18 bestimmen.fur1r1;ti=0folgtauslemma2.6.(2): Esverbleibtalsonurnochdet(Isi+ti?1+Ctr II.EINHEITEN det(isi+ti?1+ctr ici)=n?1 Xl=1(ci)2l+1=n: ici)bzw.det(2in?1+2ctr ici)zu MirLemma2.6.(1)folgt: Schlielichsei1ir1undti>0.Mit det(2i+2ctr ici)=2n?1(n?1 Xl=11+1)=2n?1n: D:=diag( z} { 12;:::;12;ti?1 si und 1;:::;1) z} { folgtdanndet(isi+ti?1+ctr~ci= 0?1:::?1 Iti?1! ic)=det2(d)det(d?2+~ctr =14si4si2ti?1(2si Xl=114+2si+ti?1 i~ci) =2ti(si 4+ti?1 l=si+112+1) X aus =2tin ) Insgesamtgilt ~Ctr i~ci=diag( 0;:::;0;ti?1 z} { si z} { 1;:::;1)+2si+ti?1: dq=r1yi=14?max(0;ti?1)reg2f=e(f)r1yi=1 =2?Pr1 ti=0nr1yi=1 ti>02ti?2nr1+r2 i=1tinr12(n?1)r2nr2reg2f=e(f) i=r1+12n?1n Y unddiebehauptungfolgt. =2r2(n?1)?Pr1 i=1tinr1+r2reg2f=e(f)

23 Lemma2.12.Fur2.EINEUNTEREREGULATORABSCHATZUNG h1:r0!r:x7!cosh(px)?1; 19 x,y2r0,1gelten: (1)h1(x+y)h1(x)+h1(y), Beweis.(1):Esgiltcosh(x)=P1k=0x2k (2)h1(x)h1(x), (3)h1iststrengmonotonwachsend. h1(x+y)=1xk=11 (2k)!unddaher: 1Xk=11 (2k)!(x+y)k =h1(x)+h1(y): (2k)!(xk+yk) (2):Dakgilt,folgtdieBehauptungwiein(1). Lemma2.13.Seienn02N,n0K2Rund sageunmittelbar. (3):Dasowohlcosh()alsauchpstrengmonotonwachsendsind,folgtdieAus- gegeben.furdasminimummvonh2unterdennebenbedingungen h2:rn0!r:x=(x1;:::;xn0)7!n0 Xi=1x2i (1)Pn0 gilt: (2)Pn0 i=1e?2xik i=1e2xik, Beweis.DurchAdditionderBedingungen(1)und(2)erhaltenwir(cosh(x)= 12(ex+e?x)): M14arcosh2(K?n0+1): (3)Pn0 i=1cosh(2xi)k.

24 20 Lemma2.12.(1)gilt: NachLemma2.12.(3)reichtes,dasMinimumvoncosh(p4h2)abzuschatzen.Mit II.EINHEITEN coshq4h2(x)?1=cosh(vutn0 n0 Xi=1(cosh(j2xij)?1) Xi=1(2xi)2)?1 worausdiebehauptungdannunmittelbarfolgt. =n0 Xi=1(cosh(2xi)?1)K?n0; Lemma2.14.SeiUUFeineUntergruppevonendlichemIndexmitUE<U. Danngilt: Beweis.UnmittelbareFolgeausNF=E(UE)=UnEunddemSatzvonLagrange[40, (UE:TUENF=E(UF))j(UE:TUENF=E(U))jnr1+r2: untereschrankefurregf=e(f):seienr:=pr1 Analog[55,Kapitel2]erhaltenwirnunausLemma2.11undLemma2.13eine Satz1.7.7.]. sukzessivenminimavonqundrdier-tehermiteschekonstante.danngilt: vut2pr1 i=1ti?r2(n?1)qri=1mii=1(si+ti)+r2n?1,m1;:::;mrdie (2-8) eineuntereregulatorschrankebestimmen.dortwerden mittelsdesauszahl- NunkonnenwirmitHilfeeinermodiziertenVersionvon[55,Algorithmus2.7] nr1+r2r regf=e(f): untereschrankefurdiefehlendenminimaermittelt.alternativhierzukonnenwir auchdenungeandertenalgorithmusverwenden,umeineschrankefurregf(f) Algorithmus3.6 diesukzessivenminimateilweisebestimmtundgleichzeitigeine zuerhalten.nachdemwirdien-maximaleobergruppe(d.h.p-maximalfurjedes p2pqmitpjn)vonueinufbestimmthaben,konnenwirmithilfevonsatz2.9 eineuntereschrankeerhalten. InderPraxissolltenbeideSchrankenparallelberechnetwerden,waseinfachzu implementierenist,dadiehauptarbeitimauszahlenundtesteneinergroen MengevonalgebraischenZahlenliegt.

25 Bemerkung2.15.In[45]wirddasMinimumvonRn03x7!Pn0 zudeninlemma2.13gegebenennebenbedingungennochunter 3.KONSTRUKTIONVONEINHEITEN i=1x2izusatzlich 21 abgeschatzt.diedortangegebeneuntereschrankeerforderti.allg.nochdaslosen Xi=1xi=0 n0 mehrereralgebraischergleichungssysteme.furdenfalln0=5istdieschranke Wegenarcosh0(x)!0furx!1gilt explizit,esgilt h212arcosh2(k?5+2 arcosh2(k?n+2 2) 2 ): ImGegensatzzuderin[45]istunsereSchrankejedochexplizitgegeben. d.h.,unsereregulatorschrankeistfurgroeketwahalbsogrowiediein[45]. arcosh2(k?n+1)!1; Hierwollenwirkurzdaraufeingehen,wiedieindenletztenAbschnittenvorgestelltenErgebnissefurpraktischeBerechnungengenutztwerdenkonnen.Zunachst 3.KonstruktionvonEinheiten benotigenwirjedochnochein Lemma2.16. (2)Seienc>0undMc:=fx2oFj8v2V1x (1)Furjedesx2oFgilt:NF=E(x) E:v(NF=E(x))cg: 2oF. Beweis.(1):Konsequenzaus(1-1). DannenthaltMcnurendlichvielebezuglichU1FnichtassoziierteElemente. (2):Analog[46,5(2.3)]:Setze Dannistoensichtlich#~Mc<1,undesreichtzuzeigen,dafurjedes2~Mc diemengen:=fx2ofj8v2v1 ~Mc:=fx2oEj8v2V1 E:NF=E(x)=gnurendlichvielenicht E:v(x)cg: zeigennun,da=2u1fausmodfolgt.seiendazumod assoziierteelementeenthalt.wirxierenein2~mcundsetzet:=of=().wir beliebigausngegebenund2ofmit?=.danngilt:=1+2of

26 22 nach(1).analogfolgt2of.wegennf=e()=nf=e()folgtdann2u1f, mit#t=nf=q()=ne=q()n<1wasdiebehauptungimpliziert. II.EINHEITEN MitHilfediesesLemmasistesmoglich,diein[55,Kapitel3]vorgestelltenMethoden unterzuhilfenahmederimnachstenkapitelvorgestelltenideen auch inrelativerweiterungenzubenutzen.jedochsinddiese"relativenmethoden\viel aufwendigeralsdieentsprechenden"absoluten\.daherlohnensiesichnur,wenn Index)indementsprechendenabsolutenZahlkorperauszurechnen. dierelativestruktureinewesentlicherollespielt.esscheintsinnvollzusein,zuersteinmaximalesunabhangigeseinheitensystem(d.h.uufmitendlichem Erzeugendensystem1;:::;rE?1unddeniereneinenZ-Modulisomorphismus rangvoneundrf?1dervonf.wirxiereninue=tueeinunabhangiges SeinunUUFmitendlichemIndexgegeben,fernerseirE?1derEinheiten- E:UE=TUE!ZrE?1:=rE?1 Yi=1ni i7!(ni)re?1 abhangigenerzeugernvonu=tuf.fernersein2zre?1rf?1=hom(zrf?1;zre?1) AnalogdenierenwirF:U=TUF!ZrF?1fureinbeliebigesfestesSystemvonun- i=1: sogewahlt,dadasfolgendediagrammkommutativist: U=TUFNF=E F?y???!UE=TUE WennwirnundiespaltenreduzierteHermite-NormalformHNF(N)ausrechnen,???!ZrE?1: N?yE erhaltenwireinebasisvonzrf?1undeinsystemvoneinheitenwieinsatz2.5. DieMatrixNkanndadurcherhaltenwerden,dawirdieNormenderErzeuger vonualspotenzproduktderi(1ire?1)darstellen.diesemethodelat zudenfundamentaleinheitenbzw.dernachweis,da(uf:u)=1gilt.o.b.d.a. sichnaturlichauchanwenden,wennsev1 AlsletzterSchrittinderBerechnungderEinheitengruppebleibtnochderAufstieg Egilt. nehmenwirvonnunueuan(ggf.mussenwiruentsprechenderweitern). Mit[55,Algorithmus4.10]vergroernwirnunUso,daUp-maximalfurpjn wird.mitobigemalgorithmusberechnenwirutue erklart,konnenwirnunutue denerforderlichenwurzeltests[55,algorithmus4.20]nichtalleerzeugervonu berucksichtigtwerdenmussen,sondern"nur\dievonutue F bestimmen.einvorteildiesermethodeist,dabei F\U.WieimletztenAbschnitt F \U.

27 WennwirstattUTUE beidesmit[55,algorithmus4.22]erhalten.f\ointeressiertsind,sokonnenwir oderaneinemvertretersystemfurutue F,UTUE 3.KONSTRUKTIONVONEINHEITEN F\ofureinebeliebigeOrdnungooFbestimmenwollen F=UTUE 23


29 GitteruberZahlkorpern KAPITELIII FurdasLosenvonNormgleichungen(wieauchfurdiealgorithmischeBehandlung abbildung[46,6(2.6)] additiveuntergruppendesrn,vongroerbedeutung.vermogederminkowski- zahlreicherandererzahlentheoretischerprobleme)sindz-gitter,d.h.diskrete ':E!R m:x7! 0 p2re(x(r1+1)) x(r1) x(1) 1CA p2re(x(r1+r2)) p2im(x(r1+1)) wirdderz-moduloeisomorphzueinemgitterimrmvomrangm. p2im(x(r1+r2)). AufEbetrachtenwirdievon induziertemetrikundauf:='(oe)dievondemskalarproduktdesrminduzierte euklidische.vermogedieserabbildung'kanndievonminkowskibegrundete T2:E!R0:x7!mXi=1jx(i)j2 Methodengibt,umallex2mitxtrxc(0<c2R)zubestimmen[20,(2.15) SpeziellfurdasLosenvonNormgleichungenisteswichtig,daessehreziente "GeometriederZahlen\[41]aufZahlkorperangewendetwerden. Algorithmus]. 25

30 26 ImfolgendenwerdenwirnundieGitterdenitionsoverallgemeinern,daauch RelativordnungenkanonischmitGitternidentiziertwerdenkonnen.Obwohles III.GITTER verschiedenetheoretischeansatzeinderliteraturgibt,gitteruberanderenstrukturenalszzubetrachten[8,11,17,29,39,47,54]undgeometrischemethoden aufrelativerweiterungenzuubertragen[6],gibtesbisherkaumalgorithmische Betrachtungen.Jurk[31]hatinseinerDissertationeineersteVariantefureinen rithmenentwickeln.teiledieseskapitelssindbereitsindenants-iiproceedings AuszahlalgorithmusfurGitteruberZahlkorperngegeben. [19]erschienen. FurdieseneuenGitterwerdenwirdanngeeigneteAuszahl-undReduktionsalgo- WirgebenhiereinenkurzenUberblickuberspaterverwendeteEigenschaftenund AlgorithmenfurGitteruberZ. 1.GitteruberZ Definition3.1.EinZ-GitteristeinediskreteadditiveUntergruppedesRn0. Imweiterenwerdenwirnochzusatzlich[]R=Rn0fordern,d.h.,Z-Gittersollen Satz3.2.SeieinZ-Gitter.Danngibtesi2(1in0)so,da= vollenranghaben.danngiltderfolgende SeinunBeinSkalarproduktaufdemRn0,Q(x):=B(x;x)diezugehorigequadratischeForm.WennwirnuneineGitterbasis1;:::;n0xieren,gibteseine i=1zigilt.dieelemente1;:::;n0bildeneinegitterbasisfur. Pn0 vonderwahlderspeziellenbasisab. (1in0).dZ():=qdet(G)istdieGitterdiskriminantevon,siehangtnicht positivdenitematrixg2rn0n0mitb(x;y)=(x1;:::;xn0)trg(y1;:::;yn0) (x=pn0 i=1xii,y=pn0 i=1yii),gheitdiegram-matrixzudergitterbasisi Seien1;:::;n02linearunabhangig,danngilt Definition3.3.DieZahlenYi=1Q(i)d2Z(): n0 (1in0)heiendiesukzessivenMinimavon. FurdieMinimavongiltderfolgende Mi:=inff2R>0j9x1;:::;xi2Z-lin.unabh.mitQ(xj)(1ji)g

Matrizennorm. Definition 1. Sei A M r,s (R). Dann heißt A := sup die Matrixnorm. Wir wissen zunächst nicht, ob A eine reelle Zahl ist.

Matrizennorm. Definition 1. Sei A M r,s (R). Dann heißt A := sup die Matrixnorm. Wir wissen zunächst nicht, ob A eine reelle Zahl ist. Matrizennorm Es seien r,s N Mit M r,s (R bezeichnen wir die Menge der reellen r s- Matrizen (also der linearen Abbildungen R s R r, und setze M s (R := M s,s (R (also die Menge der linearen Abbildungen


Lineare Gleichungssysteme

Lineare Gleichungssysteme Lineare Gleichungssysteme Sei K ein Körper, a ij K für 1 i m, 1 j n. Weiters seien b 1,..., b m K. Dann heißt a 11 x 1 + a 12 x 2 +... + a 1n x n = b 1 a 21 x 1 + a 22 x 2 +... + a 2n x n = b 2... a m1


Analysis II. Vorlesung 48. Die Hesse-Form

Analysis II. Vorlesung 48. Die Hesse-Form Prof. Dr. H. Brenner Osnabrück SS 2014 Analysis II Vorlesung 48 Die Hesse-Form Wir sind natürlich auch an hinreichenden Kriterien für das Vorliegen von lokalen Extrema interessiert. Wie schon im eindimensionalen





7 Die Determinante einer Matrix

7 Die Determinante einer Matrix 7 Die Determinante einer Matrix ( ) a11 a Die Determinante einer 2 2 Matrix A = 12 ist erklärt als a 21 a 22 det A := a 11 a 22 a 12 a 21 Es ist S 2 = { id, τ}, τ = (1, 2) und sign (id) = 1, sign (τ) =


Effiziente Algorithmen und Datenstrukturen I. Kapitel 10: Lineare Algebra

Effiziente Algorithmen und Datenstrukturen I. Kapitel 10: Lineare Algebra Effiziente Algorithmen und Datenstrukturen I Kapitel 10: Lineare Algebra Christian Scheideler WS 2008 19.02.2009 Kapitel 10 1 Überblick Notation Arithmetik auf großen Zahlen (Addition und Multiplikation)


TechnischeUniversitatMunchen ZentrumMathematik Uberlebenszeitanalyse Anwendungender inderpegeversicherung Diplomarbeit FlorianRudolph von Abgabetermin: Betreuerin: Themenstellerin:ProfDrCzado 25Januar2000


H2 1862 mm. H1 1861 mm

H2 1862 mm. H1 1861 mm 1747 mm 4157 mm H2 1862 mm H1 1861 mm L1 4418 mm L2 4818 mm H2 2280-2389 mm H1 1922-2020 mm L1 4972 mm L2 5339 mm H3 2670-2789 mm H2 2477-2550 mm L2 5531 mm L3 5981 mm L4 6704 mm H1 2176-2219 mm L1 5205


klar. Um die zweite Bedingung zu zeigen, betrachte u i U i mit u i = 0. Das mittlere -Zeichen liefert s

klar. Um die zweite Bedingung zu zeigen, betrachte u i U i mit u i = 0. Das mittlere -Zeichen liefert s Nachtrag zur allgemeinen Vektorraum-Theorie. 1.5.15. Direkte Summen. Sei V ein Vektorraum, seien U 1,..., U t Unterräume, wir schreiben V = U 1 U 2 U t = t i=1 U i falls die folgenden beiden Bedingungen


Bestimmung einer ersten

Bestimmung einer ersten Kapitel 6 Bestimmung einer ersten zulässigen Basislösung Ein Problem, was man für die Durchführung der Simplexmethode lösen muss, ist die Bestimmung einer ersten zulässigen Basislösung. Wie gut das geht,


Über relative Normgleichungen in algebraischen Zahlkörpern

Über relative Normgleichungen in algebraischen Zahlkörpern Über relative Normgleichungen in algebraischen Zahlkörpern vorgelegt von Diplom-Mathematiker Claus Fieker aus Haan Vom Fachbereich 3 Mathematik der Technischen Universität Berlin zur Erlangung des akademischen


Kleiner Satz von Fermat

Kleiner Satz von Fermat Kleiner Satz von Fermat Satz Kleiner Satz von Fermat Sei p P. Dann gilt a p a mo p für alle a Z. Wir führen zunächst eine Inuktion für a 0 urch. IA a = 0: 0 p 0 mo p. IS a a+1: Nach vorigem Lemma gilt


Elemente der Analysis II

Elemente der Analysis II Elemente der Analysis II Kapitel 3: Lineare Abbildungen und Gleichungssysteme Informationen zur Vorlesung: wengenroth/ J. Wengenroth () 15. Mai 2009 1 / 35 3.1 Beispiel


Taylorentwicklung der k ten Dimension

Taylorentwicklung der k ten Dimension Taylorentwicklung der k ten Dimension 1.) Taylorentwicklung... 2 1.1.) Vorgehenesweise... 2 1.2.) Beispiel: f ((x, y)) = e x2 +y 2 8x 2 4y 4... 3 2.) Realisierung des Algorithmus im CAS Sage Math... 5


Vektorräume und Rang einer Matrix

Vektorräume und Rang einer Matrix Universität Basel Wirtschaftswissenschaftliches Zentrum Vektorräume und Rang einer Matrix Dr. Thomas Zehrt Inhalt:. Lineare Unabhängigkeit 2. Vektorräume und Basen 3. Basen von R n 4. Der Rang und Rangbestimmung


Entscheidungsbäume. Definition Entscheidungsbaum. Frage: Gibt es einen Sortieralgorithmus mit o(n log n) Vergleichen?

Entscheidungsbäume. Definition Entscheidungsbaum. Frage: Gibt es einen Sortieralgorithmus mit o(n log n) Vergleichen? Entscheidungsbäume Frage: Gibt es einen Sortieralgorithmus mit o(n log n) Vergleichen? Definition Entscheidungsbaum Sei T ein Binärbaum und A = {a 1,..., a n } eine zu sortierenden Menge. T ist ein Entscheidungsbaum


das Infomagazin des Vereins DIE ALTERNATIVE 40 Jahre Sozialtherapie ULMENHOF

das Infomagazin des Vereins DIE ALTERNATIVE 40 Jahre Sozialtherapie ULMENHOF k Ifz V DIE ALTERNATIVE 40 J Szp ULMENHOF I Dk fü 40 J V. W k I z fü I Uüz v 40 J. Ip Ak 24 2012 V fü f Sp DIE ALTERNATIVE I Af 9000 Rk DIE ALTERNATIVE Ly & Gfk C Güf & f-fk. E: W! 02 P Bk, G ALTERNATIVE


Vorlesung 12 22. bzw. 23. Januar 2014. Determinanten 1. Cramersche Regel

Vorlesung 12 22. bzw. 23. Januar 2014. Determinanten 1. Cramersche Regel Vorlesung 2 22 bzw 23 Januar 204 Lineares Gleichungssystem a a 2 b b 2 = F a a 2 a 3 b b 2 b 3 c c 2 c 3 = V V =< a, b c > c b a b a F V Seite 70 a x + a 2 x 2 + a 3 x 3 b = 0 < a x + a 2 x 2 + a 3 x 3



Strahlenschutzverordnung Strahlenschutzverordnung (StSV) Änderung vom 15. November 2000 Der Schweizerische Bundesrat verordnet: I Die Strahlenschutzverordnung vom 22. Juni 1994 1 wird wie folgt geändert: Art. 9 Kommission für



9.2. DER SATZ ÜBER IMPLIZITE FUNKTIONEN 83 9.. DER SATZ ÜBER IMPLIZITE FUNKTIONEN 83 Die Grundfrage bei der Anwendung des Satzes über implizite Funktionen betrifft immer die folgende Situation: Wir haben eine Funktion f : V W und eine Stelle x


11. Primfaktorzerlegungen

11. Primfaktorzerlegungen 78 Andreas Gathmann 11 Primfaktorzerlegungen Euch ist sicher aus der Schule bekannt, dass sich jede positive ganze Zahl a als Produkt a = p 1 p n von Primzahlen schreiben lässt, und dass diese Darstellung


Wortproblem für kontextfreie Grammatiken

Wortproblem für kontextfreie Grammatiken Wortproblem für kontextfreie Grammatiken G kontextfreie Grammatik. w Σ w L(G)? Wortproblem ist primitiv rekursiv entscheidbar. (schlechte obere Schranke!) Kellerautomat der L(G) akzeptiert Ist dieser effizient?


2 Die Darstellung linearer Abbildungen durch Matrizen

2 Die Darstellung linearer Abbildungen durch Matrizen 2 Die Darstellung linearer Abbildungen durch Matrizen V und V seien Vektorräume über einem Körper K. Hom K (V, V ) bezeichnet die Menge der K linearen Abbildungen von V nach V. Wir machen Hom K (V, V )


vertreten arbeiten an (1,1) (1,1) (1,10) (1,1) (1,3) Abteilung Angestellter Projekt (0,2) Name Gehalt

vertreten arbeiten an (1,1) (1,1) (1,10) (1,1) (1,3) Abteilung Angestellter Projekt (0,2) Name Gehalt !" #$% &'() +*),- ##.0/1324$ #56 879*:? @& BADC, #E +E #. &)GFH @ I J J; 8/1$% 9):$SIRJ O2T ):$ #5# @ E BIZ [ #:# &)]FH 3@#KZ5 )5(^* _PR3>$@S


9/1"2$/"#6#,-./0/12#-.3'S3(&"E3' A303;7"B'13#-.03-.%3*?(72*3*'A3-.%##6*7-.3' dem/der Kandidat/in seine/ ihre Stimme geben :

9/12$/#6#,-./0/12#-.3'S3(&E3' A303;7B'13#-.03-.%3*?(72*3*'A3-.%##6*7-.3' dem/der Kandidat/in seine/ ihre Stimme geben : dem/der Kandidat/in seine/ ihre Stimme geben : Zum vermeintlichen Konflikt von Verständlichkeit und Geschlechtergerechtigkeit in der Rechtssprache!"#$%&'"%&()*+&,#-&./#012+3*4-&!"#$%&%'()*'+#,-./0/1234'56*7-.3'8'9/1"2$/"'


Sonntag, 16. Mai 2010

Sonntag, 16. Mai 2010 ÖLV 2021/10 30. H f d S Sg, 16. M 2010 21. WALDVIERTLER LÄUFERCUP S/Z: Sppz Bdsgymsm H Bfz HOBBYLAUF 5km Bfz NORDIC WALKIN 5km HAUPTLAUF 10km NACHWUCHSLÄUFE 300m - 1500m Bfz STAFFELLAUF 2 x 2,5km 09.30


Kapitel 15. Lösung linearer Gleichungssysteme

Kapitel 15. Lösung linearer Gleichungssysteme Kapitel 15. Lösung linearer Gleichungssysteme Lineare Gleichungssysteme Wir befassen uns nun mit der Lösung im allgemeinen nichthomogener linearer Gleichungssysteme in zweifacher Hinsicht. Wir studieren


5.2 Das All-Pairs-Shortest-Paths-Problem (APSP-Problem) Kürzeste Wege zwischen allen Knoten. Eingabe: Gerichteter Graph G =(V, E, c)

5.2 Das All-Pairs-Shortest-Paths-Problem (APSP-Problem) Kürzeste Wege zwischen allen Knoten. Eingabe: Gerichteter Graph G =(V, E, c) 5.2 Das All-Pairs-Shortest-Paths-Problem (APSP-Problem) Kürzeste Wege zwischen allen Knoten. Eingabe: Gerichteter Graph G =(V, E, c) mit V = {1,...,n} und E {(v, w) 1 apple v, w apple n, v 6= w}. c : E!


Unser Haus setzt auf Qualität und Vertraulichkeit

Unser Haus setzt auf Qualität und Vertraulichkeit O 2014 Mii cfll Sic V L cflll Jö Scf ( c) i T. Al cf i i i i vl. i cfc I i iill B M v O Til Sl. Wi l l öc 20 S i Li. I l J cfll v Af i ß B. l i c i iill Sc v O. I Sic i A c i i iv cfll i. V Ji i A l i


Algorithmen II Vorlesung am 15.11.2012

Algorithmen II Vorlesung am 15.11.2012 Algorithmen II Vorlesung am 15.11.2012 Kreisbasen, Matroide & Algorithmen INSTITUT FÜR THEORETISCHE INFORMATIK PROF. DR. DOROTHEA WAGNER KIT Universität des Landes Baden-Württemberg und Algorithmen nationales



VERGLEICHSTABELLE VON VERSCHIEDENEN STAHLSORTEN 10 Cr Mo 11 1.7276 12 CD 10 0,10 0,25 0,40 0,035 0,035 2,85 0,25 10 Cr Mo 9-10 1.7380 grade 45 10 CD 9-10 0,12 0,50 0,55 0,035 0,030 2,25 1,05 10 S 20 1.0721 1108-10 F2 0,10 0,25 0,70 0,060 0,20 100 Cr


Atombau, Periodensystem der Elemente

Atombau, Periodensystem der Elemente Seminar zum Brückenkurs Chemie 2015 Atombau, Periodensystem der Elemente Dr. Jürgen Getzschmann Dresden, 21.09.2015 1. Aufbau des Atomkerns und radioaktiver Zerfall - Erläutern Sie den Aufbau der Atomkerne


50. Mathematik-Olympiade 2. Stufe (Regionalrunde) Klasse 11 13. 501322 Lösung 10 Punkte

50. Mathematik-Olympiade 2. Stufe (Regionalrunde) Klasse 11 13. 501322 Lösung 10 Punkte 50. Mathematik-Olympiade. Stufe (Regionalrunde) Klasse 3 Lösungen c 00 Aufgabenausschuss des Mathematik-Olympiaden e.v. Alle Rechte vorbehalten. 503 Lösung 0 Punkte Es seien


Lösungsvorschlag für die Probeklausuren und Klausuren zu Algebra für Informations- und Kommunikationstechniker bei Prof. Dr.

Lösungsvorschlag für die Probeklausuren und Klausuren zu Algebra für Informations- und Kommunikationstechniker bei Prof. Dr. Lösungsvorschlag für die Probeklausuren und Klausuren zu Algebra für Informations- und Kommunikationstechniker bei Prof. Dr. Kurzweil Florian Franzmann André Diehl Kompiliert am 10. April 2006 um 18:33


Erinnerung/Zusammenfassung zu Abbildungsmatrizen

Erinnerung/Zusammenfassung zu Abbildungsmatrizen Erinnerung/Zusammenfassung zu Abbildungsmatrizen Thomas Coutandin ( 7. November 2 Abbildungsmatrizen Im Folgenden betrachten wir stets endlich dimensionale K-Vektorräume (K irgend


Stackelberg Scheduling Strategien

Stackelberg Scheduling Strategien Stackelberg Scheduling Strategien Von Tim Roughgarden Präsentiert von Matthias Ernst Inhaltsübersicht Einleitung Vorbetrachtungen Stackelberg Strategien Ergebnisse Seminar Algorithmische Spieltheorie:


Sechs Module aus der Praxis

Sechs Module aus der Praxis Modu l 1 : V o r b e r e i tung für d a s Re i te n L e r n s i tuatio n : De r e r ste Ko n ta k t K i n d u n d P fe r d d a r f : 1 2 0 m i n. D i e K i n d e r so l l e n d a s P f e r d, s e i n e



BONUS MALUS SYSTEME UND MARKOV KETTEN Fakultät Mathematik und Naturwissenschaften, Fachrichtung Mathematik, Institut für Mathematische Stochastik BONUS MALUS SYSTEME UND MARKOV KETTEN Klaus D. Schmidt Ringvorlesung TU Dresden Fakultät MN,



VERGLEICHSTABELLE VON VERSCHIEDENEN STAHLSORTEN 1.0050 St 50-2 - 50 B - 50 C A 50-2 0,33 0,27 0,65 0,045 0,045 0,30 0,30-1.0060 St 60-2 - 55 C A 60-2 0,43 0,27 0,65 0,045 0,045 0,30 0,30-1.0301 C 10 M 1010 045 M 10 AF 34 C 10 0,10 0,40 0,45 0,045 0,045-1.0308


E i n b a u-b a c k o f e n O I M 2 2 3 0 1 B i t t e z u e r s t d i e s e B e d i e n u n g s a n l e i t u n g l e s e n! S e h r g e e h r t e K u n d i n, s e h r g e e h r t e r K u n d e, v i e


3. Grundlagen der Linearen Programmierung

3. Grundlagen der Linearen Programmierung 3. Grundlagen der linearen Programmierung Inhalt 3. Grundlagen der Linearen Programmierung Lineares Programm Grafische Lösung linearer Programme Normalform Geometrie linearer Programme Basislösungen Operations


Kap. 8: Speziell gewählte Kurven

Kap. 8: Speziell gewählte Kurven Stefan Lucks 8: Spezielle Kurven 82 Verschl. mit Elliptischen Kurven Kap. 8: Speziell gewählte Kurven Zur Erinnerung: Für beliebige El. Kurven kann man den Algorithmus von Schoof benutzen, um die Anzahl


P R E I S L I S T E. PREISLISTE GÜLTIG AB 18.04.2016 ZUZÜGL.MWST Art.-Nr. Rab.Gr. Bezeichung Preis 1 Preis 2



Teil III: Routing - Inhalt I. Literatur. Geometric Routing. Voraussetzungen. Unit Disk Graph (UDG) Geometric Routing 29

Teil III: Routing - Inhalt I. Literatur. Geometric Routing. Voraussetzungen. Unit Disk Graph (UDG) Geometric Routing 29 1 29 Teil III: Routing - Inhalt I Literatur Compass & Face Routing Bounded & Adaptive Face Routing Nicht Ω(1) UDG E. Kranakis, H. Singh und Jorge Urrutia: Compass Routing on Geometric Networks. Canadian


a c b e h k r s l m a) 224380.035.901 VE: 4 b) 224380.022.101 VE: 4 c) 224380.035.101 VE: 4 d) 224380.022.901 VE: 4

a c b e h k r s l m a) 224380.035.901 VE: 4 b) 224380.022.101 VE: 4 c) 224380.035.101 VE: 4 d) 224380.022.901 VE: 4 r ü r ) 224380.035.901 VE: 4 ) 224380.022.101 VE: 4 ) 224380.035.101 VE: 4 ) 224380.022.901 VE: 4 ) 224362.021.355 VE: 2 ) 224362.017.355 VE: 4 i x w ) 224365.013.355 VE: 4 ) 224364.009.355 VE: 6 i) 224234.015.901


Chemische Bindung. Wie halten Atome zusammen? Welche Atome können sich verbinden? Febr 02

Chemische Bindung. Wie halten Atome zusammen? Welche Atome können sich verbinden? Febr 02 Chemische Bindung locker bleiben Wie halten Atome zusammen? positiv Welche Atome können sich verbinden? power keep smiling Chemische Bindung Die chemischen Reaktionen spielen sich zwischen den Hüllen der


Kapitel III. Lineare Abbildungen

Kapitel III. Lineare Abbildungen Kapitel III. Lineare Abbildungen Beispiele: 1 Lineare Abbildungen a) Seien c 1,..., c n K vorgegeben. Betrachte die Funktion F (x 1,..., x n ) = c 1 x 1 + c 2 x 2 +... + c n x n in den Variablen x 1,...,


Division Für diesen Abschnitt setzen wir voraus, dass der Koeffizientenring ein Körper ist. Betrachte das Schema

Division Für diesen Abschnitt setzen wir voraus, dass der Koeffizientenring ein Körper ist. Betrachte das Schema Division Für diesen Abschnitt setzen wir voraus, dass der Koeffizientenring ein Körper ist. Betrachte das Schema 2x 4 + x 3 + x + 3 div x 2 + x 1 = 2x 2 x + 3 (2x 4 + 2x 3 2x 2 ) x 3 + 2x 2 + x + 3 ( x


Übungen zur Ingenieur-Mathematik III WS 2009/10 Blatt 10 21.12.2009

Übungen zur Ingenieur-Mathematik III WS 2009/10 Blatt 10 21.12.2009 Übungen zur Ingenieur-Mathematik III WS 2009/10 Blatt 10 21.12.2009 Aufgabe 35: Thema: Singulärwertzerlegung und assoziierte Unterräume Sei A eine m n Matrix mit Rang r und A = UDV T ihre Singulärwertzerlegung.


A4 Monitore Doppelgeräte für Pulver- und Schaumlöschmittel

A4 Monitore Doppelgeräte für Pulver- und Schaumlöschmittel A4 Monitore Doppelgeräte für Pulver- und Schaumlöschmittel A4 Monitore LL (Leichtmetalllegierung G-Al Si 9) - A4/DA/F/P, LL, Doppelgerät mit Schaum-/Wasserlöschkopf und Pulverrohr A4 Monitore Bz (Bronze


Beispiel 11.2. Wenn p ein Polynom vom Grad größer gleich 1 ist, ist q : C Ĉ definiert durch q (z) =

Beispiel 11.2. Wenn p ein Polynom vom Grad größer gleich 1 ist, ist q : C Ĉ definiert durch q (z) = Funktionentheorie, Woche Funktionen und Polstellen. Meromorphe Funktionen Definition.. Sei U C offen und sei f : U gilt, nennt man f meromorph auf U: Ĉ eine Funktion. Wenn folgendes. P := f hat keine Häufungspunkte;.


7 Untergruppen, Faktorgruppen, Ideale, Restklassenringe

7 Untergruppen, Faktorgruppen, Ideale, Restklassenringe 7 Untergruppen, Faktorgruppen, Ideale, Restklassenringe und Homomorfismen Wir verallgemeinern den Übergang von Z zu Z/m. Sei im folgenden G eine (additiv geschriebene) abelsche Gruppe, H eine Untergruppe.


Stahlrohre, nahtlos, warm gefertigt für Kugellagefertigung nach GOST 800-78

Stahlrohre, nahtlos, warm gefertigt für Kugellagefertigung nach GOST 800-78 Stahlrohre, nahtlos, warm gefertigt für Kugellagefertigung nach GOST 800-78 Chemische Zusammensetzung Мassenanteil der Elemente, % S P Ni Cu C Mn Si Cr max. ШХ15 0,95-1,05 0,20-0,40 0,17-0,37 1,30-1,65


KAPITEL 4. Lineare Ausgleichsrechnung Beispiel 4.1. Das Ohmsche Gesetz: U = RI. Eine Meßreihe von Daten:

KAPITEL 4. Lineare Ausgleichsrechnung Beispiel 4.1. Das Ohmsche Gesetz: U = RI. Eine Meßreihe von Daten: KAPITEL 4 Lineare Ausgleichsrechnung Beispiel 41 Das Ohmsche Gesetz: Eine Meßreihe von Daten: U = RI (U i, I i ) (Spannung, Stromstärke), i = 1,, m Aufgabe: man bestimme aus diesen Meßdaten den Widerstand


Die niederländische Strafprozeßordnung... 33

Die niederländische Strafprozeßordnung... 33 Inhaltsverzeichnis Vorwort... V Abkürzungsverzeichnis... XIII Einführung... 1 Die niederländische Strafprozeßordnung... 33 Erstes Buch Allgemeine Bestimmungen... 35 Titel I Strafverfahren im allgemeinen


A Matrix-Algebra. A.1 Definition und elementare Operationen

A Matrix-Algebra. A.1 Definition und elementare Operationen A Matrix-Algebra In diesem Anhang geben wir eine kompakte Einführung in die Matrizenrechnung bzw Matrix-Algebra Eine leicht lesbare Einführung mit sehr vielen Beispielen bietet die Einführung in die Moderne


Schranken für zulässige Lösungen

Schranken für zulässige Lösungen Schranken für zulässige Lösungen Satz 5.9 Gegeben seien primales und duales LP gemäß der asymmetrischen Form der Dualität. Wenn x eine zulässige Lösung des primalen Programms und u eine zulässige Lösung


Optimierung. Florian Jarre Josef Stoer. Springer

Optimierung. Florian Jarre Josef Stoer. Springer 2008 AGI-Information Management Consultants May be used for personal purporses only or by libraries associated to network. Florian Jarre Josef Stoer Optimierung Springer Inhaltsverzeichnis


Vorschau reiseführer

Vorschau reiseführer V ü üj 0 ä, ä, ö Z Z U v T T v V ö üzv (v ) VIT ü U v V V V ä z v jz v, äi, z vä v zü I z: ä T V ü ü, ü z z T Iv z ö, ü I z D ü ü ä D Z ä,, jz z ü z : D z Cy, v ä I ü z zäz v v U 0 äü I z I z v,, vä T


TECHNISCHE UNIVERSITÄT MÜNCHEN. Abzählbarkeit, Injektivität, Sürjektivität und Bijektivität

TECHNISCHE UNIVERSITÄT MÜNCHEN. Abzählbarkeit, Injektivität, Sürjektivität und Bijektivität TECHNISCHE UNIVERSITÄT MÜNCHEN Zentrum Mathematik Prof. Dr. Friedrich Roesler Ralf Franken, PhD Max Lein Lineare Algebra 1 WS 26/7 en Blatt 4 13.11.26 Abzählbarkeit, Injektivität, Sürjektivität und Bijektivität


Theoretische Informatik 2 (WS 2006/07) Automatentheorie und Formale Sprachen / Kontextfreie Sprachen und Kellerautomaten

Theoretische Informatik 2 (WS 2006/07) Automatentheorie und Formale Sprachen / Kontextfreie Sprachen und Kellerautomaten Inhalt 1 Einführung 2 Automatentheorie und Formale Sprachen Grammatiken Reguläre Sprachen und endliche Automaten Kontextfreie Sprachen und Kellerautomaten Kontextsensitive und Typ 0-Sprachen 3 Berechenbarkeitstheorie


Titanlegierungen Freiform- und Gesenkschmiedestücke

Titanlegierungen Freiform- und Gesenkschmiedestücke Mechanische Eigenschaften bei Raumtemperatur Physikalische Eigenschaften Werkstoffkurzzeichen Legierungstyp Wärmebehandlung Wärmebehandlungsdicke d [mm] R po2 [MPa] R m [MPa] A 5 [%] Z [%] Dichte [g/cm


Leitfaden Lineare Algebra: Determinanten

Leitfaden Lineare Algebra: Determinanten Leitfaden Lineare Algebra: Determinanten Die symmetrische Gruppe S n. Eine Permutation σ der Menge S ist eine bijektive Abbildung σ : S S. Ist S eine endliche Menge, so reicht es zu verlangen, dass σ injektiv


Algorithmen und Komplexität Teil 1: Grundlegende Algorithmen

Algorithmen und Komplexität Teil 1: Grundlegende Algorithmen Algorithmen und Komplexität Teil 1: Grundlegende Algorithmen WS 08/09 Friedhelm Meyer auf der Heide Vorlesung 8, 4.11.08 Friedhelm Meyer auf der Heide 1 Organisatorisches Am Dienstag, 11.11., fällt die


Induktive Limiten. Arpad Pinter, Tobias Wöhrer. 30. Jänner 2010

Induktive Limiten. Arpad Pinter, Tobias Wöhrer. 30. Jänner 2010 Induktive Limiten Arpad Pinter, Tobias Wöhrer 30. Jänner 2010 1 Inhaltsverzeichnis 1 Induktiver Limes von Mengen 2 2 Induktiver Limes von Vektorräumen 4 3 Lokalkonvexe topologische Vektorräumen 7 4 Induktiver


Fachschaft Mathematik und Informatik (FIM) LA I VORKURS. Herbstsemester 2015. gehalten von Harald Baum

Fachschaft Mathematik und Informatik (FIM) LA I VORKURS. Herbstsemester 2015. gehalten von Harald Baum Fachschaft Mathematik und Informatik (FIM) LA I VORKURS Herbstsemester 2015 gehalten von Harald Baum 2. September 2015 Inhaltsverzeichnis 1. Stichpunkte zur Linearen Algebra I 2. Körper 3. Vektorräume


Minimale Darstellungen, Kommutator- und Fixräume, projektive Geometrie

Minimale Darstellungen, Kommutator- und Fixräume, projektive Geometrie Notation Die in dieser Arbeit verwendete Notation ist im Wesentlichen Standard, so wie sie beispielsweise in [As] zu nden ist. Einige Abweichungen hiervon, Klarstellungen und zusätzliche Notationen (sofern


Carsten Fallak. Rechtsschutz bei lückenhafter Begründung des zivilgerichtlichen. wvb

Carsten Fallak. Rechtsschutz bei lückenhafter Begründung des zivilgerichtlichen. wvb Carsten Fallak Rechtsschutz bei lückenhafter Begründung des zivilgerichtlichen Urteils wvb Gliederung Literaturverzeichnis....... XIII Abkürzungsverzeichnis XXVII A. Einleitung 1 I. Gegenstand der Untersuchung


Projektive Moduln. Lemma/Definition 1.1. Folgende Aussagen für einen R-Modul P sind äquivalent: (i) P erfüllt folgende Liftungseigenschaft:

Projektive Moduln. Lemma/Definition 1.1. Folgende Aussagen für einen R-Modul P sind äquivalent: (i) P erfüllt folgende Liftungseigenschaft: Seminar Summen von Quadraten und K-Theorie Projektive Moduln Im Folgenden sei R ein assoziativer Ring mit Eins, nicht notwendigerweise kommutativ. R-Modul ist im Folgenden stets ein Rechts-R-Modul. Ein


Im gesamten Kapitel sei Ω eine nichtleere Menge. Wir bezeichnen die Potenzmenge

Im gesamten Kapitel sei Ω eine nichtleere Menge. Wir bezeichnen die Potenzmenge 1 Mengensysteme Ein Mengensystem ist eine Familie von Teilmengen einer Grundmenge und damit eine Teilmenge der Potenzmenge der Grundmenge. In diesem Kapitel untersuchen wir Mengensysteme, die unter bestimmten


Rechtsextremismus und demokratiegefährdende Phänomene in Berlin-Marzahn-Hellersdorf und Möglichkeiten der demokratischen Intervention

Rechtsextremismus und demokratiegefährdende Phänomene in Berlin-Marzahn-Hellersdorf und Möglichkeiten der demokratischen Intervention 23 Rechtsextremismus und demokratiegefährdende hänomene in Berlin-Marzahn-Hellersdorf und Möglichkeiten der demokratischen Intervention Bea Dorn, Silke Meier, Desirée ilz, Kerstin Sischka Moritz Blanke,


Mengensysteme, Wahrscheinlichkeitsmaße

Mengensysteme, Wahrscheinlichkeitsmaße Kapitel 1 Mengensysteme, Wahrscheinlichkeitsmaße Der Großteil der folgenden fundamentalen Begriffe sind schon aus der Vorlesung Stochastische Modellbildung bekannt: Definition 1.1 Eine Familie A von Teilmengen


lsa = (S' A) (SA') (110)

lsa = (S' A) (SA') (110) Mathematics. - Ueber Trivektoren. V. Von R. WEITZENBÖCK. (Communicated at the meeting of February 26. 1938.) 13. Die Syzygien D:~ und E:~. Wir haben im 11 in der Gleichung (98) eine Syzygie dritter Art


8 Diskrete Optimierung

8 Diskrete Optimierung 8 Diskrete Optimierung Definition 8.1. Ein Graph G ist ein Paar (V (G), E(G)) besteh aus einer lichen Menge V (G) von Knoten (oder Ecken) und einer Menge E(G) ( ) V (G) 2 von Kanten. Die Ordnung n(g) von


Dr.-Ing. A. van Bennekom + 49 (0) 2151 3633 4139 Dipl.-Ing. F. Wilke +49 (0) 271 808 2640 frank.wilke@dew-stahl.

Dr.-Ing. A. van Bennekom + 49 (0) 2151 3633 4139 Dipl.-Ing. F. Wilke +49 (0) 271 808 2640 frank.wilke@dew-stahl. Vergleich der physikalischen, mechanischen und korrosiven Eigenschaften von stabilisierten (1.4571) und niedrig kohlenstoffhaltigen (1.4404) austenitischen rostfreien Stählen Qualitätslenkung, Entwicklung



INHALTSVERZEICHNIS A) INHALTSVERZEICHNIS A) Einleitung 13 I. Ausgangssituation 13 II. Aufgabenstellung 16 B) Entstehungsgeschichte des 370a AO 19 I. Einführung des 370a AO durch das Steuerverkürzungsbekämpfungsgesetz 19 II.


7. Ringe und Körper. 7. Ringe und Körper 49

7. Ringe und Körper. 7. Ringe und Körper 49 7. Ringe und Körper 49 7. Ringe und Körper In den bisherigen Kapiteln haben wir nur Gruppen, also insbesondere nur Mengen mit lediglich einer Verknüpfung, untersucht. In der Praxis gibt es aber natürlich


TechnischeUniversitatMunchen ZentrumMathematik Kreditrisiko ModelleundDerivatebewertung Diplomarbeit AlexanderSzimayer von Abgabetermin:12.Mai1999 Betreuer: Themensteller:Prof.Dr.C.Kluppelberg Dr.M.Borkovec


Mathematik II. D K, z P(z) Q(z), wobei D das Komplement der Nullstellen von Q ist, eine rationale Funktion.

Mathematik II. D K, z P(z) Q(z), wobei D das Komplement der Nullstellen von Q ist, eine rationale Funktion. rof. Dr. H. Brenner Osnabrück SS 200 Mathematik II Vorlesung 34 Wir erinnern an den Begriff einer rationalen Funktion. Definition 34.. Zu zwei olynomen,q K[X], Q 0, heißt die Funktion D K, z (z) Q(z),


Binäre und ternäre Carbid- und Nitridsysteme der Übergangsmetalle

Binäre und ternäre Carbid- und Nitridsysteme der Übergangsmetalle Herausgeber GÜNTER PETZOW Materialkundlich- Technische r* Binäre und ternäre Carbid- und Nitridsysteme der Übergangsmetalle von HELMUT HOLLECK Leiter der Abteilung Konstitution und Thermodynamik" im Institut


Algebraische Kurven. Vorlesung 26. Die Schnittmultiplizität

Algebraische Kurven. Vorlesung 26. Die Schnittmultiplizität Prof. Dr. H. Brenner Osnabrück SS 2012 Algebraische Kurven Vorlesung 26 Die Schnittmultiplizität Es seien zwei ebene algebraische Kurven C,D A 2 K gegeben, die keine Komponente gemeinsam haben. Dann besteht


Codierungstheorie Rudolf Scharlau, SoSe 2006 9

Codierungstheorie Rudolf Scharlau, SoSe 2006 9 Codierungstheorie Rudolf Scharlau, SoSe 2006 9 2 Optimale Codes Optimalität bezieht sich auf eine gegebene Quelle, d.h. eine Wahrscheinlichkeitsverteilung auf den Symbolen s 1,..., s q des Quellalphabets


Zahlentheorie. Daniel Scholz im Winter 2006 / 2007. Überarbeitete Version vom 7. September 2007.

Zahlentheorie. Daniel Scholz im Winter 2006 / 2007. Überarbeitete Version vom 7. September 2007. Zahlentheorie Daniel Scholz im Winter 2006 / 2007 Überarbeitete Version vom 7. September 2007. Inhaltsverzeichnis 1 Einleitung und Grundlagen 4 1.1 Einleitung............................. 4 1.2 Zahlensysteme..........................


Optimierung für Wirtschaftsinformatiker: Analytische Optimierung ohne Nebenbedingungen

Optimierung für Wirtschaftsinformatiker: Analytische Optimierung ohne Nebenbedingungen Optimierung für Wirtschaftsinformatiker: Analytische Optimierung ohne Nebenbedingungen Dr. Nico Düvelmeyer Freitag, 1. Juli 2011 1: 1 [1,1] Inhaltsübersicht für heute 1 Einführung und Wiederholung Beispiel


Dr. Jürgen Roth. Fachbereich 6: Abteilung Didaktik der Mathematik. Elemente der Algebra. Dr. Jürgen Roth 3.1

Dr. Jürgen Roth. Fachbereich 6: Abteilung Didaktik der Mathematik. Elemente der Algebra. Dr. Jürgen Roth 3.1 .1 Dr. Jürgen Roth Fachbereich 6: Abteilung Didaktik der Mathematik Elemente der Algebra . Inhaltsverzeichnis Elemente der Algebra & Argumentationsgrundlagen, Gleichungen und Gleichungssysteme Quadratische


Thema: Chemische Bindungen Wasserstoffbrückenbindungen

Thema: Chemische Bindungen Wasserstoffbrückenbindungen Wiederholung der letzten Vorlesungsstunde: Thema: Chemische Bindungen Wasserstoffbrückenbindungen Wasserstoffbrückenbindungen, polare H-X-Bindungen, Wasser, Eigenschaften des Wassers, andere Vbg. mit H-Brücken


PERMINOX. Technische Dokumentation. Nichtrostender Betonrippenstahl

PERMINOX. Technische Dokumentation. Nichtrostender Betonrippenstahl PERMINOX Nichtrostender Betonrippenstahl Technische Dokumentation Nichtrostender Betonrippenstahl BSt 500 NR (IV NR) mit bauaufsichtlicher Zulassung des DIBt Berlin 2 Das Produkt PERMINOX sind nichtrostende


Der einstweilige Rechtsschutz gegen Mitgliedstaaten nach dem EWG-Vertrag

Der einstweilige Rechtsschutz gegen Mitgliedstaaten nach dem EWG-Vertrag Volkmar Wagner Der einstweilige Rechtsschutz gegen Mitgliedstaaten nach dem EWG-Vertrag PETER LANG Europäischer Verlag der Wissenschaften Inhaltsverzeichnis: Abkürzungsverzeichnis VI 1. Kapitel: Einleitung


Höhere Mathematik 3. Apl. Prof. Dr. Norbert Knarr. Wintersemester 2015/16. FB Mathematik

Höhere Mathematik 3. Apl. Prof. Dr. Norbert Knarr. Wintersemester 2015/16. FB Mathematik Höhere Mathematik 3 Apl. Prof. Dr. Norbert Knarr FB Mathematik Wintersemester 2015/16 4. Homogene lineare Dierentialgleichungen 4.1. Grundbegrie 4.1.1. Denition. Es sei J R ein Intervall und a 0 ; : :


KAPITEL 3. Lineare Gleichungssysteme, direkte Lösungsverfahren

KAPITEL 3. Lineare Gleichungssysteme, direkte Lösungsverfahren KAPITEL 3. Lineare Gleichungssysteme, direkte Lösungsverfahren Beispiel 3.2. Gesucht u(x), das eine Differentialgleichung vom Typ u (x) + λ(x)u(x) = f(x), x [0,], mit den Randbedingungen u(0) = u() = 0


t r Lineare Codierung von Binärbbäumen (Wörter über dem Alphabet {, }) Beispiel code( ) = code(, t l, t r ) = code(t l ) code(t r )

t r Lineare Codierung von Binärbbäumen (Wörter über dem Alphabet {, }) Beispiel code( ) = code(, t l, t r ) = code(t l ) code(t r ) Definition B : Menge der binären Bäume, rekursiv definiert durch die Regeln: ist ein binärer Baum sind t l, t r binäre Bäume, so ist auch t =, t l, t r ein binärer Baum nur das, was durch die beiden vorigen


Seminar Analysis Konvexe Funktionen und einige wichtige Ungleichungen

Seminar Analysis Konvexe Funktionen und einige wichtige Ungleichungen Seminar Analysis Konvexe Funktionen und einige wichtige Ungleichungen Michael Schaeer 3.04.03 Abstract This seminar is about convex functions and several imortant ineualities. At the beginning the term


Advanced Encryption Standard. Copyright Stefan Dahler 20. Februar 2010 Version 2.0

Advanced Encryption Standard. Copyright Stefan Dahler 20. Februar 2010 Version 2.0 Advanced Encryption Standard Copyright Stefan Dahler 20. Februar 2010 Version 2.0 Vorwort Diese Präsentation erläutert den Algorithmus AES auf einfachste Art. Mit Hilfe des Wissenschaftlichen Rechners


Theoretische Grundlagen der Informatik

Theoretische Grundlagen der Informatik Theoretische Grundlagen der Informatik Vorlesung am 12.01.2012 INSTITUT FÜR THEORETISCHE 0 KIT 12.01.2012 Universität des Dorothea Landes Baden-Württemberg Wagner - Theoretische und Grundlagen der Informatik


Lineare Gleichungssysteme. Lineare Gleichungssysteme. LR Zerlegung ohne Pivotsuche. Zerlegung regulärer Matrizen

Lineare Gleichungssysteme. Lineare Gleichungssysteme. LR Zerlegung ohne Pivotsuche. Zerlegung regulärer Matrizen Heinrich Voss Hamburg University of Technology Institute for Numerical Simulation Betrachte ein lineares Gleichungssystem Ax = b (1) Es sei A C n n eine gegebene regulär Matrix. Dann


RSA Full Domain Hash (RSA-FDH) Signaturen

RSA Full Domain Hash (RSA-FDH) Signaturen RSA Full Domain Hash (RSA-FDH) Signaturen Signatur RSA-FDH Sei H : {0, 1} Z N ein Random-Oracle. 1 Gen: (N, e, d) GenRSA(1 n ) mit pk = (N, e) und sk = (N, d). 2 Sign: Für eine Nachricht m {0, 1} berechne


BMU 2005-673. J.A.C. Broekaert. J. Feuerborn. A. Knöchel. A.-K. Meyer. Universität Hamburg, Institut für Anorganische und Angewandte Chemie

BMU 2005-673. J.A.C. Broekaert. J. Feuerborn. A. Knöchel. A.-K. Meyer. Universität Hamburg, Institut für Anorganische und Angewandte Chemie BMU 2005-673 Hochaufgelöste ortsabhängige Multielemtanalysen von mit allgemeintoxischen und radiotoxischen Elementen belasteten Organen/Geweben mit Hilfe der Röntgenmikrosonde und Elektronenmikroskopie


Die Kündigung eines Werkvertrages aus wichtigem Grund

Die Kündigung eines Werkvertrages aus wichtigem Grund Andreas Wiegreffe Die Kündigung eines Werkvertrages aus wichtigem Grund Verlag Dr. Kovac Hamburg 2007 Inhaltsverzeichnis A. Einleitung 13 B.Problemstellung 15 C. Bisherige Fälle eines zur Kündigung berechtigenden


Der Entwicklungs- und Einfiihrungsprozess des G-REIT

Der Entwicklungs- und Einfiihrungsprozess des G-REIT Der Entwicklungs- und Einfiihrungsprozess des G-REIT von Marc S. Hadyk Die Arbeit hat dem Promotionsausschuss Dr. jur. der Universität Bremen als Dissertation vorgelegen. Gutachter: 1. Prof. Dr. Christoph


ERP ERP ERP. Jahresinhaltsverzeichnis 2015. Jahresinhaltsverzeichnis 2015. GITO Verlag 2015. GIT Jetzt Probeheft anfordern unter erp.gito.

ERP ERP ERP. Jahresinhaltsverzeichnis 2015. Jahresinhaltsverzeichnis 2015. GITO Verlag 2015. GIT Jetzt Probeheft anfordern unter erp.gito. Jvz 25 -J ä -J ä 5 25 3/p2 w, fü B 5v -Sy S 6-672 5 v -Sy www.p-. ISS 8 B5 5 2 / 2. -672 fü 2 xpw fü x -Sy S D / C C 5 4/2 Dz 25 ISS 86-6725 D. K Sw v G J é Sü IL GH V O I G / f. GIO GIO GIO O GI V Jz
