Electro-Optical Characteristics (T=25 C) Elektrooptische Eigenschaften
|
|
- Bella Kaufer
- vor 6 Jahren
- Abrufe
Transkript
1 Features: size 3,0(L) x 2,0(W) x 1,0(H) mm circuit substrate: Al 2 O 3 Ceramics encapsulation: Silicone devices are ROHS and REACH conform lead free solderable, soldering pads: gold plated taped in 8 mm blister tape, cathode to transporting perforation all devices sorted into radiant intensity classes taping: face-up (T) Merkmale: Größe 3,0 x 2,0 x 1,0 mm Gehäusematerial: Al 2 O 3 Keramik Vergussmaterial: Silicon Bauteile sind ROHS und REACH konform Bleifrei lötbar, Lötpads sind vergoldet Gegurtet in 8mm Blistergurt, Kathode zur Transportperforation Alle Bauteile sind Strahlstärkeklassen sortiert Gurtung: face-up (T) Electro-Optical Characteristics (T=25 C) Elektrooptische Eigenschaften Parameter Symbol Condition Min Typ Max Unit Emitting Color Farbe ultraviolet Forward Voltage Flussspannung U f I f = 20 ma V Peak Wavelength Peak Wellenlänge λ P I f = 20 ma nm FWHM Halbwertsbreite Δλ I f = 20 ma 10 nm Radiant Intensity Strahlstärke I e I f = 20 ma mw/sr Reverse Current Sperrstrom I R U R = 5V 100 μa Measurement time less than 50 ms Messzeit kleiner 50 ms Page/Seite 1/8
2 Maximum Ratings Grenzwerte Parameter Symbol Min Max Unit Forward Current Flussstrom I f, max 20 ma Forward Current, pulsed t p 100μs, Flussstrom, gepulst =1:10 I f, pulse 30 ma Reverse Voltage Sperrspannung U R 5 V Thermal Resistance Wärmewiderstand R th 60 K/W Operating Temperatur Betriebstemperatur T op C Storage Temperature Lagertemperatur T St C Electrostatic discharge classification (MIL-STD-883) Elektrostatische Empfindlichkeit class 1 Outline Drawing Zeichnung Recommended Soldering Pad Empfohlenes Lötpad Marking Marking at cathode Markierung an der Kathode Page/Seite 2/8
3 Performace Diagram Kennlinien 1, ,20 Forward Current [ma] 1 rel. Intensity [a.u.] 1,00 0,80 0,60 0,40 0,20 0,1 2,70 2,90 3,10 3,30 3,50 3,70 3,90 Forward Voltage [V] 0, Forward Current [ma] Forward Current vs. Forward Voltage Flussstrom über Flussspannung Intensity vs. Forward Current Strahlstärke über Flussstrom 379,1 IF [ma] T op [ C] Peak Wavelength [nm] 379,0 378,9 378,8 378,7 378,6 378,5 378,4 378, Forward Current [ma] Max. Forward Current vs. Ambient Temperature Max. Flussstrom über Umgebungstemperatur Forward Current vs. Shift Peak Wavelength Flussstrom gegen Verschiebung der Wellenlänge 90 1,00 1, ,80 0,8 rel. Intensity [ma] 0,60 0,40 0,6 0,4 0, ,20 0, , Wavelength [nm] 20mA 20mA View Angle Abstrahlung Page/Seite 3/8
4 Soldering Conditions Lötprofile s C Temperature [ C] C 170 C 3K/s max. 40s max. 4K/s max IR reflow soldering profile for lead containing solder IR Reflow Lötprozess für bleihaltiges Lot Time [s] C 250 C Temperature [ C] K/s max 3K/s max 120s max 180 C 217 C s 60s max 4K/s max IR reflow soldering profile for lead free soldering IR Reflow Lötprozess für bleifreies Lot Time [s] Manual Soldering: Manuelles Löten: max power of iron 25W / 300 C for 3s Max. Leistung des Lötkolben 25W / 300 C für 3s Page/Seite 4/8
5 Ordering Code For Parts Kodierung der Bestellnummer Series Serie Color Farbe Encapsulation Verguss Packaging Verpackung OCU-400 -??????? -? -? T taped up X uncolored clear Type definition, e.g. Typenbezeichnung z.b. -X-T Tape And Reel Packing Gurt und Spule D Parts/reel Page/Seite 5/8
6 Packing Verpackung The reel is sealed in special plastic bag with integrate ESD protection ( MIL - STD ) including a silica dry-pack. MSL level acc. to IPC/JEDEC J-STD 020D: Level 2 for Europe Level 2a for all other countries Die Rolle wird zusammen mit einem Trockenmittelbeutel in einem Highshield- Antistatic-Beutel verschweißt. Feuchtigkeitsempfindlichkeitsschwellwert (MSL) gemäß J-STD 020D: Schwellwert 2 für Europa Schwellwert 2a für alle anderen Länder Label Etikett Order No. Bestellnr. Type Typ XXXXXXXXXX???-??????-?-? Customer order No. Kundenspezifische Nr. Intensity group Intensitätskgruppe ZZ Color Class: CC Color Class optional Farbklasse optional Charge No. Chargennr. Quantity Anzahl 1122-AAAAAA 9999 LED Radiant Intensity Groups And Subgroups [mw/sr] Strahlstärkeklassen und Unterklassen (general information not this device specific; Allgemeine Informationen nicht bauteilspezifisch) E: E1: E2: F: F1: F2: G: G1: G2: Measured according to CIE 127. All SMD-LEDs are 100% measured and selected on full automated equipment with an accuracy of ±11 % for intensity and ±1 nm for wavelength. Special service: Brightness selection in sub selections possible. Color selection in 3 sub selections possible (each subgroup per reel). Gemessen nach CIE127. Alle SMD-LEDs sind 100% gemessen und auf automatischen Anlagen mit einer Toleranz von ±11 % für die Intensität und ±1 nm für die Wellenlänge selektiert. Spezieller Service: Selektion der Helligkeit in Unterklassen auf Anfrage möglich. Farbselektion in drei Unterklassen möglich (je eine Unterklasse pro Spule) Page/Seite 6/8
7 Warnings and Handling Instructions Sicherheitshinweise UV LEDs emit intense but mainly invisible ultraviolet radiation when in operation, which may be harmful to eyes, even for brief periods. * DO NOT LOOK DIRECTLY INTO THE UV LED DURING OPERATION * * BE SURE THAT YOU AND ALL PERSONS IN THE VICINITY WEAR SAFETY GOGGLES THAT PROVIDE SUITABLE UV PROTECTION WHEN A UV LED IS OPERATING * * KEEP CHILDREN AWAY FROM THE OPERATING VICINITY * * KEEP UV LEDs OUT OF THE REACH OF CHILDREN * If you incorporate a UV LED into a product, be sure to provide appropriate cautionary labels and instructions. Please follow all standard procedures for storing, handling, cleaning, mounting, soldering, disposal, or otherwise handling LED dies or packaged LEDs, including static electricity protection. The user has the responsibility to inform, train and instruct customers and co-workers UV-LEDs are ESD sensitive (Class1). The handling and usage have to consider this device property UV-LEDs emittieren im Betrieb intensive, aber unsichtbare Strahlung, welche auch bei kurzer Bestrahlung für die Augen gefährlich sein kann. *IM BETRIEB NICH DIREKT IN DIE UV-LED SEHEN* * DAS BEDIENPERSONAL UND ALLE PERSONEN IM ARBEITSBEREICH MÜSSEN GEEIGNETE SCHUTZBRILLEN TRAGEN; WENNDIE UV-LED IN BETRIEB IST* *KINDER VOM ARBEITSBEREICH FERN HALTEN* *UV-LEDS AUSERHALB DER REICHWEITE VON KINDERN AUFBEWAHREN* Wenn UV-LEDs in ein Gerät eingebaut werden, dann sind die notwendigen Sicherheitshinweise und Warmzeichen anzubringen. UV-LEDs sind ESD-empfindlich (Klasse 1). Die Handhabung und Nutzung ist dieser Bauteileigenschaft anzupassen. Page/Seite 7/8
8 Attention please The information describes the type of component and shall not considered as assured characteristics. Terms of delivery and rights to change reserved. The data sheet may changed without prior information; the valid issue will be on our webpage in internet. Due to technical requirements components may contain dangerous substances. Parameters can vary in different applications. All operating parameters must be validated for each customer application by the customer. OSA opto light GmbH does not have the responsibility for the reliability and the degradation behavior of products made with OSA opto light GmbH diodes because they depend not only on the diode but also on the conditions of manufacture or design of the final products. The customer is responsible to approve the long term stability of the product according to customer s requirements. Components used in toys, life support devices or systems or safety devices or systems must be expressly authorized by OSA opto light GmbH for such purpose! Packaging: OSA opto light GmbH uses recyclable packages, please use the recycling operators known to you. Zur Beachtung Dieses Datenblatt beschreibt typische, nicht uneingeschränkt garantierte Bauelementeigenschaften. Es gelten die AGB der OSA opto light GmbH, das Recht zur Änderung dieser ist vorbehalten. Änderungen im Sinne des technische Fortschritts vorbehalten, eine automatische Information erfolgt nicht. Die jeweils gültige Version ist auf unserer Internet-Seite vorhanden. Auf Grund technischer Erfordernisse können die Bauelemente gefährliche Substanzen enthalten. Produkteigenschaften können je nach Anwendung variieren. Die Produkteigenschaften müssen in der Anwendung durch den Kunden geprüft werden. Die OSA opto light GmbH ist nicht für die Zuverlässigkeit und das Alterungsverhalten von Produkten, die unter Verwendung von der OSA opto light GmbH hergestellten Dioden gefertigt wurden, verantwortlich, da Beides nicht nur von den Dioden selbst, sondern auch von Konstruktion und Fertigung des Endproduktes abhängt. Der Kunde ist verpflichtet, das Langzeitverhalten des Produktes gemäß seiner Anforderungen zu prüfen und freizugeben. Werden die Dioden in Spielzeug, lebenserhaltenden oder sicherheitsrelevanten Systemen und Geräten eingesetzt, muss dies durch die OSA opto light GmbH ausdrücklich gestattest werden. Rückgabe von Verpackungsmaterial: Die OSA opto light GmbH verwendet wiederverwertbare Verpackung, bitte wenden Sie sich an einen örtlichen Verwerter. OSA Opto Light GmbH Köpenicker Str.325 / Haus Berlin Germany Tel. +49 (0) contact@osa-opto.com Page/Seite 8/8
Electro-Optical Characteristics (T=25 C) Elektrooptische Eigenschaften
Features: size 3,8(L) x 3,8(W) x 1,0(H) mm circuit substrate: AlN Ceramics encapsulation: Silicone devices are ROHS and REACH conform lead free solderable, soldering pads: silver plated taped in 8 mm blister
Electro-Optical Characteristics (T= 25 C) Elektrooptische Eigenschaften
Features: package 0805 size: 1,9(L) x 1,2(W) x 1,2(H) mm circuit substrate: glass laminated epoxy devices are ROHS and REACH conform lead free solderable, soldering pads: gold plated taped in 8 mm blister
Electro-Optical Characteristics (T=25 C) Elektrooptische Eigenschaften. Parameter Symbol Condition Min Typ Max Unit Emitting Color Farbe
Features: size 3,8(L) x 3,8(W) x 1,0(H) mm circuit substrate: AlN Ceramics devices are ROHS and REACH conform lead free solderable, soldering pads: silver plated taped in 12 mm blister tape, cathode to
Electro-Optical Characteristics (T=25 C) Elektrooptische Eigenschaften. Parameter Symbol Condition Min Typ Max Unit Emitting Color Farbe
Preliminary Features: size 3,8(L) x 3,8(W) x 1,0(H) mm circuit substrate: AlN Ceramics devices are ROHS and REACH conform lead free solderable, soldering pads: silver plated taped in 16 mm blister tape,
Electro-Optical Characteristics (T=25 C) Elektrooptische Eigenschaften
Features: size 3,0(L) x 2,0(W) x 1,0(H) mm circuit substrate: Al 2 O 3 Ceramics encapsulation: Silicone devices are ROHS and REACH conform lead free solderable, soldering pads: gold plated taped in 8 mm
Electro-Optical Characteristics (T=25 C) Elektrooptische Eigenschaften
Features: size 3,0(L) x 2,0(W) x 1,0(H) mm circuit substrate: Al 2 O 3 Ceramics encapsulation: Silicone devices are ROHS and REACH conform lead free solderable, soldering pads: gold plated taped in 8 mm
Electro-Optical Characteristics (T=25 C) Elektrooptische Eigenschaften. Parameter Symbol Condition Min Typ Max Unit Emitting Color Farbe
Features: size 1206: 3.2(L) x 1.6(W) x 1.2(H) mm low current circuit substrate: glass laminated epoxy devices are ROHS and REACH conform lead free solderable, soldering pads: gold plated taped in 8 mm
Electro-Optical Characteristics (T=25 C) Elektrooptische Eigenschaften
Features: size 3,8(L) x 3,8(W) x 1,0(H) mm circuit substrate: AlN Ceramics devices are ROHS and REACH conform lead free solderable, soldering pads: silver plated taped in 12 mm blister tape, cathode to
Electro-Optical Characteristics (T= 25 C) Elektrooptische Eigenschaften
Features: with lens, mounting from backside of PCB view angle 40 package 1206 size: 3.2(L) x 1.6(W) x 1.9(H) mm circuit substrate: glass laminated epoxy devices are ROHS and REACH conform lead free solderable,
Electro-Optical Characteristics (T=25 C) Elektrooptische Eigenschaften
Features: size 3,8(L) x 3,8(W) x 1,0(H) mm circuit substrate: AlN Ceramics devices are ROHS and REACH conform lead free solderable, soldering pads: silver plated taped in 12 mm blister tape, cathode to
Electro-Optical Characteristics (T=25 C) Elektrooptische Eigenschaften
Features: size 3,8(L) x 3,8(W) x 1,0(H) mm circuit substrate: AlN Ceramics devices are ROHS and REACH conform lead free solderable, soldering pads: silver plated taped in 12 mm blister tape, cathode to
Typical Electro-Optical Characteristics Typische Elektrooptische Eigenschaften Measurement conditions Messbedingungen
Features: with lens, mounting from backside of PCB view angle 40 package 1206 size: 3.2(L) x 1.6(W) x 1.9(H) mm circuit substrate: glass laminated epoxy devices are ROHS and REACH conform lead free solderable,
Typical Electro-Optical Characteristics Typische Elektrooptische Eigenschaften Measurement conditions Messbedingungen
Features: size 1206: 3,2(L) x 1,6(W) x 1,2(H) mm circuit substrate: glass laminated epoxy devices are ROHS and REACH conform lead free solderable, soldering pads: gold plated taped in 8 mm blister tape,
Electro-Optical Characteristics (T=25 C) Elektrooptische Eigenschaften
preliminary Features: with lens, mounting from backside of PCB view angle 40 package 1206 size: 3.2(L) x 1.6(W) x 1.9(H) mm circuit substrate: glass laminated epoxy devices are ROHS and REACH conform lead
Typical Electro-Optical Characteristics Typische Elektrooptische Eigenschaften Measurement conditions Messbedingungen
Features: size 1206: 3,2(L) x 1,6(W) x 1,2(H) mm circuit substrate: glass laminated epoxy selected for low forward current devices are ROHS and REACH conform lead free solderable, soldering pads: gold
Electro-Optical Characteristics (T=25 C) Elektrooptische Eigenschaften
OCU4 UC375 Features: size 3,(L) x 2,(W) x 1,(H) mm circuit substrate: Al2O3 s encapsulation: Silicone devices are ROHS and REACH conform lead free solderable, soldering pads: gold plated taped in 8 mm
Electro-Optical Characteristics (T=25 C) Elektrooptische Eigenschaften. Parameter Symbol Condition Min Typ Max Unit Color Farbe
Features: size 1206: 3,2(L) x 1,6(W) x 1,2(H) mm circuit substrate: glass laminated epoxy devices are ROHS and REACH conform lead free solderable, soldering pads: gold plated taped in 8 mm blister tape,
Electro-Optical Characteristics (T=25 C) Elektrooptische Eigenschaften
Features: size 3,8(L) x 3,8(W) x 1,0(H) mm circuit substrate: AlN Ceramics devices are ROHS and REACH conform lead free solderable, soldering pads: silver plated taped in 12 mm blister tape, cathode to
Electro-Optical Characteristics (T=25 C) Elektrooptische Eigenschaften
preliminary Features: package 1206 with lens, mounting from backside of PCB view angle 40 size: 3,2(L) x 1,6(W) x 1,9(H) mm circuit substrate: glass laminated epoxy devices are ROHS and REACH conform lead
Opto Semiconductors. Vorläufige Daten / Preliminary Data
CHIPLED Vorläufige Daten / Preliminary Data Besondere Merkmale SMT-Gehäusetyp: 63 Farben: grün (572 nm), gelb (59 nm) Abstrahlcharakteristik: extrem breit (16 ) Industriestandard bzgl. Lötpadraster geringe
Impuls-Laserdiode im Plastikgehäuse 3 W Spitzenleistung Pulsed Laser Diode in Plastic Package 3 W Peak Power SPL PL90_0
Impuls-Laserdiode im Plastikgehäuse 3 W Spitzenleistung Pulsed Laser Diode in Plastic Package 3 W Peak Power SPL PL90_0 Vorläufige Daten / Preliminary Data Besondere Merkmale Kostengünstiges Plastikgehäuse
3 mm (T1) LED, Diffused LR 3360, LS 3360, LO 3360 LY 3360, LG 3360, LP 3360
3 mm (T1) LED, Diffused LR 3360, LS 3360, LO 3360 Besondere Merkmale eingefärbtes, diffuses Gehäuse als optischer Indikator einsetzbar Lötspieße mit Aufsetzebene gegurtet lieferbar Störimpulsfest nach
UV-Lumineszensdiode UV Light Emitting Diode SFH Vorläufige Daten / Preliminary Data
UV-Lumineszensdiode UV Light Emitting Diode SFH 484 Vorläufige Daten / Preliminary Data Wesentliche Merkmale UV-LED mit Emissionswellenlänge 395nm Enger Abstrahlwinkel Hermetisch dichtes Gehäuse ESD-Festigkeit
Gabellichtschranke Slotted Interrupter SFH 9300
Gabellichtschranke Slotted Interrupter SFH 9300 Wesentliche Merkmale Kompaktes Gehäuse GaAs-IR-Sendediode (950 nm) Si-Fototransistor mit Tageslichtsperrfilter Einfache Unterscheidbarkeit von Sender (transparentes
GaAs-IR-Lumineszenzdiode GaAs Infrared Emitter LD 274
GaAs-IR-Lumineszenzdiode GaAs Infrared Emitter LD 274 Wesentliche Merkmale GaAs-LED mit sehr hohem Wirkungsgrad Hohe Zuverlässigkeit Gute spektrale Anpassung an Si-Fotoempfänger Gehäusegleich mit SFH 484
ø GEO GEX Maße in mm, wenn nicht anders angegeben/dimensions in mm, unless otherwise specified.
GaAs-IR-Lumineszenzdioden GaAs Infrared Emitters 415 Cathode spacing 2.54mm 2.54 mm spacing 1.8 1.2 29 27 Area not flat Chip position.8 Approx. weight.2 g Area not flat.8 1.8 1.2 29.5 27.5 Cathode (Diode)
Opto Semiconductors. White LED
Hyper TOPLED White LED Vorläufige Daten / Preliminary Data Besondere Merkmale GaN-Technologie Farbe: weiß x =.3, y =.32 nach CIE1931 Abstrahlcharakteristik: Lambertscher Strahler (12 ) ESD-sicher bis 2
GEX GEX Maße in mm, wenn nicht anders angegeben/dimensions in mm, unless otherwise specified.
Schnelle GaAlAs-IR-Lumineszenzdiode High-Speed GaAlAs Infrared Emitter 2.54 mm spacing 2.54 mm spacing.6 Anode.6.8 1.8 1.2 29.5 27.5 Area not flat Area not flat.8 9. 8.2 7.8 7.5 9. 8.2 7.8 7.5 5.7 5.1
Cathode GEX Cathode GEX06305
GaAIAs-IR-Lumineszenzdioden (88 nm) GaAIAs Infrared Emitters (88 nm) 484 Area not flat 2.54 mm spacing 2.54 mm spacing.6.4.6.4.8.2 29 27.5.8.5 29 27 Area not flat.8.5 9. 8.2 7.8 7.5 5.7 5. 9. 8.2 7.8 7.5
650nm Resonant Cavity LED-Chip 650nm Resonant Cavity LED Die F372A. Vorläufige Daten / Preliminary Data
65nm Resonant Cavity LED-Chip 65nm Resonant Cavity LED Die F372A Vorläufige Daten / Preliminary Data Besondere Merkmale keine Schwelle hohe Leistung Kurze Schaltzeiten: 15ns Oberflächenstrahler Optimale
5 mm (T1 3 / 4 ) MULTILED, Diffused LU 5351
5 mm (T1 3 / 4 ) MULTILED, Diffused LU 5351 Besondere Merkmale nicht eingefärbtes, teilweise diffuses Gehäuse Lötspieße im 2.54 mm Raster hohe Signalwirkung durch Farbwechsel der LED möglich Anzeige unterschiedlicher
Gabellichtschranke mit Schmitt-Trigger IC Slotted Interrupter with Schmitt-Trigger-IC SFH 9340 SFH 9341
Gabellichtschranke mit Schmitt-Trigger IC Slotted Interrupter with Schmitt-Trigger-IC SFH 9340 SFH 934 Wesentliche Merkmale Kompaktes Gehäuse IR-Sender: GaAs (950 nm) Empfänger: Schmitt-Trigger IC Empfänger:
Gabellichtschranke Slotted Interrupter SFH 9310
Gabellichtschranke Slotted Interrupter SFH 9310 Wesentliche Merkmale Kompaktes Gehäuse GaAs-IR-Sendediode (950 nm) Si-Fototransistor mit Tageslichtsperrfilter Anwendungen Geschwindigkeitsüberwachung Motorsteuerung
GEX Maβe in mm, wenn nicht anders angegeben/dimensions in mm, unless otherwise specified.
GaAIAs-IR-Lumineszenzdiode (88 nm) GaAIAs Infrared Emitter (88 nm) SFH 487 P 2.54 mm spacing.6.4 Area not flat.7.4.8.2 29 27.8.4 4.5 4. Cathode 3. 2.5 2..7 ø3. ø2.9 3.5 Chip position 4. 3.6.6.4 GEX638
Opto Semiconductors. Schnelle IR-Lumineszenzdiode (950 nm) im 5 mm Radial-Gehäuse High-Speed Infrared Emitter (950 nm) in 5 mm Radial Package
Schnelle IR-Lumineszenzdiode (95 nm) im 5 mm Radial- High-Speed Infrared Emitter (95 nm) in 5 mm Radial Package Area not flat 9. 8.2 7.8 7.5 5.9 5.5 fexf6626 2.54 mm spacing 1.8 1.2 29.5 27.5 Anode ø5.1
Schmitt-Trigger IC im Smart DIL Gehäuse Schmitt-Trigger IC in Smart DIL Package Lead (Pb) Free Product - RoHS Compliant SFH 5440 SFH 5441
Schmitt-Trigger IC im Smart DIL Gehäuse Schmitt-Trigger IC in Smart DIL Package Lead (Pb) Free Product - RoHS Compliant SFH 5440 SFH 544 Wesentliche Merkmale SFH 5440: Ausgang active low SFH 544: Ausgang
spacing GEO Detector: Schmitt-Trigger IC SFH 9240: Output active low
Reflexlichtschranke im P-DSO-6-Gehäuse Reflective Interrupter in P-DSO-6 Package Vorläufige Daten / Preliminary Data 0.5 0. 6.2 5.8.4.0 0...0. 2..7 4.2.8 6 2 5 4 0.5 0..27 spacing GEO06840 Type 2 4 5 6
SOCKET AND RING Lead (Pb) Free Product - RoHS Compliant. Sleeves and Ring for 3 mm and 5 mm LED. full production
2006-06-12 SOCKET AND RING Lead (Pb) Free Product - RoHS Compliant Sleeves and Ring for 3 mm and 5 mm LED full production Applications Signal lamp for front panel installation using clip mounting and a
UV-Lumineszensdiode UV Light Emitting Diode Lead (Pb) Free Product - RoHS Compliant SFH 4840
UV-Lumineszensdiode UV Light Emitting Diode Lead (Pb) Free Product - RoHS Compliant SFH 484 Vorläufige Daten / Preliminary Data Wesentliche Merkmale UV-LED mit Emissionswellenlänge 395nm Enger Abstrahlwinkel
Leistungsstarke IR-Lumineszenzdiode High Power Infrared Emitter SFH 4209
Leistungsstarke IR-Lumineszenzdiode High Power Infrared Emitter SFH 429 Wesentliche Merkmale Leistungsstarke GaAs-LED (4mW) Hoher Wirkunsgrad bei kleinen Strömen Typische Peakwellenlänge 95nm Anwendungen
Schnelle GaAs-IR-Lumineszenzdiode (950 nm) High-Speed GaAs Infrared Emitter (950 nm) SFH 4200 SFH 4205
Schnelle GaAs-IR-Lumineszenzdiode (95 nm) High-Speed GaAs Infrared Emitter (95 nm) SFH 42 SFH 425 SFH 42 SFH 425 Wesentliche Merkmale GaAs-LED mit sehr hohem Wirkungsgrad Gleichstrom- (mit Modulation)
SFH Features Especially suitable for applications from 740 nm to 1100 nm 5 mm LED plastic package Integrated NTC thermistor, R 25 =10kΩ
Silizium-PIN-Fotodiode mit integriertem Temperatur-Sensor Silicon PIN Photodiode with integrated Temperature Sensor Lead (Pb) Free Product - RoHS Compliant SFH 54 Wesentliche Merkmale Speziell geeignet
GPL Maβe in mm, wenn nicht anders angegeben/dimensions in mm, unless otherwise specified.
SM Multi OPLED SFH 722 orläufige Daten / Preliminary Data 3. 2.6 2.3 2..8.6 2 3 2..7.9.7 C C. typ 3.4 3. E (2.4) 3.7 3.3 Package marking 4..5.8.2.6.4 GPL6965 Maβe in mm, wenn nicht anders angegeben/dimensions
Multi TOPLED LSG T670, LSP T670, LSY T670 LOP T670, LYG T670, LYP T670
Multi TOPLED LSG T670, LSP T670, LSY T670 LOP T670, LYG T670, LYP T670 Besondere Merkmale Gehäusebauform: P-LCC-4 Gehäusefarbe: weiß als optischer Indikator einsetzbar zur Hinterleuchtung, Lichtleiter-
GaAlAs-IR-Lumineszenzdiode in SMT-Gehäuse mit Linse GaAlAs Infrared Emitter in SMT Package with lens SFH 4289
GaAlAs-IR-Lumineszenzdiode in SMT-Gehäuse mit Linse GaAlAs Infrared Emitter in SMT Package with lens SFH 4289 Wesentliche Merkmale TOPLED mit Linse GaAIAs-LED mit sehr hohem Wirkungsgrad Gute Linearität
Silizium-PIN-Fotodiode; in SMT und als Reverse Gullwing Silicon PIN Photodiode; in SMT and as Reverse Gullwing BPW34, BPW34S, BPW34S (R18R)
Silizium-PIN-Fotodiode; in SMT und als Reverse Gullwing Silicon PIN Photodiode; in SMT and as Reverse Gullwing BPW34, BPW34S, BPW34S (R18R) BPW 34 BPW 34 S Wesentliche Merkmale Speziell geeignet für Anwendungen
Silizium-Fotodiode Silicon Photodiode BPW 33
Silizium-Fotodiode Silicon Photodiode BPW 33 Wesentliche Merkmale Speziell geeignet für Anwendungen im Bereich von 35 nm bis 11 nm Sperrstromarm (typ. 2 pa) DIL-Plastikbauform mit hoher Packungsdichte
GaAs-IR-Lumineszenzdiode GaAs Infrared Emitter SFH 409
GaAs-IR-Lumineszenzdiode GaAs Infrared Emitter SFH 49 Wesentliche Merkmale GaAs-LED mit sehr hohem Wirkungsgrad Hohe Zuverlässigkeit Hohe Impulsbelastbarkeit Gute spektrale Anpassung an Si-Fotoempfänger
Blaue Laser Diode 1.4 W in TO56 Bauform Blue Laser Diode 1.4 W in TO56 Package PL TB450 TARGET DATASHEET
Blaue Laser Diode 1.4 W in TO56 Bauform Blue Laser Diode 1.4 W in TO56 Package PL TB450 TARGET DATASHEET Besondere Merkmale Typ. Emissionswellenlänge 450nm Effiziente Strahlungsquelle für Dauerstrich-
Schnelle InGaAlAs-IR-Lumineszenzdiode (950 nm) High-Speed InGaAlAs Infrared Emitter (950 nm) SFH 4209
Schnelle InGaAlAs-IR-Lumineszenzdiode (95 nm) High-Speed InGaAlAs Infrared Emitter (95 nm) SFH 429 Wesentliche Merkmale TOPLED mit Linse InGaAlAs-LED mit sehr hohem Wirkungsgrad Gleichstrom- (mit Modulation)
Silizium-PIN-Fotodiode mit sehr kurzer Schaltzeit Silicon PIN Photodiode with Very Short Switching Time SFH 229 SFH 229 FA
Silizium-PIN-Fotodiode mit sehr kurzer Schaltzeit Silicon PIN Photodiode with Very Short Switching Time Wesentliche Merkmale Speziell geeignet für Anwendungen im Bereich von 380 nm bis 1100 nm () und bei
Gabellichtschranke Slotted Interrupter SFH 9300
Gabellichtschranke Slotted Interrupter SFH 9300 Wesentliche Merkmale Kompaktes Gehäuse GaAs-IR-Sendediode (950 nm) Si-Fototransistor mit Tageslichtsperrfilter Einfache Unterscheidbarkeit von Sender (transparentes
Schnelle PIN-Fotodiode High Speed PIN-Photodiode Lead (Pb) Free Product - RoHS Compliant SFH 2701
Schnelle PIN-Fotodiode High Speed PIN-Photodiode Lead (Pb) Free Product - RoHS Compliant SFH 7 Wesentliche Merkmale Speziell geeignet für Anwendungen von 4nm bis 5nm Sehr kurze Schaltzeit im spezifizierten
optical axis (0.25) Circuitry GPX06992 Maβe in mm, wenn nicht anders angegeben/dimensions in mm, unless otherwise specified.
Gabellichtschranken Slotted Interrupters Vorläufige Daten / Preliminary Data SFH 901, SFH 90 SFH 90, SFH 904 SFH 906 1.5 1.1.8.98 6.8 1.74.4 0. 1 SFH 901 Maβe in mm, wenn nicht anders angegeben/dimensions
GaAs-IR-Lumineszenzdiode GaAs Infrared Emitter LD 274-3
GaAs-IR-Lumineszenzdiode GaAs Infrared Emitter LD 274 Wesentliche Merkmale GaAs-LED mit sehr hohem Wirkungsgrad Hohe Zuverlässigkeit Gute spektrale Anpassung an Si-Fotoempfänger Gehäusegleich mit SFH 484
GaAs-IR-Lumineszenzdiode GaAs Infrared Emitter Lead (Pb) Free Product - RoHS Compliant SFH 4511
GaAs-IR-Lumineszenzdiode GaAs Infrared Emitter Lead (Pb) Free Product - RoHS Compliant SFH 4511 Wesentliche Merkmale GaAs-LED mit sehr hohem Wirkungsgrad 5mm Kunststoffgehäuse Peakwellenlänge 95 nm Sehr
GaAlAs-IR-Lumineszenzdioden (880 nm) in SMR Gehäuse GaAlAs Infrared Emitters (880 nm) in SMR Package SFH 4580 SFH 4585
GaAlAs-IR-Lumineszenzdioden (88 nm) in SMR Gehäuse GaAlAs Infrared Emitters (88 nm) in SMR Package SFH 458 SFH 4585 SFH 458 SFH 4585 Wesentliche Merkmale GaAlAs-LED mit sehr hohem Wirkungsgrad SMR (Surface
Silizium-PIN-Fotodiode Silicon PIN Photodiode SFH 206 K
Silizium-PIN-Fotodiode Silicon PIN Photodiode SFH 26 K Wesentliche Merkmale Speziell geeignet für Anwendungen im Bereich von 4 nm bis 11 nm Kurze Schaltzeit (typ. 2 ns) 5-mm-Plastikbauform im LED-Gehäuse
GaAs-IR-Lumineszenzdiode (Mini Sidelooker) GaAs Infrared Emitter (Mini Sidelooker) Lead (Pb) Free Product - RoHS Compliant SFH 4110
GaAs-IR-Lumineszenzdiode (Mini Sidelooker) GaAs Infrared Emitter (Mini Sidelooker) Lead (Pb) Free Product - RoHS Compliant SFH 41 Wesentliche Merkmale Wellenlänge der Strahlung 95 nm Enger Abstrahlwinkel
Gabellichtschranke Slotted Interrupter SFH 9500
Gabellichtschranke Slotted Interrupter SFH 9500 Wesentliche Merkmale Geeignet für Oberflächenmontage (SMT) Kompaktes Gehäuse GaAs-IR-Sendediode (940 nm) Si-Fototransistor mit Tageslichtsperrfilter Mit
Silizium-Fotodiode für den sichtbaren Spektralbereich Silicon Photodiode for the Visible Spectral Range BPW 21
Silizium-Fotodiode für den sichtbaren Spektralbereich Silicon Photodiode for the Visible Spectral Range BPW 21 Wesentliche Merkmale Speziell geeignet für Anwendungen im Bereich von 350 nm bis 820 nm Angepaßt
Overcurrent Protection Leaded Disks, Coated, 12 V, 24 V
B99* C 93 C 99 Applications Overcurrent and short-circuit protection b 3, max. Features Lead-free terminals Manufacturer s logo and type designation stamped on in white Low resistance For rated currents
DatasheetArchive.com. Request For Quotation
DatasheetArchive.com Request For Quotation Order the parts you need from our real-time inventory database. Simply complete a request for quotation form with your part information and a sales representative
GaAs-IR-Lumineszenzdioden GaAs Infrared Emitters Lead (Pb) Free Product - RoHS Compliant SFH Vorläufige Daten / Preliminary Data
GaAs-IR-Lumineszenzdioden GaAs Infrared Emitters Lead (Pb) Free Product - RoHS Compliant SFH 4516 Vorläufige Daten / Preliminary Data Wesentliche Merkmale GaAs-LED mit sehr hohem Wirkungsgrad Hohe Zuverlässigkeit
DatasheetArchive.com. Request For Quotation
DatasheetArchive.com Request For Quotation Order the parts you need from our real-time inventory database. Simply complete a request for quotation form with your part information and a sales representative
BPW34FA, BPW34FAS, BPW34FAS (E9087)
Si-PIN-Fotodiode mit Tageslichtsperrfilter; in SMT und als Reverse Gullwing Silicon PIN Photodiode with Daylight Filter; in SMT and as Reverse Gullwing BPW34FA, BPW34FAS, BPW34FAS (E987) BPW 34 FA BPW
Hybride Impuls-Laserdiode mit integrierter Treiberstufe 14 W Spitzenleistung Hybrid Pulsed Laser Diode with Integrated Driver Stage 14 W Peak Power
Hybride Impuls-Laserdiode mit integrierter Treiberstufe 14 W Spitzenleistung Hybrid Pulsed Laser Diode with Integrated Driver Stage 14 W Peak Power SPL LL85 Besondere Merkmale Kleines kostengünstiges Plastik-Gehäuse
BPX 80 BPX NPN-Silizium-Fototransistor Zeilen Silicon NPN Phototransistor Arrays BPX 80 BPX
NPN-Silizium-Fototransistor Zeilen Silicon NPN Phototransistor Arrays BPX 80 Maße in mm, wenn nicht anders angegeben/dimensions in mm, unless otherwise specified. feo06367 fez06365 Wesentliche Merkmale
Strahlstärkegruppierung 1) (I F = 100 ma, t p = 20 ms) Radiant Intensity Grouping 1) I e (mw/sr)
Infrarot-LED mit hoher Ausgangsleistung High Power Infrared LED Lead (Pb) Free Product - RoHS Compliant SFH 4 preliminary data / vorläufige Daten Wesentliche Merkmale Infrarot LED mit hoher Ausgangsleistung
Silizium-PIN-Fotodiode Silicon PIN Photodiode BPX 61
Silizium-PIN-Fotodiode Silicon PIN Photodiode BPX 61 Wesentliche Merkmale Speziell geeignet für Anwendungen im Bereich von 4 nm bis 1 nm Kurze Schaltzeit (typ. 2 ns) Hermetisch dichte Metallbauform (ähnlich
Impuls-Laserdiode im Plastikgehäuse 4 W Spitzenleistung Pulsed Laser Diode in Plastic Package 4 W Peak Power Lead (Pb) Free Product - RoHS Compliant
Impuls-Laserdiode im Plastikgehäuse 4 W Spitzenleistung Pulsed Laser Diode in Plastic Package 4 W Peak Power Lead (Pb) Free Product - RoHS Compliant SPL PL9_ Besondere Merkmale Kostengünstiges Plastikgehäuse
Infrarot-LED Infrared-LED Lead (Pb) Free Product - RoHS Compliant SFH 4281
Infrarot-LED Infrared-LED Lead (Pb) Free Product - RoHS Compliant SFH 4281 Wesentliche Merkmale Emissionswellenlänge 88 nm Homogene Abstrahlcharakteristik Anwendungen Miniaturlichtschranken für Gleich-
SFH 300 SFH 300 FA. ṄPN-Silizium-Fototransistor Silicon NPN Phototransistor SFH 300 SFH 300 FA
ṄPN-Silizium-Fototransistor Silicon NPN Phototransistor Maße in mm, wenn nicht anders angegeben/dimensions in mm, unless otherwise specified. feof6652 feo06652 Wesentliche Merkmale Speziell geeignet für
Gabellichtschranke mit Schmitt-Trigger IC Slotted Interrupter with Schmitt-Trigger-IC Lead (Pb) Free Product - RoHS Compliant SFH 9340 SFH 9341
Gabellichtschranke mit Schmitt-Trigger IC Slotted Interrupter with Schmitt-Trigger-IC Lead (Pb) Free Product - RoHS Compliant SFH 9340 SFH 934 Wesentliche Merkmale IR-Sender: GaAs (950 nm) Empfänger: Schmitt-Trigger
SFH 900 SFH 900. Miniatur-Reflexlichtschranken Miniature Light Reflection Switches
Miniatur-Reflexlichtschranken Miniature Light Reflection Switches Maβe in mm, wenn nicht anders angegeben/dimensions in mm, unless otherwise specified. Wesentliche Merkmale Reflexlichtschranken für den
NPN-Silizium-Fototransistor Silicon NPN Phototransistor BP 103-4
NPN-Silizium-Fototransistor Silicon NPN Phototransistor BP 103 Wesentliche Merkmale Speziell geeignet für Anwendungen im Bereich von 420 nm bis 1130 nm Hohe Linearität TO-18, Bodenplatte, klares Epoxy-Gießharz,
GaAlAs-IR-Lumineszenzdiode in SMT-Gehäuse GaAlAs Infrared Emitter in SMT Package SFH 421 SFH 426
GaAlAs-IR-Lumineszenzdiode in SMT-Gehäuse GaAlAs Infrared Emitter in SMT Package SFH 421 SFH 426 SFH 421 SFH 426 Wesentliche Merkmale GaAIAs-LED mit sehr hohem Wirkungsgrad Gute Linearität (I e = f [I
Grüne Laser Diode 120 mw in TO56 Bauform Green Laser Diode 120 mw in TO56 Package PLP 520 PRELIMINARY
Grüne Laser Diode 120 mw in TO56 Bauform Green Laser Diode 120 mw in TO56 Package PLP 520 PRELIMINARY Besondere Merkmale Optische Ausgangsleistung (Dauerstrich- Betrieb): 90/120mW (T Case = 25 C) Typ.
Infrarot-LED Infrared-LED SFH 4281
Infrarot-LED Infrared-LED SFH 4281 Wesentliche Merkmale Emissionswellenlänge 88nm Homogene Abstrahlcharakteristik IR Reflow und TTW Löten geeignet Feuchte-Empfindlichkeitsstufe 2 nach JEDEC Standard J-STD-2A
Gabellichtschranke Slotted Interrupter SFH 9310
查询 SFH9310 供应商 Gabellichtschranke Slotted Interrupter SFH 9310 Wesentliche Merkmale Kompaktes Gehäuse GaAs-IR-Sendediode (950 nm) Si-Fototransistor mit Tageslichtsperrfilter Anwendungen Geschwindigkeitsüberwachung
GaAIAs-IR-Lumineszenzdiode (880 nm) GaAIAs Infrared Emitter (880 nm) SFH 487
GaAIAs-IR-Lumineszenzdiode (88 nm) GaAIAs Infrared Emitter (88 nm) SFH 487 Wesentliche Merkmale GaAlAs-LED mit sehr hohem Wirkungsgrad Hohe Zuverlässigkeit Hohe Impulsbelastbarkeit Gute spektrale Anpassung
GaAlAs-IR-Lumineszenzdioden (880 nm) GaAlAs Infrared Emitters (880 nm) SFH 484 SFH 485
GaAlAs-IR-Lumineszenzdioden (88 nm) GaAlAs Infrared Emitters (88 nm) 484 485 484 485 Wesentliche Merkmale GaAlAs-LED mit sehr hohem Wirkungsgrad Hohe Zuverlässigkeit Gute spektrale Anpassung an Si-Fotoempfänger
Leistungsstarke IR-Lumineszenzdiode High Power Infrared Emitter Lead (Pb) Free Product - RoHS Compliant SFH 4301
Leistungsstarke IR-Lumineszenzdiode High Power Infrared Emitter Lead (Pb) Free Product - RoHS Compliant SFH 431 Nicht für Neuentwicklungen / Not for new designs Wesentliche Merkmale Leistungsstarke GaAs-LED
Silicon Photodiode for the Visible Spectral Range Silicon Photodiode for the Visible Spectral Range Lead (Pb) Free Product - RoHS Compliant BPW 21
Silicon Photodiode for the Visible Spectral Range Silicon Photodiode for the Visible Spectral Range Lead (Pb) Free Product - RoHS Compliant BPW 21 Wesentliche Merkmale Speziell geeignet für Anwendungen
Gabellichtschranke Slotted Interrupter Lead (Pb) Free Product - RoHS Compliant SFH 9315
Gabellichtschranke Slotted Interrupter Lead (Pb) Free Product - RoHS Compliant SFH 9315 Wesentliche Merkmale Kompaktes Gehäuse GaAs-IR-Sendediode (95 nm) Si-Fototransistor mit Tageslichtsperrfilter Anwendungen
IR-Lumineszenzdiode (850 nm) mit hoher Ausgangsleistung High Power Infrared Emitter (850 nm) Lead (Pb) Free Product - RoHS Compliant SFH 4556
IR-Lumineszenzdiode (8 nm) mit hoher Ausgangsleistung High Power Infrared Emitter (8 nm) Lead (Pb) Free Product - RoHS Compliant SFH 46 Wesentliche Merkmale Infrarot LED mit hoher Ausgangsleistung Kurze
Reflector Lead (Pb) Free Product - RoHS Compliant. Reflector for 3 mm and 5 mm LED (silver) full production
2006-06-12 Reflector Lead (Pb) Free Product - RoHS Compliant Reflector for 3 mm and 5 mm LED (silver) full production Features: Besondere Merkmale: Package: reflector for 3 mm and 5 mm LED, Gehäusetyp:
GaAlAs-IR-Lumineszenzdiode (880 nm) GaAlAs Infrared Emitter (880 nm) SFH 485 P
GaAlAs-IR-Lumineszenzdiode (88 nm) GaAlAs Infrared Emitter (88 nm) SFH 485 P Wesentliche Merkmale GaAlAs-LED mit sehr hohem Wirkungsgrad Hohe Zuverlässigkeit Gute spektrale Anpassung an Si-Fotoempfänger
SIMID 1210-100. Size 1210 (EIA) or 3225 (IEC) Rated inductance 0,0082 to 100 µh Rated current 65 to 800 ma
Size 12 (EIA) or 3225 (IEC) Rated inductance 0,0082 to 0 µh Rated current 65 to 800 ma Construction Ceramic or ferrite core Laser-welded winding Flame-retardant encapsulation Features Very wide temperature
Schnelle IR-Lumineszenzdiode (950 nm) im 3 mm Radial-Gehäuse High-Speed Infrared Emitter (950 nm) in 3 mm Radial Package
Schnelle IR-Lumineszenzdiode (95 nm) im 3 mm Radial-Gehäuse High-Speed Infrared Emitter (95 nm) in 3 mm Radial Package SFH 431 Wesentliche Merkmale Hohe Pulsleistung und hoher Gesamtstrahlungsfluß Φ e
BPY 62. NPN-Silizium-Fototransistor Silicon NPN Phototransistor BPY 62. Wesentliche Merkmale
NPN-Silizium-Fototransistor Silicon NPN Phototransistor BPY 62 Maße in mm, wenn nicht anders angegeben/dimensions in mm, unless otherwise specified Wesentliche Merkmale Features Speziell geeignet für Anwendungen
0.5x geo Maβe in mm, wenn nicht anders angegeben/dimensions in mm, unless otherwise specified.
NPN-Silizium-Fototransistor mit ageslichtsperrfilter Silicon NPN Phototransistor with Daylight-Cutoff Filter SFH 31 F Vorläufige Daten / Preliminary Data Emitter/ Cathode 16.5 16. R.9 R.7 3.1 2.9.5x45
IR-Lumineszenzdiode (850 nm) mit hoher Ausgangsleistung High Power Infrared Emitter (850 nm) Lead (Pb) Free Product - RoHS Compliant SFH 4255
IR-Lumineszenzdiode (8 nm) mit hoher Ausgangsleistung High Power Infrared Emitter (8 nm) Lead (Pb) Free Product - RoHS Compliant SFH 42 Wesentliche Merkmale Infrarot LED mit sehr hoher Ausgangsleistung
Blaue Laser Diode 1.6 W in TO56 Bauform Blue Laser Diode 1.6 W in TO56 Package PL TB450B PRELIMINARY
Blaue Laser Diode 1.6 W in TO56 Bauform Blue Laser Diode 1.6 W in TO56 Package PL TB450B PRELIMINARY Besondere Merkmale Typ. Emissionswellenlänge 450nm Effiziente Strahlungsquelle für Dauerstrich- und
2-Chip Silicon PIN Photodiode 2-fach-Silizium-PIN-Fotodiode Version 1.0 KOM 2125
2007-04-12 2-Chip Silicon PIN Photodiode 2-fach-Silizium-PIN-Fotodiode Version 1.0 KOM 2125 Features: Besondere Merkmale: Especially suitable for applications from 400 nm to Speziell geeignet für Anwendungen
IR-Lumineszenzdiode (940 nm) mit hoher Ausgangsleistung High Power Infrared Emitter (940 nm) Lead (Pb) Free Product - RoHS Compliant SFH 4243
IR-Lumineszenzdiode (94 nm) mit hoher Ausgangsleistung High Power Infrared Emitter (94 nm) Lead (Pb) Free Product - RoHS Compliant SFH 4243 Wesentliche Merkmale Infrarot LED mit hoher Ausgangsleistung
Silizium-PIN-Fotodiode mit Tageslichtsperrfilter Silicon PIN Photodiode with Daylight Filter SFH 235 FA
Silizium-PIN-Fotodiode mit Tageslichtsperrfilter Silicon PIN Photodiode with Daylight Filter SFH 235 FA Wesentliche Merkmale Speziell geeignet für Anwendungen bei 88 nm Kurze Schaltzeit (typ. 2 ns) 5 mm-plastikbauform
Blaue Laser Diode 1.4 W in TO56 Bauform Blue Laser Diode 1.4 W in TO56 Package PL TB450 PRELIMINARY
Blaue Laser Diode 1.4 W in TO56 Bauform Blue Laser Diode 1.4 W in TO56 Package PL TB450 PRELIMINARY Besondere Merkmale Typ. Emissionswellenlänge 450nm Effiziente Strahlungsquelle für Dauerstrich- und gepulsten
GaAlAs-IR-Lumineszenzdioden (880 nm) GaAlAs Infrared Emitters (880 nm) Lead (Pb) Free Product - RoHS Compliant SFH 484 SFH 485
GaAlAs-IR-Lumineszenzdioden (88 nm) GaAlAs Infrared Emitters (88 nm) Lead (Pb) Free Product - RoHS Compliant 484 485 484 485 Wesentliche Merkmale GaAlAs-LED mit sehr hohem Wirkungsgrad Hohe Zuverlässigkeit