Klinische SIT- Studien mit rekombinanten Allergenen

Transkript

1 Klinische SIT- Studien mit rekombinanten Allergenen Petra Zieglmayer Allergieambulatorium Wien West GesmbH Vienna Challenge Chamber Thermo Fisher Scientific

2 Was erwarten wir von Allergenimmuntherapie (AIT)?

3 Wie sehen die Entwicklungen aus? Burks, PRACTALL Consensus report, JACI 2013

4 Immunmechanismen der Immuntherapie: IgE-blockierende IgG- Antikörper

5 Immunmechanismen - Allergenspezifisches IgG reduziert die Mastzell- und Basophilendegranulation - Allergenspezifisches IgG reduziert den kosaisonalen IgE- Boost - Allergenspezifisches IgG inhibiert die IgE- vermittelte Allergenpräsentation an T- Zellen, die T- Zellaktivierung und Sekretion proinflammatorischer Zytokine Anto et al. JACI 2012

6 Was messen wir derzeit? Akdis M, Akdis C. JACI 2014

7 Surrogatmarker für Erfolg einer Immuntherapie? Siehe auch: Raker V. Allergo J 2012;21(3):160ff. Prof. H. Fiebig, 2007

8 Jutel, Allergology international 2014 Immunmechanismen neuer Allergievakzine IgE- Reaktivität, Immunogenität : - Hypoallergene, Fragmente, Trimere, Faltungsvarianten - Fusionsproteine Immunogenität : - T- Zell- Epitop- Peptide - Adjuvans- Kopplung (MPL, CpG, HepB PreS etc.) - Rekombinante Mixes Anti- IgE-Antikörper

9 Synthetische Allergievakzine Quelle: Valenta R, Ann Rev Immunol 2010

10 Die Zukunft der Allergenimmuntherapie (AIT)? intralymphatisch epikutan oder intrakutan Rekombinante Allergene Hapten-Carrier- Prinzip: Nur blockierendes IgG T-Zell Peptide: reine T-Zell- Wirkung

11 Unter anderem in klinischen Studien.. Intralymphat. IT ( 1:1000 Extrakte Biene, Gras, 1:100 MAT Fel d1 Katze) * The treatment has been difficult to market, however, because the trend in immunotherapy is not toward more efficient, but rather toward more convenient methods, such as sublingual immunotherapy. *Kündig, Allergy 2011

12

13 Unter anderem in klinischen Studien.. Intralymphat. IT ( 1:1000 Extrakte Biene, Gras, 1:100 MAT Fel d1 Katze) * The treatment has been difficult to market, however, because the trend in immunotherapy is not toward more efficient, but rather toward more convenient methods, such as sublingual immunotherapy. Epidermale IT (Gras, Milch, Erdnuss): 1x/Wo für 8h *Kündig, Allergy 2011

14

15 Heat-labile Escherichia coli toxin enhances the induction of allergen-specific IgG antibodies in epicutaneous patch vaccination. Cabauatan CR, Campana R, Niespodziana K, Reinisch C, Lundberg U, Meinke A, Henning R, Neubauer A, Valenta R. Allergy Aug 29. doi: /all [Epub ahead of print]

16 Unter anderem in klinischen Studien.. Intralymphat. IT ( 1:1000 Extrakte Biene, Gras, 1:100 MAT Fel d1 Katze) * The treatment has been difficult to market, however, because the trend in immunotherapy is not toward more efficient, but rather toward more convenient methods, such as sublingual immunotherapy. Epidermale IT (Gras, Milch, Erdnuss): 1x/Wo für 8h SLIT Milbentablette *Kündig, Allergy 2011

17 Wird die Zukunft Komponenten bringen?

18 In Entwicklung Komponenten- IT - bet v1 - phl p 1,2,5,6 - fel d1 Div. neue Adjuvantien/ Carrier

19

20

21

22

23

24

25 BM32- a B cell epitope based vaccine for immunotherapy of grass pollen allergy BM32 Vaccine design C Phl p 1 (Acc. No. P43213) P5: aa VRYTTEGGTKTEAEDVIPEGWKADTSYESK N BM321 P5 P5 Pre S P5 P5 Phl p 2 (Acc. No. P43214) P4: aa CFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE C N BM322 P4 P4 Pre S P4 P4 N Phl p 5 (Acc. No. Q40960) C P1: aa ADLGYGPATPAAPAAGYTPATPAAPAEAAPAGK P2: aa ATTEEQKLIEKINAGFKAALAAAAGVQPADKYR P5: aa AEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDK P6: aa EAAFNDAIKASTGGAYESYKFIPALEAAVK BM325 P6 P5 Pre S P1 P2 C Phl p 6 (Acc. No. Y ) P1: aa GKATTEEQKLIEDVNASFRAAMATTANVPPAD N BM326 P1 P1 Pre S P1 P1 Focke- Tejkl, JACI 2015

26 BM32- a B cell epitope based vaccine for immunotherapy of grass pollen allergy BM 32- skin test reactivity BM32 Niederberger, JACI 2015

27 BM32 BM 32- dose finding

28 Mean TNSS (2-6h) Mean Change of of mean wheal area [mm²] BM32 Clinical parameter TNSS SPT 10 Placebo S3: 40µg S2: 20µg S1: 10µg n=18 n=16 n=18 n=16 2 Placebo S3: 40µg S2: 20µg S1: 10µg ns ** p= % p= % * p= % ns p= % pre- post- pre- post- pre- post- pre- post- -12 treatment

29 OD 450nm (ELISA) OD 450nm (ELISA) OD 450nm (ELISA) OD 450nm (ELISA) BM32 Immunological parameter 5 Phl p 1-specific total IgG P=0,0029 Phl p 2-specific total IgG 5 P<0, Phl p 1 IgG - Plac (pre) Phl p 1 IgG - Plac (post) 5 4 Phl p 1 IgG - BM32 40 (pre) Phl p 1 IgG - BM32 40(post) Phl p 1 IgG - BM32 20 (pre) Phl p 1 IgG - BM32 20(post) Phl p 5-specific total IgG Phl p 1 IgG - BM32 10 (pre) Phl p 1 IgG - BM32 10(post) 0 Phl p 2 IgG - Plac (pre) Phl p 2 IgG - Plac (post) 4 Phl p 2 IgG - BM32 40 (pre) Phl p 2 IgG - BM32 40(post) Phl p 2 IgG - BM32 20 (pre) Phl p 2 IgG - BM32 20(post) Phl p 2 IgG - BM32 10 (pre) Phl p 2 IgG - BM32 10(post) Phl p 6-specific total IgG P<0,001 5 P< 0, Phl p 5 IgG - Plac (pre) Phl p 5 IgG - Plac (post) Phl p 5 IgG - BM32 40 (pre) Phl p 5 IgG - BM32 40(post) Phl p 5 IgG - BM32 20 (pre) Phl p 5 IgG - BM32 20(post) Phl p 5 IgG - BM32 10 (pre) Phl p 5 IgG - BM32 10(post) 0 Phl p 6 IgG - Plac (pre) Phl p 6 IgG - Plac (post) Phl p 6 IgG - BM32 40 (pre) Phl p 6 IgG - BM32 40(post) Phl p 6 IgG - BM32 20 (pre) Phl p 6 IgG - BM32 20(post) Phl p 6 IgG - BM32 10 (pre) Phl p 6 IgG - BM32 10(post)

30 BM32- protective against hepatitis B infection? Cornelius, Ebio 2016

31

32 Andere Pollenvakzine? Daten verfügbar zu: - Alt a 1 - Ole e 1

33

34 Nahrungsmittelvakzine?

35 Nahrungsmittelvakzine? Leider nein!

36 Wir nehmen mit: Neue Entwicklungen beinhalten neben Tablettenformulierungen neue Applikationsformen und synthetische Vakzine Der Fokus in der Entwicklung liegt auf der Reduktion der IgE- Reaktivität und Verstärkung der Immunogenität ( Convenience ) Für Pollenvakzine sind die Daten vielversprechend Interessant wird auch die Entwicklung der Milbenvakzine Für Nahrungsmittel ist bisher kein Durchbruch in Sicht

37 Fragen?