Praktikum Molekularbiologie, 5. Semester, BT 12 Martin Sievers, Gottfried Dasen und Tobias Wermelinger RT 418

Save this PDF as:
 WORD  PNG  TXT  JPG

Größe: px
Ab Seite anzeigen:

Download "Praktikum Molekularbiologie, 5. Semester, BT 12 Martin Sievers, Gottfried Dasen und Tobias Wermelinger RT 418"

Transkript

1 Praktikum Molekularbiologie, 5. Semester, BT 12 Martin Sievers, Gottfried Dasen und Tobias Wermelinger RT 418 Datum Gruppe Thema I Forensik: PCR und Restriktionsanalyse am Beispiel der ITS-Region der Hefe II Forensik: PCR und Restriktionsanalyse am Beispiel der ITS-Region der Hefe I Real-time PCR: Fleischanalyse II Real-time PCR: Fleischanalyse I mitochondriale DNA, Sequenzierung: Cytb II mitochondriale DNA, Sequenzierung: Cytb I Klonierung und Expression der SOD (Superoxid-Dismutase) in E. coli: TA-cloning Auswertung: DNA-Sequenzierung II Klonierung und Expression der SOD (Superoxid-Dismutase) in E. coli: TA-cloning Auswertung: DNA-Sequenzierung I Klonierung und Expression der SOD Elektroporation: GFP-, puc-vektor blau-weiss-selektion II Klonierung und Expression der SOD Elektroporation: GFP-, puc-vektor blau-weiss-selektion I Klonierung und Expression der SOD: SDS-PAGE Klonierungstrategie: Calcitonin II Klonierung und Expression der SOD: SDS-PAGE Klonierungstrategie: Calcitonin I und II Protokoll der SOD Klonierung und Expression der SOD: bitte Protokoll erstellen

2 PCR: Polymerase Chain Reaction DNA-Restriktionsenzyme Amplifikation der ITS- Regionen von Hefen DNA-Restriktion der PCR-Produkte

3 Ist die? Hefe: Saccharomyces cerevisiae, Hanseniaspora uvarum oder Candida utilis? CCOS 581 CCOS 582 Saccharomyces cerevisiae Hanseniaspora uvarum Candida utilis?

4 «Genes in a bottle»

5 Forensic DNA Fingerprinting Kit

6

7 M CS

8 Molekulare Identifizierung Bakterien Hefen Chromosom Plasmid chr. DNA Plasmidprofil Protein-Profil: MALDI-TOF-MS Restriktionsmuster (rep-pcr) Auftrennung von Chromosomen: Pulsed Field Gelelektrophorse Sequenz: 16S rdna, 23S rdna Sequenz: ITS, 18S, 26/28S rdna

9 MALDI-TOF MS spectrum of Pseudomonas aeruginosa Intens. [a.u.] x m/z ICBC, Ivana Kroslakova und Cultue Collection of Switzerland 9

10 Lage der Internal Transcribed Spacer (ITS)-Region bei Hefen 18S rdna ITS 1 5.8S rdna ITS 2 26S rdna 1.8 kb 0.15 kb 3.8 kb

11 rrna-operon, Eukarya DNA ITS1 ITS2 18S rdna 5.8S rdna 28/26S rdna Transkription rrna 18S rrna 5.8S rrna 28/26S rrna

12 Formaldehyd-RNA-Gel von verschiedenen Arten human 28S rrna 26S rrna 18S rrna 23S rrna 16S rrna Qiagen

13 (ITS)-Region bei Hefen 18S rdna ITS 1 5.8S rdna ITS 2 26S rdna Std Std Amplifikation mittels PCR Std TaqI-Verdau des PCR-Produktes

14 PCR: Polymerase Chain Reaction

15 PCR: Polymerase Chain Reaction Angelika Viviani

16 Angelika Viviani

17 Angelika Viviani

18 Isolation chromosomaler DNA als template für die PCR und Generierung eines PCR-Produktes, welches im Agarosegel eine Grösse von 580 bp ergibt

19 5' 3' ATGCCCAGCAGGGACGCTTGGCGAGGTATCAACGGCTACTAA TACGGGTCGTCCCTGCGAACCGCTCCATAGTTGCCGATGATT 3' 5' Denaturierung 3' 5' ATGCCCAGCAGGGACGCTTGGCGAGGTATCAACGGCTACTAA 3' TACGGGTCGTCCCTGCGAACCGCTCCATAGTTGCCGATGATT 5'

20 5' ATGCCCAGCAGGGACGCTTGGCGAGGTATCAACGGCTACTAA 3' 3' TACGGGTCGTCCCTGCGAACCGCTCCATAGTTGCCGATGATT Primer annealing 5' 5' 3' ATGCCCAGCAGGGACGCTTGGCGAGGTATCAACGGCTACTAA forward 5' 3' ATGCCCAGC GCCGATGATT 3' 5' reverse TACGGGTCGTCCCTGCGAACCGCTCCATAGTTGCCGATGATT 3' 5'

21 5' 3' ATGCCCAGCAGGGACGCTTGGCGAGGTATCAACGGCTACTAA GCCGATGATT 5' 3' 3' 5' ATGCCCAGC TACGGGTCGTCCCTGCGAACCGCTCCATAGTTGCCGATGATT 3' 5' Polymerization 5' 3' ATGCCCAGCAGGGACGCTTGGCGAGGTATCAACGGCTACTAA TACGGGTCGTCCCTGCGAACCGCTCCATAGTTGCCGATGATT 3' 5' 5' ATGCCCAGCAGGGACGCTTGGCGAGGTATCAACGGCTACTAA 3' TACGGGTCGTCCCTGCGAACCGCTCCATAGTTGCCGATGATT 3' 5'

22 1993: Nobelpreis für Chemie gemeinsam mit Michael Smith für die Entdeckung der PCR Spektrum der Wissenschaft, Juni 1990

23 Denaturierung DNA-Replikation Primer annealing dntp, DNA- Polymerase Polymerisation PCR dntp, Taq- Polymerase

24

25 template 3 -AGC AGA CGG ATG AGT CGG GAT CAG AGA GAT TGC CCG AGG GCA GCA AAT TCG TCT GCC TAC TCA GCC CTA GTC TAT CTA ACG GGC TCC CGT CGT TTA 3 Schritt 1: Denaturierung (95 C): 3 -AGC AGA CGG ATG AGT CGG GAT CAG AGA GAT TGC CCG AGG GCA GCA AAT TCG TCT GCC TAC TCA GCC CTA GTC TAT CTA ACG GGC TCC CGT CGT TTA 3 Schritt 2: Primer Annealing (berechnet nach T m Wert): 3 -AGC AGA CGG ATG AGT CGG GAT CAG AGA GAT TGC CCG AGG GCA GCA AAT TCG TCT GCC TAC TCA GCC CTA GAT TGC CCG AGG GCA GCA AAT 5 35 x 5 -TCG TCT GCC TAC TCA GCC CTA GTC TAT CTA ACG GGC TCC CGT CGT TTA 3 Schritt 3: DNA Synthese durch hitzestabile Polymerase: 3 -AGC AGA CGG ATG AGT CGG GAT CAG AGA GAT TGC CCG AGG GCA GCA AAT TCG TCT GCC TAC TCA GCC CTA GTC ATA GAT TGC CCG AGG GCA GCA AAT TCG TCT GCC TAC TCA GCC CTA GTC TAT CTA ACG GGC TCC CGT CGT TTA 3

26 anfängliche Denaturierung Denaturierung PCR Primer annealing 35 x dntp, DNA- Polymerase Polymerisation final polymerization 8 C 2 35 Kopien

27 PCR Zyklus, Thermoprofil 1 Zyklus der 35 Zyklen Temperatur 95 C Denaturierung 72 C 55 C Polymerisation Primer annealing Zeit

28 PCR-Temperaturprofil 35x 95 C 95 C Temperatur Polymerisation. 2 min anfängliche Denat. 15 min Denat. 30 sec. 55 C Primer annealing 30 sec. 72 C final Polymer. 10 min 8 C Abkühlung hold Zeit

29 Probe Isolierung der DNA PCR Ansatz Reagenzien zur DNA: dntp's (desoxynucleotidtriphosphate) Primer forward Primer reverse Taq-Polymerase Puffer (Mg 2+ ) H 2 O Thermal-Cycler Auswertung kb Agarosegelelektrophorese 1: positiv Kontrolle 2: PCR-Produkt 3: negativ Kontrolle

30 Handling o Einweghandschuhe tragen o nur sterile Pipettenspitzen und PCR Reaktionsgefässe verwenden o Pipettenspitzen mit Filter benutzen (Aerosole) o PCR Reaktionsgefässe richtig beschriften o bei jedem Pipettierschritt neue Spitze verwenden o Pipetierschritt kontrollieren ( l Massstab) o Vermeidung von Kontaminationen: separater Raum, Sterilbanch: Aufarbeitung der Probe: DNA Isolation PCR Kammer: Pipettierung: Primer, dntp's, Polymerase, Puffer und steriles bidest H 2 O separater Bereich: Zugabe der isolierten DNA o stets positiv und negativ Kontrollen mitführen o Angaben der Hersteller beachten

31 PCR-Produkt, Berechnung (PCR-Formel) X n = X 0 2 n X n = Menge des PCR-Produktes nach n Zyklen X 0 = Ausgangsmenge der template DNA n = Anzahl der Zyklen X n = X 0 (1 + E) n Abbildung: Roche: PCR, eine ausgezeichnete Methode X n = Menge des PCR-Produktes nach n Zyklen X 0 = Ausgangsmenge der template DNA E = Effizienz der PCR (Wert zwischen 0 und 1)

32 Denaturierung ersten zwei PCR-Zyklen Primer Annealing Polymerisation Polymerisation Denaturierung 35 Zyklen konstantes Template lineare Zunahme Primer Annealing exponentielle Zunahme

33 Generation of longer PCR products 22 kbp 6.8 kbp DNA: Ixodes ricinus PCR-Produkte: 22 kb (Banden 2-10), Eppendorf PCR: OmpA: R. helvetica Roche PCR-Fragmente: 20 kb PCR-Fragmente: 5 bis 9 kb

34 Amplifikation eines DNA Fragmentes 5' 3' ATGATATGCCCCGCCTCCTAA vorwärts (forward) Länge des Amplifikates reverse 3' 5' Sequenzangabe bei der Bestellung der Primer: 5' 3' Primer (vorwärts): Primer (reverse): Primerlänge als Beispiel: 5 nt

35 Design: PCR-Primer, RT-Primer, Aufgaben o o DNA-Sequenz, Einzelstrang, NCBI-Genbank: SOD, E. coli mrna-sequenz: GFP, Aquorea victoria

36 E. coli: Superoxid-Dismutase: SOD Accession No.: X03951, cds: 141 bis 761: 621 bp

37 SOD, E. coli PCR-Primer, DNA-Sequenz: Primer, forward: Primer, reverse: T m -Wert: Temperatur: Primer annealing:

38 GFP, mrna, Aequorea victoria Accession No.: L b Foto: Prospekt: Bio-Rad augag uaaaggagaa gaacuuuuca cuggaguugu cccaauucuu guugaauuag auggcgaugu uaaugggcaa aaauucucug ucaguggaga gggugaaggu gaugcaacau acggaaaacu uacccuuaaa uuuauuugca cuacugggaa gcuaccuguu ccauggccaa cacuugucac uacuuucucu uaugguguuc aaugcuuuuc aagauaccca gaucauauga aacagcauga cuuuuucaag agugccaugc ccgaagguua uguacaggaa agaacuauau uuuacaaaga ugacgggaac uacaagacac gugcugaagu caaguuugaa ggugauaccc uuguuaauag aaucgaguua aaagguauug auuuuaaaga agauggaaac auucuuggac acaaaaugga auacaacuau aacucacaua auguauacau cauggcagac aaaccaaaga auggaaucaa aguuaacuuc aaaauuagac acaacauuaa agauggaagc guucaauuag cagaccauua ucaacaaaau acuccaauug gcgauggccc uguccuuuua ccagacaacc auuaccuguc cacacaaucu gcccuuucca aagaucccaa cgaaaagaga gaucacauga uccuucuuga guuuguaaca gcugcuggga uuacacaugg cauggaugaa cuauacaaau aa

39 RT-PCR: mrna dscdna mrna 5' 3' AUG UAA

40 GFP, mrna: RT-PCR Foto: Prospekt: Bio-Rad Reverse Transkriptase, Primer, DNA-Sequenz: PCR-Primer, DNA-Sequenz: Primer, forward: Primer, reverse: T m -Wert: Temperatur: Primer annealing: Anzahl zu bestellende Primer für RT-PCR? 2 Primer 3 Primer

41 Use IUB code for mixed base sites: Degenerierte Primer N=G,A,T,C; V=G,A,C; B=G,T,C; H=A,T,C; D=G,A,T; K=G,T; S=G,C; W=A,T; M=A,C; Y=C,T; R=A,G DNA-Sequenz verschiedener Bakterienarten 1. ATG GGC CCA CGC CTC AGT GAA 2. ATG GGC CCA CGC CAC AGT GAA 3. ATG GGT CCG CGC CTC AGT GAA 4. ATG GGT CCG CGC CAC AGT GAA 5. ATG GGC CCA CGC CTC ACT GAA 6. Sequenz nicht bekannt Consensus ATG GGY CCR CGC CWC AST GAA Primer (vor.) ATG GGY CCR CGC CWC AST

42 Bestellung Primer: z.b.: Formular ausfüllen Primer (Oligonukleotide) werden trocken verschickt Produkt 5 Min. bei 65 C in sterilem bidest lösen, zwischendurch vortexen Menge des Primers ist in nmol angegeben Konzentration: nmol/ml (= pmol/ l = M) Primerkonzentration einstellen auf: 100 pmol/ l z.b. Primer: 59 nmol wieviel steriles bidest. H 2 O muss ich zum Primer zugeben, um eine Konzentration von 100 pmol/ l zu haben?

43 5' RACE (rapid amplification of cdna-ends) PCR

44 Herstellung einer DNA-Sequenz mit einer Mutation vorgegebene DNA- Sequenz soll an einer Stelle mutiert werden 1. PCR: vorwärts Primer mit einem Nukleotidaustausch 2. PCR: reverse Primer mit einem Nukleotidaustausch PCR genutzt um die neue DNA-Sequenz mit der Mutation herzustellen DNA-Sequenz mit Punktmutation hergestellt

45 Thr ATG CCG ATA CGA GTG AAC AGC ACA TGG CCA CAG AAG GTA CAT TAA TAC GGC TAT GCT CAC TTG TCG TGT ACC GGT GTC TTC CAT GTA ATT Einfügen einer Mutation in einer DNA- Sequenz mittels PCR Ala ATG CCG ATA CGA GTG AAC AGC GCA TGG CCA CAG AAG GTA CAT TAA TAC GGC TAT GCT CAC TTG TCG CGT ACC GGT GTC TTC CAT GTA ATT 1. PCR ATG CCG ATA CGA GTG AAC AGC ACA TGG CCA CAG AAG GTA CAT TAA TCG CGT ACC GGT ATG CCG ATA TAC GGC TAT GCT CAC TTG TCG TGT ACC GGT GTC TTC CAT GTA ATT 2. PCR ATG CCG ATA CGA GTG AAC AGC ACA TGG CCA CAG AAG GTA CAT TAA CAT GTA ATT AAC AGC GCA TGG TAC GGC TAT GCT CAC TTG TCG TGT ACC GGT GTC TTC CAT GTA ATT

46 1. PCR Produkt: ATG CCG ATA CGA GTG AAC AGC GCA TGG CCA TAC GGC TAT GCT CAC TTG TCG CGT ACC GGT 2. PCR Produkt: AAC AGC GCA TGG CCA CAG AAG GTA CAT TAA TTG TCG CGT ACC GGT GTC TTC CAT GTA ATT PCR, annealing 5' 3' ATG CCG ATA CGA GTG AAC AGC GCA TGG CCA TTG TCG CGT ACC GGT GTC TTC CAT GTA ATT 3' PCR, Polymerisation 5' ATG CCG ATA CGA GTG AAC AGC GCA TGG CCA CAG AAG GTA CAT TAA TAC GGC TAT GCT CAC TTG TCG CGT ACC GGT GTC TTC CAT GTA ATT

47 Biol. Unserer Zeit, 4/2008 (38),Wiley VCH Restriktionsenzyme

48 Restriktion und Modifikation E. coli Robert M. Blumenthal and Xiaodong Cheng, Modern Microbial Genetics, 2002, Wiley-Liss

49 Restriktion und Modifikation von DNA Chemie in unserer Zeit, 1988

50 6nt-Regel beim Schneiden mit Restriktionsenzymen 5' 3' AATTCAGAATTC TTAAGTCTTAAG EcoRI 6nt AATTCAGAATTC TTAAGTCTTAAG GGATCCTATCCT CCTAGGATAGGA BamHI 6nt GGATCCTATCCT CCTAGGATAGGA 3' 5' AATTCAG AATTC G GATCCTATCCT TTAAGTCTTAA G CCTAG GATAGGA

51 PCR-Fragment mit Erkennungssequenzen für Restriktionsenzyme EcoRI cds BamHI 6 nt GAATTC CTTAAG ATG --- TAA TAC --- ATT GGATCC CCTAGG 6 nt EcoRI BamHI EcoRI und BamHI Vektor Vektor

52 PCR Primer mit zusätzlicher Erkennungssequenz für ein Restriktionsenzym am 5'-Ende 3' 3' 5'

53 Konstruktion von PCR-Primer mit Erkennungssequenz für Restriktionsenzyme 5' GAATTC 3' 3' CTTAAG 5' EcoRI 5' GGATCC 3' 3' CCTAGG 5' BamHI Bacillus amyloliquefaciens H am Beispiel der Amplifikation des Oberflächenproteins S vom Hepatitis B-Virus Primer HBsAg+ EcoRI vorwärts: Primer HBsAg + BamHI reverse:

54 Hepatitis B virus S antigen gene, complete cds GenBank: AF cds: 1 bis 681 ATGGAGAACACAGCATCAGGACTCCTAGGACCCCTGCTCGTGTTACAGGCGGGGTTTTTCTTGTTGACAA AAATCCTCACAATACCACAGAGTCTAGACTCGTGGTGGACTTCTCTCAATTTTCTAGGGGGAACACCCGT GTGTCTTGGCCAAAATTCGCAGTCCCAAATCTCCAGTCACTCACCAACCTGTTGTCCTCCAATTTGTCCT GGTTATCGCTGGATGTGTCTGCGGCGTCTTATCATCTTCCTCTGCATCCTGCTGCTATGCCTCATCTTCT TGTTGGTTCTTCTGGACTATCAAGGTATGTTGCCCGTTTGTCCTCTAATTCCAGGATCATCAACAACCAG CACCGGACCATGCAAAACCCGCACAACTCCTGCTCAAGGAACCTCTATGTTTCCCTCATGTTGCTGTATA AAACCTACGGACGGAAACTGCACCTGTATTCCCATCCCATCATCTTGGGCTTTCGCAAAATACCTATGGG AGTGGGCCTCAGTCCGTTTCTCTTGGCTCAGTTTACTAGTGCCATTTGTTCAGTGGTTCGTAGGGCTTTC CCCCACTGTCTGGCTTTCAGTTATATGGATGATATGGTTTTGGGGGCCAAGTCTGTACAACATCTTGAGT CCCTTTATGCCGCTGTTACCAATTTTCTTTTGTCTTTGGGTATACATTTGA

55 Konstruktion von PCR-Primer mit Erkennungssequenz für Restriktionsenzyme 5' GAATTC 3' 3' CTTAAG 5' EcoRI 5' GGATCC 3' 3' CCTAGG 5' BamHI am Beispiel der Amplifikation des Oberflächenproteins S vom Hepatitis B-Virus Primer HBsAg+ EcoRI vorwärts: TTGCTTGAATTCATGGAGAACACAGCATCAGGACTCCTAGGACC Primer HBsAg + BamHI reverse: TTCCTTGGATCCTCAAATGTATACCCAAAGACAAAAGAAAATTGG

56 Konstruktion von PCR-Primer mit Erkennungssequenz für Restriktionsenzyme 5' GAATTC 3' 3' CTTAAG 5' EcoRI 5' GGATCC 3' 3' CCTAGG 5' BamHI am Beispiel der Amplifikation des Oberflächenproteins S vom Hepatitis B-Virus Primer HBsAg+ EcoRI vorwärts: TTGCTTGAATTCATGGAGAACACAGCATCAGGACTCCTAGGACC Primer HBsAg + BamHI reverse: TTCCTTGGATCCTCAAATGTATACCCAAAGACAAAAGAAAATTGG

57 PCR-Produkt: Oberflächenprotein S vom Hepatitis B-Virus (HBsAg) mit Erkennungssequenzen für EcoRI und BamHI 6 nt EcoRI cds BamHI 6 nt TTGCTT GAATTC ATGGAG --- ATTTGA GGATCC AAGGAA AACGAA CTTAAG TACCTC --- TAAACT CCTAGG TTCCTT

58 EcoRI und BamHI schneiden nicht in der cds vom Hepatitis B, Oberflächenprotein S!

59 Hallwilersee: Cyanobakterien o Umweltprobe aus dem Hallwilersee o Isolierung Cyanobakterien: Planktothrix rubescens o Identifizierung auf Artniveau o PCR: Gen kodierend für die Gasvakuole: gvpa o Zur Sequenzierung eingesendet zur Firma GATC o Sequenzieung: Barcode-Etikette: Planktothrix rubescens BAFU-Projekt

60 Ergebnis: GATC online: Freitag, , 18:30 Uhr Sequenz: : Ebola-Virus Ebola-Virus identifiziert

61 Warum kein Ebola-Virus: Ebola-Virus nicht endemisch in der Schweiz ausgewählten Primer zur Amplifikation des gvpa-gens hat keine Homologie zu Ebola-Virus-Sequenzen RNA-Virus, wir haben aber DNA isoliert und PCR durchgeführt und nicht RT-PCR

62 GATC hat die Probe vertauscht

A- Zugabe von 180µl Pufferlösung und Proteinase K, Inkubation bei 56 C. B- Zugabe von 200µl einer zweiten Pufferlösung, Inkubation bei 70 C

A- Zugabe von 180µl Pufferlösung und Proteinase K, Inkubation bei 56 C. B- Zugabe von 200µl einer zweiten Pufferlösung, Inkubation bei 70 C 3 Methoden 3.1 Extraktion der DNA aus den Paraffinschnitten 3.1.1 Extraktions-Kit Das QIAamp DNA Mini Kit- System beruht auf dem Prinzip der Auflösung der Eiweiße mit Proteinase K, DNA Bindung an eine

Mehr

Material MATERIAL 3.1 Oligonukleotide

Material MATERIAL 3.1 Oligonukleotide Material 13 3 MATERIAL 3.1 Oligonukleotide AGK34 LINE1 Ale1 Ale3 LIS1 LIS2 UR UL RA2 LS2 pbst7 sp6 DOP (6-MW) pcypac2-01 pcypac2-02 SD2 SA2 SA4 SD6 D11S2164 (CP5) forward D11S2164 (CP5) revers M16 forward

Mehr

Primer zum Nachweis eukaryoter DNA (Kontroll-PCR) Primer Sequenz Ziel-Gen Produktgröße T a

Primer zum Nachweis eukaryoter DNA (Kontroll-PCR) Primer Sequenz Ziel-Gen Produktgröße T a 7 Anhang 7.1 Primersequenzen Alle Oligonukleotide sind in 5-3 -Orientierung aufgelistet. 7.1.1.1.1 Primer zum Nachweis eukaryoter DNA (Kontroll-PCR) 258 s CCA TCC AAC ATC TCA GCA TGA TGA AA GCC CCT CAG

Mehr

Methodensammlung der Bund/Länder-Arbeitsgemeinschaft Gentechnik. PCR- Nachweis von E. coli B- und BL21- Stämmen

Methodensammlung der Bund/Länder-Arbeitsgemeinschaft Gentechnik. PCR- Nachweis von E. coli B- und BL21- Stämmen Methodensammlung der Bund/Länder-Arbeitsgemeinschaft Gentechnik PCR- Nachweis von E. coli B- und BL21- Stämmen Erstellt vom Unterausschuss Methodenentwicklung der LAG, März 2005 1. Zweck und Anwendungsbereich

Mehr

Genannotation bei Prokaryoten

Genannotation bei Prokaryoten Genannotation bei Prokaryoten Maike Tech Abt. Bioinformatik Institut für Mikrobiologie und Genetik (IMG) Universität Göttingen 28. November 2005 Genetik von Pro- und Eukaryoten Eukaryoten Prokaryoten Zellkern

Mehr

Sigma-Aldrich Chemie GmbH, München Merck Biosciences, Darmstadt. Thermo Hybaid GmbH, Ulm Roche Diagnostics GmbH, Mannheim

Sigma-Aldrich Chemie GmbH, München Merck Biosciences, Darmstadt. Thermo Hybaid GmbH, Ulm Roche Diagnostics GmbH, Mannheim 3 Materialien 28 3 Materialien 3.1 Chemikalien Acrylamid Agar Agarose Ammoniumsulfat Ampicillin, Natriumsalz L-Arabinose Bradford-Reagenz Bromphenolblau Caseinhydrolysat Chloramphenicol Chloroform Coomassie-Brillant-Blau

Mehr

2. MATERIAL UND METHODEN

2. MATERIAL UND METHODEN 2. MATERIAL UND METHODEN 2.1 Material 2.1.1 Proben zur DNA-Analytik Blutproben zur Gewinnung von DNA aus Leukozyten wurden uns freundlicherweise von Dr. Ramaekers, Universität Aachen, überlassen. Ein positives

Mehr

PCR (polymerase chain reaction)

PCR (polymerase chain reaction) PCR (polymerase chain reaction) Ist ein in vitro Verfahren zur selektiven Anreicherung von Nukleinsäure-Bereichen definierter Länge und definierter Sequenz aus einem Gemisch von Nukleinsäure-Molekülen

Mehr

Funktionelle Genomik. praktische Anwendungen

Funktionelle Genomik. praktische Anwendungen Funktionelle Genomik praktische Anwendungen Schmelzpunkt der DNA Einzelsträngige DNA absorbiert UV-Licht effektiver SYBR Green fluoresziert nur wenn es an doppelsträngiger DNA bindet Fluoreszenz erhöht

Mehr

Genisolierung in 2 Stunden : Die Polymerase-Ketten-Reaktion (PCR)

Genisolierung in 2 Stunden : Die Polymerase-Ketten-Reaktion (PCR) PCR Genisolierung in 2 Stunden : Die Polymerase-Ketten-Reaktion (PCR) von Kary B. Mullis entwickelt (1985) eigentlich im Mai 1983 bei einer nächtlichen Autofahrt erstes erfolgreiches Experiment am 16.12.1983

Mehr

3. Ergebnisse 3.1. Reaktion von Endothelzellkulturen auf Wandschubspannung

3. Ergebnisse 3.1. Reaktion von Endothelzellkulturen auf Wandschubspannung 60 3. Ergebnisse 3.1. Reaktion von Endothelzellkulturen auf Wandschubspannung Nach Stimulierung durch Wandschubspannung liessen die HUVECs aus venösen Nabelschnurendothelien bei lichtmikroskopischer Untersuchung

Mehr

Etablierung einer. Homemade - PCR

Etablierung einer. Homemade - PCR Etablierung einer Homemade - PCR Anja Schöpflin Institut für Pathologie Universitätsklinikum Freiburg Überblick: Anwendungsgebiete der PCR Anforderungen an Primer Auswahl geeigneter Primer / Primerdesign

Mehr

TCC CCA GTG AAG ACC TCC TCA GAG TCC GAC TCT. 56 C 67 siehe oben siehe oben siehe oben 56 C 66 CCG GCG CCA TTC TAT CC CGA GAA TCT GAC GCA GG 56 C 738

TCC CCA GTG AAG ACC TCC TCA GAG TCC GAC TCT. 56 C 67 siehe oben siehe oben siehe oben 56 C 66 CCG GCG CCA TTC TAT CC CGA GAA TCT GAC GCA GG 56 C 738 128 9. Anhang 9.1. Tabelle der verwendeten Primerpaare Nr. Name Sequenz 5 3 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 rcar. 981s rcar. 981s GAPDH. 682s GAPDH. 826a GAPDH. 381s GAPDH. 826a 18S-rRNA. 216s 18S-rRNA.

Mehr

Material. 3 Material. 3.1 Reagenzien

Material. 3 Material. 3.1 Reagenzien 3 Material 3.1 Reagenzien Tabelle 1: verwendete Reagenzien Substrat Hersteller Firmensitz Agarose (NEEO, Ultra-Qualität) Carl Roth Karlsruhe BPB (Bromphenolblau) Merck Darmstadt DEPC (Diethylpyrocarbonat)

Mehr

2. Material Material Chemikalien Radiochemikalien Restriktionsenzyme Enzyme (andere)

2. Material Material Chemikalien Radiochemikalien Restriktionsenzyme Enzyme (andere) 12 2. Material 2.1. Material 2.1.1. Chemikalien Alle verwendeten Chemikalien wurden in höchstem Reinheitsgrad von folgenden Firmen bezogen:, Difco Laboratories, FMC Bioproducts, Gibco BRL, Merck,, Sigma

Mehr

3. Methoden. 3.1 Chemikalien und Geräte

3. Methoden. 3.1 Chemikalien und Geräte 3. Methoden Aufgabenstellung: Ziel der Arbeit war es eine eigene Multiplexreaktion zu erstellen, die im Rechtsmedizinischen Institut der Martin-Luther-Universität Halle-Wittenberg zur Durchführung von

Mehr

kanr camr F trad36, lac I q lacz M15 proab/supe thi (lac-proab), λimm434 (P1)

kanr camr F trad36, lac I q lacz M15 proab/supe thi (lac-proab), λimm434 (P1) Material 12 2. Material 2.1 Tierstämme CD-1(ICR)BR, Auszucht-Maus Dll1-Knockout-Mäuse Hühnereier, Gallus gallus Charles River, Deutschland GSF, München Geflügelanstalt, Kitzingen Brüterei Mahler, Rimpar

Mehr

Anhang. Bedeutung Bezeichnung Rs + Nukleotidsequenz (5-3 ) Mutationsprimer Asp 29 Glu

Anhang. Bedeutung Bezeichnung Rs + Nukleotidsequenz (5-3 ) Mutationsprimer Asp 29 Glu AHAG 115 Anhang Tab. 13: Konstruktion der Primer zur Generierung der EcIPDC-Mutanten. Ausgetauschte ukleotide sind unterstrichen. Das ukleotidtriplett, welches für die mutierte Aminosäure codiert, ist

Mehr

2. Material und Methoden

2. Material und Methoden 2. Material und Methoden 2.1. Material 2.1.1. Geräte BioPhotometer 6131 (Eppendorf, Hamburg, D.) Durchlichtmikroskop BX 60 (Olympus, Hamburg, D.) Durchlichtmikroskop MZ 12 (Leica, Bensheim, D.) Feinwaage

Mehr

7 Anhang. Tabelle I: Zusammensetzung der Restriktionsansätze.

7 Anhang. Tabelle I: Zusammensetzung der Restriktionsansätze. 7 Anhang Tabelle I: Zusammensetzung der Restriktionsansätze. Reagenz Konzentration Volumen je Endkonzentration der Stammlösung Reaktionansatz Reaktionspuffer 10x NEB-Puffer 2 1.50 µl 1x MseI 4 U/µl 0.30

Mehr

3 GFP green fluorescent protein

3 GFP green fluorescent protein SCHNUPPERKURS GENTECHNIK 1 ExploHeidelberg 2 Klonierung des Phagen Lambda 3 GFP green fluorescent protein 4 Gens in a bottle Vanessa Hecht 1 ExploHeidelberg Stiftung Jugend und Wissenschaft GmbH Technologiepark

Mehr

Patente in der Biotechnologie. VPP-Düsseldorf. 2002-März-20

Patente in der Biotechnologie. VPP-Düsseldorf. 2002-März-20 Patente in der Biotechnologie VPP-Düsseldorf 2002-März-20 25 März, 2002 KB-RP / PL / PL4 / Biotechnology 1 Patente in der Biotechnologie Große Tiere, kleine Tiere, Gene, Proteine und Patente 25 März, 2002

Mehr

Untersuchungen zur Wechselbeziehung von Struktur und Funktion von Transkriptionsaktivatoren am PHO5-Promotor in Saccharomyces cerevisiae

Untersuchungen zur Wechselbeziehung von Struktur und Funktion von Transkriptionsaktivatoren am PHO5-Promotor in Saccharomyces cerevisiae Aus dem Adolf-Butenandt-Institut der Ludwig-Maximilians-Universität München Lehrstuhl: Molekularbiologie Vorstand: Prof. Dr. P. B. Becker Thema: Untersuchungen zur Wechselbeziehung von Struktur und Funktion

Mehr

Transkriptmengen und Apocarotinoidgehalte der chimären Pflanzen von. VII.4 Mykorrhizierungsgrad und Arbuskelvorkommen in Pflanzen des

Transkriptmengen und Apocarotinoidgehalte der chimären Pflanzen von. VII.4 Mykorrhizierungsgrad und Arbuskelvorkommen in Pflanzen des VII VII.1 VII.2 VII.3 Anhang Oligonucleotide p35suida-int Transkriptmengen und Apocarotinoidgehalte der chimären Pflanzen von Experiment IV VII.4 Mykorrhizierungsgrad und Arbuskelvorkommen in Pflanzen

Mehr

4.1 Erstellung einer Mammakarzinom-spezifischen cdna- Expressionsbank in λ-phagen

4.1 Erstellung einer Mammakarzinom-spezifischen cdna- Expressionsbank in λ-phagen 4 Ergebnisse 4.1 Erstellung einer Mammakarzinom-spezifischen cdna- Expressionsbank in λ-phagen 4.1.1 RNA-Isolierung aus den Mammakarzinom-Zellinien BT-474 und 8701-BC Von jeder Zellinie wurden 4 x 10 7

Mehr

2.1.2 Anamnese und Untersuchung der Patienten

2.1.2 Anamnese und Untersuchung der Patienten 2. Materialien und Methoden 2.1 Klinische Methoden 2.1.1 Patientengut Für diese Studie wurden insgesamt 108 Patienten ausgewählt, die wegen einer hypertrophen Kardiomyopathie im Deutschen Herzzentrum Berlin

Mehr

7. Anhang. 7. Anhang. Abbildung 7.1: Aminosäuresequenz AtMYC2 im Wildtyp und in jin1. Unterschiede zwischen den Sequenzen sind rot unterlegt.

7. Anhang. 7. Anhang. Abbildung 7.1: Aminosäuresequenz AtMYC2 im Wildtyp und in jin1. Unterschiede zwischen den Sequenzen sind rot unterlegt. 7. Anhang 10 20 30 40 50 60 70 80 90 100 jin1 MTDYRLQPTMNLWTTDDNASMMEAFMSSSDISTLWPPASTTTTTATTETTPTPAMEIPAQAGFNQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASV AtMYC2 MTDYRLQPTMNLWTTDDNASMMEAFMSSSDISTLWPPASTTTTTATTETTPTPAMEIPAQAGFNQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASV

Mehr

Praktikum Biochemie Biotechnologie (Molekularbiologie & Biochemie) Bettina Siebers

Praktikum Biochemie Biotechnologie (Molekularbiologie & Biochemie) Bettina Siebers Praktikum Biochemie Biotechnologie (Molekularbiologie & Biochemie) Bettina Siebers FIGURE 20.1 Biology 6/e Biotechnologie Protein Expression Genomische DNA PCR Vektormolekül (Plasmid) Escherichia coli

Mehr

4. Ergebnisse. Spezies Signalpeptid B- C-Domäne A-Domäne Total a

4. Ergebnisse. Spezies Signalpeptid B- C-Domäne A-Domäne Total a 4. Ergebnisse 4.1. Relaxin 4.1.1. Equiden 4.1.1.1. Molekulare Charakterisierung 4.1.1.1.1. Prorelaxin cdna-sequenz Mit zwei degenerierten Oligonukleotidprimern, die entsprechend der bekannten Peptid-sequenzen

Mehr

Gentechnik/Gentechnologie

Gentechnik/Gentechnologie Gentechnik/Gentechnologie Bei zelltechnischen Verfahren werden Gene wenn überhaupt, dann nur im Gesamtverband, also als ganzes Genom verschoben oder kombiniert. Bei Gentechnologischen Verfahren wird in

Mehr

2. Material und Methoden

2. Material und Methoden 2. Material und Methoden 2.1 Verwendete Materialien 2.1.1 Chemikalien und Enzyme Alle verwendeten Chemikalien wurden, sofern nicht anders angegeben, bei Sigma (München), Roth (Karlsruhe), Fluka (Buchs,

Mehr

8 Anhang. 8.1 Vektorkarten und verwendete Sequenzen 8.1.1 Vektorkarten. Anhang 90

8 Anhang. 8.1 Vektorkarten und verwendete Sequenzen 8.1.1 Vektorkarten. Anhang 90 Anhang 90 8 Anhang 8.1 Vektorkarten und verwendete Sequenzen 8.1.1 Vektorkarten 8.1.1.1 Expression in Sf9-Zellen durch Baculoviren pfastbac1 mit GST (Firma Invitrogen) Anhang 91 pbsv-8his mit Signalpeptid

Mehr

Protein-Protein-Interaktionen der U1snRNPKomponente Prp40 und deren FF-Domänen in Saccharomyces cerevisiae

Protein-Protein-Interaktionen der U1snRNPKomponente Prp40 und deren FF-Domänen in Saccharomyces cerevisiae Forschungszentrum Karlsruhe in der Helmholtz-Gemeinschaft Wissenschaftliche Berichte FZKA 7304 Protein-Protein-Interaktionen der U1snRNPKomponente Prp40 und deren FF-Domänen in Saccharomyces cerevisiae

Mehr

F-I Molekulare Zoologie: Teil I: Expressionsanalysen. Expressionsanalyse mittels RT-PCR

F-I Molekulare Zoologie: Teil I: Expressionsanalysen. Expressionsanalyse mittels RT-PCR F-I Molekulare Zoologie: Teil I: Expressionsanalysen Expressionsanalyse mittels RT-PCR Inhalt: Seite I. Generelles 1 II. RNA-Aufreinigung mit EZNA Total RNA Kit (PeqLab)...2 III. Umschreiben von RNA in

Mehr

Molekularbiologie II. Rekombinante PCR Zielgerichtete Mutagenese Heterologe Expression His-Tag Aufreinigung BIOCHEMISCHES ANFÄNGERPRAKTIKUM

Molekularbiologie II. Rekombinante PCR Zielgerichtete Mutagenese Heterologe Expression His-Tag Aufreinigung BIOCHEMISCHES ANFÄNGERPRAKTIKUM V 1.8 Molekularbiologie II BIOCHEMISCHES ANFÄNGERPRAKTIKUM FÜR CHEMIKER UND BIOLOGEN Rekombinante PCR Zielgerichtete Mutagenese Heterologe Expression His-Tag Aufreinigung Abteilung für Biochemie und Molekularbiologie,

Mehr

PCR basierte- Detektionstechniken

PCR basierte- Detektionstechniken PCR basierte- Detektionstechniken Warum überhaupt? Forensische Analysen: Vaterschaftstests, Kriminalistik Mikrobielle Gemeinschaften: Biofilme, medizinische Mikrobiologie 2 Warum überhaupt? minimale Mengen

Mehr

Epidemiologische und molekulare Studien zu PCV bei Wildschweinen deutscher Reviere

Epidemiologische und molekulare Studien zu PCV bei Wildschweinen deutscher Reviere Epidemiologische und molekulare Studien zu PCV bei Wildschweinen deutscher Reviere S. Knell, H. Willems, G. Reiner Professur für Schweinekrankheiten JLU Gießen Circoviren Taxonomie Familie: Circoviridae

Mehr

Versuch 2: Polymerasekettenreaktion. Betreuer: Knut Jahreis. Versuchsinhalt. Polymerasekettenreaktion, Gelelektrophorese auf Agarosegelen

Versuch 2: Polymerasekettenreaktion. Betreuer: Knut Jahreis. Versuchsinhalt. Polymerasekettenreaktion, Gelelektrophorese auf Agarosegelen Versuch 2: Polymerasekettenreaktion Betreuer: Knut Jahreis Versuchsinhalt Polymerasekettenreaktion, Gelelektrophorese auf Agarosegelen Zwei verschiedene Plasmide werden als Matrizen für eine Polymerasekettenreaktion

Mehr

Klassifizierung: noch nicht abgeschlossen, Verwandtschaftsverhältnis zur Familie: Desulvovibrionaceae - Vertreter Desulvovibrio desulfuricans

Klassifizierung: noch nicht abgeschlossen, Verwandtschaftsverhältnis zur Familie: Desulvovibrionaceae - Vertreter Desulvovibrio desulfuricans AVID X / 1998 Lawsonia intracellularis Seite -1- Klassifizierung: noch nicht abgeschlossen, Verwandtschaftsverhältnis zur Familie: Desulvovibrionaceae - Vertreter Desulvovibrio desulfuricans 1. ALLGEMEINES

Mehr

Erfassung und Bewertung von Genexpressionsmustern von Zebrabärblingen (Danio rerio) nach Belastung mit östrogenen Substanzen

Erfassung und Bewertung von Genexpressionsmustern von Zebrabärblingen (Danio rerio) nach Belastung mit östrogenen Substanzen Lehrstuhl für Zellbiologie der Technischen Universität München Wissenschaftszentrum Weihenstephan Univ.-Prof. Dr. Bertold Hock Erfassung und Bewertung von Genexpressionsmustern von Zebrabärblingen (Danio

Mehr

Gentechnologie: Isolierung und Charakterisierung von DNA

Gentechnologie: Isolierung und Charakterisierung von DNA Genetisches Grundpraktikum 9. Kurstag 23.06.2005 Gentechnologie: Isolierung und Charakterisierung von DNA Lerninhalte: Klonierung, Plasmid, Polylinker ( multiple cloning site ), Restriktionsendonuklease,

Mehr

Rank Xerox (UK) Business Services

Rank Xerox (UK) Business Services Europäisches Patentamt European Patent Office Office europeen des brevets Veröffentlichungsnummer: 0 460 674 A2 EUROPÄISCHE PATENTANMELDUNG Anmeldenummer: 91109303.7 Int. Cl.5: C12N 15/13, C12P 21/08,

Mehr

Universitätsklinikum Essen Medizinische Fakultät der Universität-Gesamthochschule Duisburg-Essen. Aus dem Institut für Humangenetik

Universitätsklinikum Essen Medizinische Fakultät der Universität-Gesamthochschule Duisburg-Essen. Aus dem Institut für Humangenetik Universitätsklinikum Essen Medizinische Fakultät der Universität-Gesamthochschule Duisburg-Essen Aus dem Institut für Humangenetik Deletionen und Insertionen des RB1-Gens bei Patienten mit Retinoblastom:

Mehr

Methodensammlung des LAG Quantitativer Nachweis von Vacciniavirus DNA mittels Real Time PCR Erstellt vom Unterausschuss Methodenentwicklung

Methodensammlung des LAG Quantitativer Nachweis von Vacciniavirus DNA mittels Real Time PCR Erstellt vom Unterausschuss Methodenentwicklung Methodensammlung des LAG Quantitativer Nachweis von Vacciniavirus DNA mittels Real Time PCR Erstellt vom Unterausschuss Methodenentwicklung des LAG, März 2003 Status: verabschiedet 1. Zweck und Anwendungsbereich

Mehr

Molekulare Verfahren im Kontext mit klinischer Praxis und Bestandsbetreuung beim Schwein

Molekulare Verfahren im Kontext mit klinischer Praxis und Bestandsbetreuung beim Schwein Molekulare Verfahren im Kontext mit klinischer Praxis und Bestandsbetreuung beim Schwein DNA-Extraktion Photometrie Polymerase-Kettenreaktion (PCR) Restriktionsanalyse Agarose-Gelelektrophorese Polyacrylamid-Gelelektrophorese

Mehr

Vorläufige Empfehlung des UAM zum Nachweis von SMRV in Zellinien Stand: Mai 2007

Vorläufige Empfehlung des UAM zum Nachweis von SMRV in Zellinien Stand: Mai 2007 Vorläufige Empfehlung des Unterausschuss Methodenentwicklung (UAM) der Bund/Länder-AG Gentechnik (LAG) zur Untersuchung von Zelllinien auf Kontamination mit dem Squirrel Monkey Retrovirus Aus der Überwachung

Mehr

Zur Funktion des MPH1-Gens von Saccharomyces cerevisiae bei der rekombinativen Umgehung von replikationsarretierenden DNA-Schäden

Zur Funktion des MPH1-Gens von Saccharomyces cerevisiae bei der rekombinativen Umgehung von replikationsarretierenden DNA-Schäden Zur Funktion des MPH1-Gens von Saccharomyces cerevisiae bei der rekombinativen Umgehung von replikationsarretierenden DNA-Schäden Dissertation zur Erlangung des Doktorgrades der Mathematisch-Naturwissenschaftlichen

Mehr

3 Ergebnisse. 3.1 cdnas

3 Ergebnisse. 3.1 cdnas 3 Ergebnisse 3.1 cdnas Das erste Screening einer Expressionsgenbank (λ-gt11, SCHARF et al., 1990) mit einem polyklonalen Kaninchenantiserum gegen HSP17 der Tomate ergab mehr als einhundert positive Klone.

Mehr

2 Materialien. Materialien 15. 2.1 Histondeacetylaseinhibitoren (HDIs) Sigma-Aldrich, Deutschland. 2.2 Zelllinien und Zellkultur.

2 Materialien. Materialien 15. 2.1 Histondeacetylaseinhibitoren (HDIs) Sigma-Aldrich, Deutschland. 2.2 Zelllinien und Zellkultur. Materialien 15 2 Materialien 2.1 Histondeacetylaseinhibitoren (HDIs) Substanz Butyrat Trichostatin A (TSA) Valproat Hersteller Sigma-Aldrich, Sigma-Aldrich, Sigma-Aldrich, 2.2 Zelllinien und Zellkultur

Mehr

Ergebnisse. 3 Ergebnisse. 3.1 Etablierung des Mutationsscreenings im Melusingen PCR

Ergebnisse. 3 Ergebnisse. 3.1 Etablierung des Mutationsscreenings im Melusingen PCR 3 Ergebnisse 3.1 Etablierung des Mutationsscreenings im Melusingen 3.1.1 PCR Die verwendeten Primer zur Amplifikation der einzelnen Exons wurden aus der Sequenz des Melusins bestimmt. Die genaue Lage der

Mehr

MOL.504 Analyse von DNA- und Proteinsequenzen

MOL.504 Analyse von DNA- und Proteinsequenzen MOL.504 Analyse von DNA- und Proteinsequenzen Vorbereitung: Start des Serial Cloners ( unter Laufwerk K: im Ordner Win_SerialCloner2-5 Programm direkt im Ordner starten) K:\Win_SerialCloner2-5 (oder 2-6

Mehr

ScieNews. ScieTalk Der bts-wissenschaftskongress. Das Magazin der bts. Juli 2013. Wissenschaft. bts aktuell

ScieNews. ScieTalk Der bts-wissenschaftskongress. Das Magazin der bts. Juli 2013. Wissenschaft. bts aktuell Juli 2013 Das Magazin der bts ScieTalk Der bts-wissenschaftskongress bts aktuell Wissenschaft Ansturm auf den Schwarzwald - Die bts in Freiburg Organs on a Chip - Vorstellung des ScieTalk Siegerprojektes

Mehr

2. Material und Methoden

2. Material und Methoden 9 2. Material und Methoden 2.1. Versuchstierhaltung und Embryonengewinnung Als Versuchstiere standen uns geschlechtsreife weibliche Hybridkaninchen (ZIKA-Hybriden, Basiszucht: Fa. Krieg, Niederwünsch)

Mehr

Praktikum Biochemie Biotechnologie (Molekularbiologie & Biochemie) Bettina Siebers

Praktikum Biochemie Biotechnologie (Molekularbiologie & Biochemie) Bettina Siebers Praktikum Biochemie Biotechnologie (Molekularbiologie & Biochemie) Bettina Siebers Protein Expression Genomische DNA PCR Vektormolekül (Plasmid) Escherichia coli Reinigung Protein Transformation des Expressionsstammes

Mehr

Die Rolle der Autoimmunreaktion gegen das SLA/LP - Molekül bei autoimmuner Hepatitis

Die Rolle der Autoimmunreaktion gegen das SLA/LP - Molekül bei autoimmuner Hepatitis Die Rolle der Autoimmunreaktion gegen das SLA/LP - Molekül bei autoimmuner Hepatitis Dissertation zur Erlangung des Grades Doktor der Naturwissenschaften am Fachbereich Biologie der Johannes Gutenberg-Universität

Mehr

Cornel Mülhardt. Genomics. 6. Auflaqe. Spektrum k - / l AKADEMISCHER VERLAG

Cornel Mülhardt. Genomics. 6. Auflaqe. Spektrum k - / l AKADEMISCHER VERLAG I Cornel Mülhardt Genomics 6. Auflaqe Spektrum k - / l AKADEMISCHER VERLAG Inhalt 1 Was ist denn "Molekularbiologie", bitteschön? 1 1.1 Das Substrat der Molekularbiologie, oder: Molli-World für Anfänger...

Mehr

Posttranskriptionelle Regulation des Chemokins CCL5 (RANTES) durch den TAB1-p38 Signalweg

Posttranskriptionelle Regulation des Chemokins CCL5 (RANTES) durch den TAB1-p38 Signalweg Posttranskriptionelle Regulation des Chemokins CCL5 (RANTES) durch den TAB1-p38 Signalweg Inauguraldissertation zur Erlangung des Grades eines Doktors der Medizin des Fachbereichs Medizin der Justus-Liebig-Universität

Mehr

PROGRAMMHEFT TSV RUDOW BERLIN

PROGRAMMHEFT TSV RUDOW BERLIN PROGRAMMHEFT TSV RUDOW BERLIN 17.6.2017 Meisterschaft der Landessieger Ü40 Fünf Mannschaften welches Bundesland holt sich den Titel? 1 AAT TGA CAC ACG TTC GCC GAT AAG GAA GTT ATG GAA CCT GGA CCA TCA CGA

Mehr

Molekularbiologie/ Genomics

Molekularbiologie/ Genomics Cornel Mülhardt Molekularbiologie/ Genomics 5. Auflage ELSEVIER SPEKTRUM AKADEMISCHER VERLAG Spektrum k-zlakademischer VERLAG Inhalt 1 Was ist denn "Molekularbiologie", bitteschön? 1 1.1 Das Substrat der

Mehr

Carnobakterien im Wein- Methoden zur Identifizierung von einem Hefen- und Bakterienisolates an GH140 in der Weinbereitung

Carnobakterien im Wein- Methoden zur Identifizierung von einem Hefen- und Bakterienisolates an GH140 in der Weinbereitung Carnobakterien im Wein- Methoden zur Identifizierung von einem Hefen- und Bakterienisolates an GH140 in der Weinbereitung In Zusammenarbeit mit Katharina Mumm, Alexander Prange Gewinnung des Hefe - Bakterienisolates

Mehr

PATENTANMELDUNG. Anmelder: BOEHRINGER MANNHEIM GMBH Sandhofer Strasse W-6800 Mannheim-Waldhof(DE)

PATENTANMELDUNG. Anmelder: BOEHRINGER MANNHEIM GMBH Sandhofer Strasse W-6800 Mannheim-Waldhof(DE) Europäisches Patentamt European Patent Office Office europeen des brevets Veröffentlichungsnummer: 0 469 523 A2 EUI EUROPAISCHE PATENTANMELDUNG Anmeldenummer: 91112739.7 @ Anmeldetag: 29.07.91 int. CIA

Mehr

Untersuchung der Spezies-Spezifität von ank Genvarianten. von Anaplasma phagocytophilum

Untersuchung der Spezies-Spezifität von ank Genvarianten. von Anaplasma phagocytophilum Aus dem Institut für Medizinische Mikrobiologie und Hygiene der Albert-Ludwigs-Universität Freiburg im Breisgau Untersuchung der Spezies-Spezifität von ank Genvarianten von Anaplasma phagocytophilum INAUGURAL-DISSERTATION

Mehr

Genotypisierung des telogenen Haares

Genotypisierung des telogenen Haares Genotypisierung des telogenen Haares Inhalt 1. Genotypisierung des telogenen Haares 2. Die Entscheidung Sequenzierung des mitochondrialen Genom oder STR-Analyse 3. Das telogene Haar und seine Entwicklung

Mehr

2. Material und Methoden

2. Material und Methoden Material und Methoden 13 2. Material und Methoden 2.1 Material 2.1.1 Gewebe 2.1.1.1 Gefriermaterial Für die Einzelzellanalyse wurden fünf Fälle des klassischen Hodgkin-Lymphoms (chl) ausgewählt. Dabei

Mehr

MPP Multiplex 2x PCR-Mastermix

MPP Multiplex 2x PCR-Mastermix Datenblatt Artikel-Nr. BS91.522.0250 250 Reaktionen in 20µl Artikel-Nr. BS91.522.1250 1250 Reaktionen a 20µl (Nur für Forschung und in vitro-anwendungen) Chargen-Nr.: Mindestens haltbar bis: Aussehen:

Mehr

MOLEKULARBIOLOGISCHE METHODEN

MOLEKULARBIOLOGISCHE METHODEN 45 MOLEKULARBIOLOGISCHE METHODEN Die Technik der DNA-Rekombination, auch als Gentechnik bezeichnet, erlaubt die Isolierung von DNA-Abschnitten (genomische oder cdna), deren Sequenzbestimmung, Modifikation

Mehr

Mycoplasma gallisepticum

Mycoplasma gallisepticum BACTOTYPE PCR Amplification Kit Mycoplasma gallisepticum Labor Diagnostik Leipzig Gebrauchsanweisung Technologie Die Produktgruppe BACTOTYPE PCR Amplification Kit umfasst optimierte Systeme zum Nachweis

Mehr

Status: verabschiedet. Alternativ kann zur Kontrolle ein 248 bp-fragment aus dem Raps- spezifischen pepc-gen (Phosphoenolpyruvate-Carboxylase)

Status: verabschiedet. Alternativ kann zur Kontrolle ein 248 bp-fragment aus dem Raps- spezifischen pepc-gen (Phosphoenolpyruvate-Carboxylase) Methodensammlung des LAG PCR-Nachweis der 35S-nptII-Übergangssequenz, der pnapin-bayte- Übergangssequenz und des plsc-gens erstellt vom Unterausschuss Methodenentwicklung des LAG Status: verabschiedet

Mehr

Inhalt. 3 Das Werkzeug... 47 3.1 Restriktionsenzyme... 47 3.2 Gele... 58 3.2.1 Agarosegele... 58

Inhalt. 3 Das Werkzeug... 47 3.1 Restriktionsenzyme... 47 3.2 Gele... 58 3.2.1 Agarosegele... 58 Inhalt 1 Was ist denn Molekularbiologie, bitteschön?...................... 1 1.1 Das Substrat der Molekularbiologie, oder: Molli-World für Anfänger.... 2 1.2 Was brauche ich zum Arbeiten?..................................

Mehr

Borrelia burgdorferi s.l.

Borrelia burgdorferi s.l. BACTOTYPE PCR Amplification Kit Borrelia burgdorferi s.l. Labor Diagnostik Leipzig Gebrauchsanweisung Technologie Die Produktgruppe BACTOTYPE PCR Amplification Kit umfasst optimierte Systeme zum Nachweis

Mehr

Informationsveranstaltung Heimtierfuttermittel. PCR-Analytik zur Bestimmung von GVOs in Heimtierfuttermitteln. C. Haldemann, ALP

Informationsveranstaltung Heimtierfuttermittel. PCR-Analytik zur Bestimmung von GVOs in Heimtierfuttermitteln. C. Haldemann, ALP Informationsveranstaltung Heimtierfuttermittel PCR-Analytik zur Bestimmung von GVOs in Heimtierfuttermitteln C. Haldemann, ALP Grundidee des Nachweises von GVOs mittels PCR Die Bestimmung genveränderter

Mehr

Molekulare Charakterisierung von ZFYVE27 und Identifizierung von Deletionen in SPG4

Molekulare Charakterisierung von ZFYVE27 und Identifizierung von Deletionen in SPG4 Aus der Abteilung Humangenetik (Prof. Dr. med. W. Engel) im Zentrum Hygiene und Humangenetik der Medizinischen Fakultät der Universität Göttingen Molekulare Charakterisierung von ZFYVE27 und Identifizierung

Mehr

Charakterisierung von Proteinen der 5 -Prozessierung mitochondrialer Transkripte in Arabidopsis thaliana

Charakterisierung von Proteinen der 5 -Prozessierung mitochondrialer Transkripte in Arabidopsis thaliana Charakterisierung von Proteinen der 5 -Prozessierung mitochondrialer Transkripte in Arabidopsis thaliana Dissertation zur Erlangung des Doktorgrades Dr. rer. nat. der Fakultät für Naturwissenschaften der

Mehr

DNA- Rekombinationstechnik. Gentechnik

DNA- Rekombinationstechnik. Gentechnik DNA- Rekombinationstechnik Gentechnik 1 Verwendung von Plasmiden in der Gentechnik Campbell 19.1 2 Die wichtigsten Schritte bei der DNA-Klonierung (Plasmid) Transformation 3 Durch Klonierung kann man DNA-Fragmente

Mehr

S-Dis Hotstart Polymerase

S-Dis Hotstart Polymerase Datenblatt Artikel-Nr. BS91.219.0200 Artikel-Nr. BS91.219.1000 200 Units 1000 Units (Nur für Forschung und in vitro-anwendungen) Chargen-Nr.: Mindestens haltbar bis: Aussehen: Farbe: 1 Beschreibung Die

Mehr

2. Konstruktion und Charakterisierung einer stx 2 -Mutante im E. coli-stamm O157:H7 86-24

2. Konstruktion und Charakterisierung einer stx 2 -Mutante im E. coli-stamm O157:H7 86-24 IV. Ergebnisse 90 2. Konstruktion und Charakterisierung einer stx 2 -Mutante im E. coli-stamm O157:H7 86-24 Die Konstruktion einer isogenen Toxinmutante des Stx2-produzierenden EHEC- Stamm O157:H7 86-24

Mehr

Metasystemische Ergebnisse zum Rezeptor-Protein Npr21 und dem molekularen Schalter cgki2.

Metasystemische Ergebnisse zum Rezeptor-Protein Npr21 und dem molekularen Schalter cgki2. Metasystemische Ergebnisse zum Rezeptor-Protein Npr21 und dem molekularen Schalter cgki2. Verschaltung des Nervensystems Forscher auf der Spur eines Schlüsselprozesses Nervenzellen müssen sich verschalten,

Mehr

Vom Gen zum Naturstoff!

Vom Gen zum Naturstoff! Pierre Stallforth // HKI Jena Vom Gen zum Naturstoff Sequenzierung: Wie erhalte ich genomische Informationen eines Organismus Genetische Knockouts, (CRISPR-Cas9) Veränderung: Bioinformatik: Datenbanken,

Mehr

Klinik und Poliklinik für Psychiatrie und Psychotherapie der Universität Würzburg Direktor: Professor Dr. med. H. Beckmann

Klinik und Poliklinik für Psychiatrie und Psychotherapie der Universität Würzburg Direktor: Professor Dr. med. H. Beckmann Klinik und Poliklinik für Psychiatrie und Psychotherapie der Universität Würzburg Direktor: Professor Dr. med. H. Beckmann Mutationsanalyse der Gene Connexin 36 (CX36) und Tyrosinkinase 3 (TYRO3) als Kandidatengene

Mehr

Herstellung universeller Influenza A Impfstofftypen und Erprobung ihrer Wirksamkeit in vivo

Herstellung universeller Influenza A Impfstofftypen und Erprobung ihrer Wirksamkeit in vivo Herstellung universeller Influenza A Impfstofftypen und Erprobung ihrer Wirksamkeit in vivo Fragestellung Die Cytos Bioltechnology AG entwickelte eine alternative Impfung gegen Influenza A. Das Matrixprotein2

Mehr

Andrée, S. und F. Schwägele (2011) Mitteilungsblatt Fleischforschung Kulmbach 50, Nr. 193, 163-171

Andrée, S. und F. Schwägele (2011) Mitteilungsblatt Fleischforschung Kulmbach 50, Nr. 193, 163-171 , 163-171 Authentifizierung ausgewählter Geflügelspezies mittels Pentaplex-Real-Time-PCR Authentication of selected poultry species by means of pentaplex real-time PCR S. ANDRÉE und F. SCHWÄGELE Zusammenfassung

Mehr

SCRIPTUM HIGH PRECISE

SCRIPTUM HIGH PRECISE Nur für Forschungszwecke Datenblatt Artikel BS.50.020 = 20 Reaktionen x 50 µl Artikel BS.50.100 = 100 Reaktionen x 50 µl Artikel BS.50. 500 = 500 Reaktionen x 50 µl Haltbarkeit: 12 Monate Lagerung bei

Mehr

Inaugural-Dissertation. zur Erlangung des Doktorgrades der Mathematisch-Naturwissenschaftlichen Fakultät der Heinrich-Heine-Universität Düsseldorf

Inaugural-Dissertation. zur Erlangung des Doktorgrades der Mathematisch-Naturwissenschaftlichen Fakultät der Heinrich-Heine-Universität Düsseldorf Feinkartierung eines QTL (Quantitative Trait Locus) für Kühletoleranz auf Chromosom 4 in Mais und dessen molekularbiologische und phänotypische Charakterisierung. Inaugural-Dissertation zur Erlangung des

Mehr

Anmeldenummer: 87113445.8 Int. Cl.4: C12N 15/00, C07H 21/04, - C07K7/36, C12N 1/20, Anmeldetag: 15.09.87 //C12P21/02.C12R1 :19

Anmeldenummer: 87113445.8 Int. Cl.4: C12N 15/00, C07H 21/04, - C07K7/36, C12N 1/20, Anmeldetag: 15.09.87 //C12P21/02.C12R1 :19 Europaishes Patentamt i European Patent Offie Veröffentlihungsnummer: 0 261 552 Offie europeen des brevets AI EUROPÄISCHE PATENTANMELDUNG Anmeldenummer: 87113445.8 Int. Cl.4: C12N 15/00, C07H 21/04, -

Mehr

1. Zusammensetzung von Colletotrichum-Nährmedien

1. Zusammensetzung von Colletotrichum-Nährmedien VII Anhang -116- VII Anhang 1. Zusammensetzung von Colletotrichum-Nährmedien Haferflockenagar 50 g Haferflocken werden mit 500 ml H 2 O dest in einem Mixer sechsmal für 20 sec auf höchster Stufe zerkleinert.

Mehr

Inhalt 1 Modellorganismen

Inhalt 1 Modellorganismen Inhalt 1 Modellorganismen....................................... 1 1.1 Escherichia coli....................................... 1 1.1.1 Historisches...................................... 3 1.1.2 Lebenszyklus.....................................

Mehr

E. coli B, F -, dcm, ompt, hsds(r B- m B- ), galλ (DE3) [Codon + ]

E. coli B, F -, dcm, ompt, hsds(r B- m B- ), galλ (DE3) [Codon + ] Material und Methoden 18 2 Material und Methoden 2.1 Material 2.1.1 Bakterienstämme Stamm Escherichia coli BL21(DE3) Codon + Escherichia coli XL1-blue Genotyp E. coli B, F -, dcm, ompt, hsds(r B- m B-

Mehr

Praktikum Biochemie Biotechnologie (Molekularbiologie & Biochemie) Bettina Siebers

Praktikum Biochemie Biotechnologie (Molekularbiologie & Biochemie) Bettina Siebers Praktikum Biochemie Biotechnologie (Molekularbiologie & Biochemie) Bettina Siebers Protein Expression Genomische DNA PCR Vektormolekül (Plasmid) Escherichia coli Reinigung Protein (1) Kolonie-PCR Polymerase

Mehr

2 Material und Methoden

2 Material und Methoden Material und Methoden 25 2 Material und Methoden 2.1 Zellbiologische Methoden 2.1.1 Zellkultur und Medien Alle Zellinien sowie PBMC (Peripheral Blood Mononuclear Cells) wurden in Zellkulturflaschen 25

Mehr

Protokoll zur Übung PCR

Protokoll zur Übung PCR Protokoll zur Übung PCR im Rahmen des Praktikums Labor an der TU Wien Durchgeführt bei Ao.Univ.Prof. Mag. Dr.rer.nat. Robert Mach Verfasser des Protokolls: Gwendolin Korinek 0625083 & Daniel Bomze 0726183

Mehr

DNA Sequenzierung. Transkriptionsstart bestimmen PCR

DNA Sequenzierung. Transkriptionsstart bestimmen PCR 10. Methoden DNA Sequenzierung Transkriptionsstart bestimmen PCR 1. Erklären Sie das Prinzip der Sanger Sequenzierung. Klären Sie dabei folgende Punkte: a) Welche besondere Art von Nukleotiden wird verwendet

Mehr

Cornel Mülhardt. Molekularbiologie/ Genomics

Cornel Mülhardt. Molekularbiologie/ Genomics Cornel Mülhardt Molekularbiologie/ Genomics 1 Was ist denn Molekularbiologie", bitteschön? 1 1.1 Das Substrat der Molekularbiologie, oder : Molli-World für Anfänger 2 1.2 Was brauche ich zum Arbeiten?

Mehr

Optimierte konstante Domänen für die effektive Expression von Fab-Fragmenten in E. coli

Optimierte konstante Domänen für die effektive Expression von Fab-Fragmenten in E. coli Aus dem Institut für Biochemie der Medizinischen Fakultät Charité Universitätsmedizin Berlin DISSERTATION Optimierte konstante Domänen für die effektive Expression von Fab-Fragmenten in E. coli zur Erlangung

Mehr

Produktkatalog 2010. Molekularbiologische Reagenzien

Produktkatalog 2010. Molekularbiologische Reagenzien Produktion, Vertrieb und Serviceleistung im Bereich der Molekularbiologie und Medizin Produktkatalog 2010 Molekularbiologische Reagenzien Molegene GmbH Bienenweg 28 35764 Sinn Tel. 02772-570952 Fax 02772-570945

Mehr

3 Material und Methoden

3 Material und Methoden 22 Material und Methoden 3 Material und Methoden 3.1 Patienten und Patientenproben TEL-AML1-Spleißvarianten und MRD-Messungen wurden an RNA-Proben von Kindern, die an einer TEL-AML1 positiven B-Vorläuferzell

Mehr

DNA mrna Protein. Initiation Elongation Termination. RNA Prozessierung. Unterschiede Pro /Eukaryoten

DNA mrna Protein. Initiation Elongation Termination. RNA Prozessierung. Unterschiede Pro /Eukaryoten 7. Transkription Konzepte: DNA mrna Protein Initiation Elongation Termination RNA Prozessierung Unterschiede Pro /Eukaryoten 3. Aus welchen vier Nukleotiden ist RNA aufgebaut? 4. DNA RNA 5. Ein Wissenschaftler

Mehr

HIV-1 NAT Blutspenderscreening Testversagen: Ursachen und mögliche Konsequenzen - Müssen zwei Zielregionen erkannt werden?

HIV-1 NAT Blutspenderscreening Testversagen: Ursachen und mögliche Konsequenzen - Müssen zwei Zielregionen erkannt werden? www.pei.de HIV-1 NAT Blutspenderscreening Testversagen: Ursachen und mögliche Konsequenzen - Müssen zwei Zielregionen erkannt werden? NAT screening and blood safety Mandatory NAT testing HCV RNA: 5 000

Mehr

1. Erklären Sie das Prinzip der Sanger Sequenzierung. Klären Sie dabei folgende Punkte: a) Welche besondere Art von Nukleotiden wird verwendet und

1. Erklären Sie das Prinzip der Sanger Sequenzierung. Klären Sie dabei folgende Punkte: a) Welche besondere Art von Nukleotiden wird verwendet und 10. Methoden 1. Erklären Sie das Prinzip der Sanger Sequenzierung. Klären Sie dabei folgende Punkte: a) Welche besondere Art von Nukleotiden wird verwendet und welche Funktion haben diese bei der Sequenzierungsreaktion?

Mehr

1 Einleitung... 13. 1.1 Staphylokokken... 13. 1.2 Koagulase-negative Staphylokokken... 13. 1.4 MSCRAMM-Proteine... 16. 1.5 LPXTG-Motive...

1 Einleitung... 13. 1.1 Staphylokokken... 13. 1.2 Koagulase-negative Staphylokokken... 13. 1.4 MSCRAMM-Proteine... 16. 1.5 LPXTG-Motive... Inhaltsverzeichnis 1 Einleitung... 13 1.1 Staphylokokken... 13 1.2 Koagulase-negative Staphylokokken... 13 1.3 Staphylococcus saprophyticus... 14 1.4 MSCRAMM-Proteine... 16 1.5 LPXTG-Motive... 16 1.6 Oberflächenassoziierte

Mehr