Markenpolitik. Hauptseminar im Wintersemester 2012/2013

Save this PDF as:
 WORD  PNG  TXT  JPG

Größe: px
Ab Seite anzeigen:

Download "Markenpolitik. Hauptseminar im Wintersemester 2012/2013"

Transkript

1 Hauptseminar im Wintersemester 2012/2013 Markenpolitik Hausarbeitsthemen und Einstiegsliteratur: Hinweis: Die genannten Quellen sind als Einführung in die Thematik zu verstehen und entbinden nicht von der eigenen Recherche, insbesondere in englischsprachigen Publikationen (Journalarticle)! Die Inhalte aller Beiträge sind grundsätzlich kritisch zu betrachten! Nutzen Sie die Einstiegsliteratur um weitere Quellen über deren Literaturverzeichnisse zu finden. 1. Grundlagen des Markenaufbaus: Eine kritische Betrachtung Burmann, C.; Meffert, H. (2007): Markenbildung und Markenstrategien, in: Albers, S.; Herrmann, A. (Hrsg.): Handbuch Produktmanagement, 3. Aufl., Wiesbaden 2007, S Esch, F. R.; Langer, T. (2005): Branding als Grundlage zum Markenaufbau, in: Esch, F. R. (Hrsg.): Moderne Markenführung, 4. Aufl., Wiesbaden 2005, S Simon, M. (2011): Brands in Context, in: Journal of Advertising Research, Jg. 51(2011), Nr. 3, S Einzel, Familien und Dachmarken als Gestaltungsoptionen im Vergleich Becker, J. (2005): Einzel, Familien und Dachmarken als grundlegende Handlungsoptionen, in: Esch, F. R. (Hrsg.): Moderne Markenführung, 4. Aufl., Wiesbaden 2005, S Erdem, T. (1998): An Empirical Analysis of Umbrella Branding, in: Journal of Marketing Research; Jg. 35(1998), Nr. 3, S Langner; T.; Esch, F. R. (2006): Corporate Branding auf Handlungsoptionen abstimmen, in: Esch, F. R., Tomczak, T.; Kernstock, J.; Langner; T. (Hrsg.): Corporate Brand Management. Marken als Anker strategischer Führung von Unternehmen, 2. Aufl., Wiesbaden 2006, S Chancen und Risiken des Imagetransfers bei Brand Extensions Dwivedi, A.; Merrilees, B. (2012): The impact of brand extensions on parent brand relationship equity, in: Journal of Brand Management, Jg. 19(2012), Nr. 5, S Esch, F. R. (2007): Markenprofilierung und Markentransfer, in: Albers, S.; Herrmann, A. (Hrsg.): Handbuch Produktmanagement, 3. Aufl., Wiesbaden 2007, S Keller, K. L. (2005): Erfolgsfaktoren von Markenerweiterungen, in: Esch, F. R. (Hrsg.): Moderne Markenführung, 4. Aufl., Wiesbaden 2005, S

2 4. Co Branding Strategien von Markenallianzen: Eine kritische Analyse Baumgarth, C. (2005): Co Branding, in: Meffert, H.; Burmann, C.; Koers, M. (Hrsg.): Markenmanagement. Identitätsorientierte Markenführung und praktische Umsetzung, 2. Aufl., Wiesbaden 2005, S Esch, F. R. et al. (2005): Management von Markenallianzen, in: Esch, F. R. (Hrsg.): Moderne Markenführung, 4. Aufl., Wiesbaden 2005, S Helmig, B.; Huber, J. A.; Leeflang, P. S. H. (2008): Co branding: The State of the Art, in: Schmalenbach Business Review, Jg. 60(2008), Nr. 4, S Analyse der Erfolgsfaktoren bei der Steuerung von Mehrmarken Portfolios Joachimsthaler, E.; Pfeiffer, M. (2005): Strategie und Architektur von Markenportfolios, in: Meffert, H.; Burmann, C.; Koers, M. (Hrsg.): Markenmanagement. Identitätsorientierte Markenführung und praktische Umsetzung, 2. Aufl., Wiesbaden 2005, S Meffert, H.; Perrey, J. (2005): Mehrmarkenstrategien Ansätze für das Management von Markenportfolios, in: Esch, F. R. (Hrsg.): Moderne Markenführung, 4. Aufl., Wiesbaden 2005, S Morgan, N.; Rego, L. (2009): Brand Portfolio Strategy and Firm Performance, in: Journal of Marketing, Jg. 73(2009), Nr. 1, S Brand Equity Ansätze zur Markenbewertung: Eine kritische Analyse Esch, F. R.; Geus, P. (2005): Ansätze zur Messung des Markenwerts, in: Esch, F. R. (Hrsg.): Moderne Markenführung, 4. Aufl., Wiesbaden 2005, S Farsky, M.; Sattler, H. (2007): Markenbewertung, in: Albers, S.; Herrmann, A. (Hrsg.): Handbuch Produktmanagement, 3. Aufl., Wiesbaden 2007, S Trommsdorff, V. (2005): Verfahren der Markenbewertung, in: Bruhn, M. (Hrsg.): Handbuch Markenführung. Kompendium zum erfolgreichen Markenmanagement. Strategien Instrumente Erfahrungen, 2. Aufl., Wiesbaden 2005, S Kritische Darstellung der Zusammenhänge zwischen Markenzufriedenheit und Markentreue Homburg, C. et al. (2005): Messung von Markenzufriedenheit und Markenloyalität, in: Esch, F. R. (Hrsg.): Moderne Markenführung, 4. Aufl., Wiesbaden 2005, S Tscheulin, K.; Helmig, B. (2007): Markentreue, Wiederkauf und Wechselverhalten, in: Albers, S.; Herrmann, A. (Hrsg.): Handbuch Produktmanagement, 3. Aufl., Wiesbaden 2007, S VonRiesen, R. D.; Herndon, N. C. (2011): Consumer Involvement with the Product and the Nature of Brand Loyalty, in: Journal of Marketing Channels, Jg. 18(2011), Nr. 4, S

3 8. Konsequenzen des Variety Seeking für die Markenpolitik Gröppel Klein, A. (2005): Verhaltenswissenschaftliche Grundlagen für die Markenführung von Konsumgütern, in: Bruhn, M. (Hrsg.): Handbuch Markenführung. Kompendium zum erfolgreichen Markenmanagement. Strategien Instrumente Erfahrungen, 2. Aufl., Wiesbaden 2005, S Michaelidou, N.; Dibb, S. (2009): Brand switching in clothing: the role of variety seeking drive and product category level characteristics, in: International Journal of Consumer Studies, Jg. 33(2009), Nr. 3, S Tscheulin, D.K.; Helmig, B. (2007): Markentreue, Wiederkauf und Wechselverhalten, in: Albers, S.; Herrmann, A. (Hrsg.): Handbuch Produktmanagement, 3. Aufl., Wiesbaden 2007, S Emotionalisierung als Ansatzpunkt der integrierten Markenkommunikation: Möglichkeiten und Grenzen Dewhirst, T.; Davis, B. (2005): Brand Strategy and integrated Marketing Communication, in: Journal of Advertising, Jg. 34(2005), Nr. 4, S Esch, F. R. (2005): Aufbau starker Marken durch integrierte Kommunikation, in: Esch, F. R. (Hrsg.): Moderne Markenführung, 4. Aufl., Wiesbaden 2005, S Freundt, T. C. (2006): Emotionalisierung von Marken. Interindustrieller Vergleich der Relevanz emotionaler Markenimages für das Konsumentenverhalten, Wiesbaden Internationale Markenstrategien im Vergleich Giersch, J. (2008): Grundlagen des internationalen Corporate Brand Managements, in: Swoboda, B.; Foscht, T. (Hrsg.): Corporate Brand Management international tätiger Unternehmen. Verhaltenswissenschaftliche Analyse interner und externer Zielgruppeneffekte unter Berücksichtigung landeskultureller Aspekte, Wiesbaden 2008, S Voet, M.; Wagemann, D. (2005): Internationale Markenführung, in: Bruhn, M. (Hrsg.): Handbuch Markenführung. Kompendium zum erfolgreichen Markenmanagement. Strategien Instrumente Erfahrungen, 2. Aufl., Wiesbaden 2005, S Whitelock, J.; Fastoso, F. (2007): Understanding international branding: defining the domain and reviewing the literature, in: International Marketing Review, Jg. 24(2007), Nr. 3, S

4 11. Besonderheiten und Herausforderungen der Markenpolitik für Dienstleistungen Grace, D.; O Cass, A. (2009): Service branding: consumer verdicts on service brands, in: Journal of Retailing & Consumer Services, Jg. 12(2005), Nr. 2, S Huber, F. ; Vollhardt, K.; Vogel, J. (2008): Aufbau von Markenbeziehungen als Grundlage des Dienstleistungsmanagements, in: Bruhn, M.; Stauss, B. (Hrsg.): Dienstleistungsmarken. Forum Dienstleistungsmanagement, Wiesbaden 2008, S Wieseke, J. (2008): Erfolgsfaktoren der Adoption innovativer Dienstleistungsmarken, in: Bruhn, M.; Stauss, B. (Hrsg.): Dienstleistungsmarken. Forum Dienstleistungsmanagement, Wiesbaden 2008, S E Branding Besonderheiten und Herausforderungen der Markenführung im Internet Edelman, D. C. (2010): Branding in The Digital Age, in: Harvard Business Review, Jg. 88(2010), Nr. 12, S Esch, F. R. et al. (2005): Markenkommunikation im Internet, in: Esch, F. R. (Hrsg.): Moderne Markenführung, 4. Aufl., Wiesbaden 2005, S Hau, S. M. ; Theobald, E. (2011): Erfolgsfaktoren und Grenzen der Markenführung im Internet, in: Theobald, E.; Haisch, P.T. (Hrsg.): Brand Evolution. Moderne Markenführung im digitalen Zeitalter, Wiesbaden 2011, S Bewertung der Erfolgsfaktoren beim Luxusmarkenmanagement Atwal, G.; Williams, A. (2009): Luxury brand marketing The experience is everything!, in: Journal of Brand Management, Jg. 16(2009), Nr. 5/6, S Lasslop, I. (2005): Identitätsorientierte Führung von Luxusmarken, in: Meffert, H.; Burmann, C.; Koers, M. (Hrsg.): Markenmanagement. Identitätsorientierte Markenführung und praktische Umsetzung, 2. Aufl., Wiesbaden 2005, S Meffert, H.; Lasslop, I. (2005): Luxusmarkenstrategie, in: Bruhn, M. (Hrsg.): Handbuch Markenführung. Kompendium zum erfolgreichen Markenmanagement. Strategien Instrumente Erfahrungen, 2. Aufl., Wiesbaden 2005, S Strategien und Ziele der Handelsmarkenpolitik: Eine kritische Analyse Burt, S.; Davies, K. (2010): From the retail brand to the retailer as a brand: themes and issues in retail branding research, in: International Journal of Retail & Distribution Management, Jg. 38(2010), Nr. 11/12, S Gröppel Klein, A. (2005): Entwicklung, Bedeutung und Positionierung von Handelsmarken, in: Esch, F. R. (Hrsg.): Moderne Markenführung, 4. Aufl., Wiesbaden 2005, S Schenk, H. O. (2005): Handels, Gattungs und Premiummarken des Handels, in: Bruhn, M. (Hrsg.): Handbuch Markenführung. Kompendium zum erfolgreichen Markenmanagement. Strategien Instrumente Erfahrungen, 2. Aufl., Wiesbaden 2005, S

5 15. Markenpiraterie Aktuelle Entwicklung und Konsequenzen für das Marketing Harte Bavendamm, H. (2005): Bekämpfung der Marken und Produktpiraterie, in: Bruhn, M. (Hrsg.): Handbuch Markenführung. Kompendium zum erfolgreichen Markenmanagement. Strategien Instrumente Erfahrungen, 2. Aufl., Wiesbaden 2005, S Lambkin, M.; Tyndall, Y. (2009): Brand counterfeiting: A marketing problem that won t go away, in: Irish Marketing Review, Jg. 20(2009), Nr.1, S Yang, D.; Fryxell, G. E. (2009): Brand Positioning and Anti counterfeiting Effectiveness, in: Management International Review, Jg. 49(2009), Nr. 6, S Zentrale Literatur in die sich immer ein Blick lohnt: Albers, S.; Herrmann, A. (2007): Handbuch Produktmanagement, 3. Aufl., Wiesbaden. Bruhn, M. (2005): Handbuch Markenführung. Kompendium zum erfolgreichen Markenmanagement. Strategien Instrumente Erfahrungen, 2. Aufl., Wiesbaden. Esch, F. R. (2005): Moderne Markenführung, 4. Aufl., Wiesbaden. Meffert, H.; Burmann, C.; Koers, M. (2005): Markenmanagement. Identitätsorientierte Markenführung und praktische Umsetzung, 2. vollst. überarb. und erw. Aufl, Wiesbaden. 5

Handbuch Markenführung

Handbuch Markenführung Manfred Bruhn (Hrsg.) Handbuch Markenführung Kompendium zum erfolgreichen Markenmanagement Strategien - Instrumente - Erfahrungen 2., vollständig überarbeitete und erweiterte Auflage Band 1 GABLER Inhaltsverzeichnis

Mehr

Moderne Markenführung

Moderne Markenführung Franz-Rudolf Esch (Hrsg.) 2008 AGI-Information Management Consultants May be used for personal purporses only or by libraries associated to dandelon.com network. Moderne Markenführung Grundlagen Innovative

Mehr

Publikationen Prof. Dr. Jörn Redler Stand: 01.03.13

Publikationen Prof. Dr. Jörn Redler Stand: 01.03.13 Publikationen Prof. Dr. Jörn Redler Stand: 01.03.13 A. Monografien Redler, J. (2003): Management von Markenallianzen, Logos. Redler, J. (2012): Grundzüge des Marketings, Berliner Wissenschaftsverlag. B.

Mehr

Moderne Markenführung

Moderne Markenführung Franz-Rudolf Esch (Hrsg.) Moderne Markenführung Grundlagen Innovative Ansätze Praktische Umsetzungen 3., erweiterte und aktualisierte Auflage GABLER Inhaltsverzeichnis Vorwort Autorenverzeichnis V XV Teil

Mehr

Modul WS-14-B-07: Wertschöpfung. Teilmodul Marketing

Modul WS-14-B-07: Wertschöpfung. Teilmodul Marketing Modul WS-14-B-07: Wertschöpfung Teilmodul Marketing Kursplan für Studierende Univ.-Prof. Dr. Claudia Fantapié Altobelli HT 11: Käuferverhalten und Marktforschung WT 12: Markenstrategie und Markenpolitik

Mehr

Corporate Brand Management

Corporate Brand Management Franz-Rudolf Esch/Torsten Tomczak/ Joachim Kernstock/Tobias Langner Corporate Brand Management Marken als Anker strategischer Führung von Unternehmen 2., aktualisierte und ergänzte Auflage GABLER Corporate

Mehr

Einführung in das wissenschaftliche Arbeiten (I) Wissenschaftliche Zitierweise

Einführung in das wissenschaftliche Arbeiten (I) Wissenschaftliche Zitierweise Fachgebiet Marketing Einführung in das wissenschaftliche Arbeiten (I) Wissenschaftliche Zitierweise SS 2012 Fachgebiet Marketing TU Ilmenau Prof. Dr. habil. Anja Geigenmüller Prof. Dr. rer. pol. habil.

Mehr

Erfolgsfaktoren der Markenführung

Erfolgsfaktoren der Markenführung Erfolgsfaktoren der Markenführung Know-how aus Forschung und Management von Prof. Dr. Hans H. Bauer, Frank Huber, Carmen-Maria Albrecht 1. Auflage Erfolgsfaktoren der Markenführung Bauer / Huber / Albrecht

Mehr

Markencontrolling von B2B-Marken Priv.-Doz. Dr. Carsten Baumgarth

Markencontrolling von B2B-Marken Priv.-Doz. Dr. Carsten Baumgarth Markencontrolling von B2B-Marken Priv.-Doz. Dr. Carsten Baumgarth 1 You cannot manage what you cannot measure! Accountants are paid to track the past, but managers are paid to build the future 2 Agenda

Mehr

4 Marketinginstrumente

4 Marketinginstrumente Gliederung 4 Marketinginstrumente 4.1 Das Produkt 4.3 Die Kommunikation 4.4 Der Preis 4.5 Die Distribution 1 Marken (rechtliche Definition) Als Marke können alle Zeichen, insbesondere Wörter einschließlich

Mehr

4 Marketinginstrumente

4 Marketinginstrumente Gliederung 4 Marketinginstrumente 4.1 Das Produkt 4.3 Die Kommunikation 4.4 Der Preis 4.5 Die Distribution 1 Marken (rechtliche Definition) Als Marke können alle Zeichen, insbesondere Wörter einschließlich

Mehr

Strategie und Technik der Markenführung

Strategie und Technik der Markenführung Strategie und Technik der Markenführung von Prof. Dr. Franz-Rudolf Esch 5., vollständig überarbeitete und erweiterte Auflage Strategie und Technik der Markenführung Esch wird vertrieben von beck-shop.de

Mehr

Paradigmenwechsel in der Markenführung? - Der Beitrag der Service-Dominant Logic

Paradigmenwechsel in der Markenführung? - Der Beitrag der Service-Dominant Logic Marketing-Umbruch // Umbruch-Marketing Prof. Dr. habil. Jan Drengner (FH Worms, Fachbereich Touristik/Verkehrswesen) Paradigmenwechsel in der Markenführung? - Der Beitrag der Service-Dominant Logic Vortragsgliederung

Mehr

MARKETING-CONTROLLING IM TOURISMUS

MARKETING-CONTROLLING IM TOURISMUS 1 von 5 12.12.2008 11:38 EMPAT :: Mitarbeiter :: Lehre :: FAQ :: Forschung :: Publikationen :: Tourismus Journal :: Kooperationen :: Anfahrt :: Sprach- und Abteilungswahl Studiengebiete :: Lehrgebiete/-bereiche

Mehr

Marketingspezialisierung: Pharmamarketing

Marketingspezialisierung: Pharmamarketing Marketingspezialisierung: Pharmamarketing Bachelorseminar WS 2013/14 Universität Hamburg, Lehrstuhl für Health Care Management Prof. Dr. Tom Stargardt Dr. Katharina Fischer, MBR Dipl.-Volksw. Dennis Guhl

Mehr

Semester: -- Workload: 300 h ECTS Punkte: 10

Semester: -- Workload: 300 h ECTS Punkte: 10 Modulbezeichnung: Modulnummer: BWMI Internationales Marketing und Branding Semester: -- Dauer: Minimaldauer 1 Semester Modultyp: Pflicht, Wahlpflicht Zu Details beachte bitte das Curriculum des jeweiligen

Mehr

1. Zentes, J. (Hrsg.) (2006): Handbuch Handel: Strategien Perspektiven Internationaler Wettbewerb, Wiesbaden.

1. Zentes, J. (Hrsg.) (2006): Handbuch Handel: Strategien Perspektiven Internationaler Wettbewerb, Wiesbaden. A. Abgeschlossene Arbeiten A.1 Bücher und selbstständige Schriften 1. Zentes, J. (Hrsg.) (2006): Handbuch Handel: Strategien Perspektiven Internationaler Wettbewerb, Wiesbaden. 2. Scholz, C.; Zentes, J.

Mehr

UNIVERSITÄT BAYREUTH Prof. Dr. Heymo Böhler Lehrstuhl für Betriebswirtschaftslehre III Marketing

UNIVERSITÄT BAYREUTH Prof. Dr. Heymo Böhler Lehrstuhl für Betriebswirtschaftslehre III Marketing -Seminar Kommunikationspolitik (Themen 1 16) im WS 09/10 Literaturhinweise Allgemeine einführende Literatur zur Kommunikationspolitik Böhler, H./Scigliano, D. (2005): -Management, Stuttgart 2005. Bruhn,

Mehr

Roland Berger-Seminar: State of the Art in Brand Management. Wintersemester 2011/2012

Roland Berger-Seminar: State of the Art in Brand Management. Wintersemester 2011/2012 1. Inhalt Roland Berger-Seminar: State of the Art in Brand Management Wintersemester 2011/ Dieses in Kooperation mit Roland Berger Strategy Consultants angebotene Marketingseminar beschäftigt sich mit

Mehr

Markenimage & Markentransferstrategien

Markenimage & Markentransferstrategien Markenimage & Markentransferstrategien Branchenbezogene Forschung Gesa von Wichert und Annett Wolf Conomic Marketing & Strategy Consultants Weinbergweg 23, 06120 Halle an der Saale Telefon: +49 345. 55

Mehr

Corporate Brand Management

Corporate Brand Management Franz-Rudolf Esch/Torsten Tomczak/ Joachim Kernstock/Tobias Langner Corporate Brand Management Marken als Anker strategischer Führung von Unternehmen GABLER Corporate Brand Management Marken als Anker

Mehr

Persönliche Kommunikation (PK) als vergessenes Instrument der Markenkommunikation

Persönliche Kommunikation (PK) als vergessenes Instrument der Markenkommunikation 02/2008 PRAXIS transfer Werbeforschung & Praxis 43 Persönliche Kommunikation (PK) als vergessenes Instrument der Markenkommunikation Priv.-Doz. Dr. Carsten Baumgarth Marmara-Universität Istanbul, Türkei

Mehr

Corporate Brand Management

Corporate Brand Management Corporate Brand Management Marken als Anker strategischer Führung von Unternehmen von Franz-Rudolf Esch, Torsten Tomczak, Joachim Kernstock, Tobias Langner, Jörn Redler 3., vollständig überarbeitete und

Mehr

Die Wirkung unterschiedlicher Markenarchitekturstrategien

Die Wirkung unterschiedlicher Markenarchitekturstrategien Die Wirkung unterschiedlicher Markenarchitekturstrategien Neue Forschungsbefunde aus der Welt der Konsumgüter und ihre Übertragbarkeit auf den Tourismus Dr. Andreas Strebinger Institut für Werbewissenschaft

Mehr

Berufsbegleitendes Studium zur Externenprüfung als Bachelor B.A.

Berufsbegleitendes Studium zur Externenprüfung als Bachelor B.A. Modulbezeichnung V.8 Marketing /Kommunikationsmanagement: Marketingmanagement Modulverantwortliche/r: Prof. Dr. Iris Ramme Modulart: Wahlpflichtfach Prüfungsleistungen 10 12 Art: K 90 Lernziele Das Modul

Mehr

Kurzprofil. Düsseldorf/München, August 2012. The Strategy Consultants of BBDO

Kurzprofil. Düsseldorf/München, August 2012. The Strategy Consultants of BBDO Kurzprofil Düsseldorf/München, August 2012 The Strategy Consultants of BBDO Wer wir sind. Batten & Company ist eine der führenden Strategieberatungen für Marketing und Vertrieb. Mit über 1000 erfolgreich

Mehr

52 Literatur. Koers, 73 114. Wiesbaden. Burmann, Christoph, Heribert Meffert, und M. Koers. 2005. Stellenwert und Gegenstand

52 Literatur. Koers, 73 114. Wiesbaden. Burmann, Christoph, Heribert Meffert, und M. Koers. 2005. Stellenwert und Gegenstand Aaker, David A. 1991. Managing brand equity: Capitalizing on the value of a brand name. New York. Aaker, David A. 1992. Management des Markenwerts. Frankfurt a. M. Aaker, David A. 1996. Building strong

Mehr

Exemplarische Studienverläufe: Spezialisiert. Masterprogramm Medien & Marketing 1

Exemplarische Studienverläufe: Spezialisiert. Masterprogramm Medien & Marketing 1 Exemplarische Studienverläufe: Spezialisiert Masterprogramm Medien & Marketing 1 Berufskarriere: Brand Management & Communication Sarah, Brand Managerin Automotiv Zu meinen Aufgaben zählen die Erarbeitung

Mehr

Exemplarische Studienverläufe Frei kombiniert. Masterprogramm Medien & Marketing 1

Exemplarische Studienverläufe Frei kombiniert. Masterprogramm Medien & Marketing 1 Exemplarische Studienverläufe Frei kombiniert Masterprogramm Medien & Marketing 1 Exemplarische Berufskarriere Andy Faupel Stellvertretender Pressesprecher Die externe Kommunikation einer öffentlichen

Mehr

Ergebnisse von qualitativen Marketingstudien: Renate Buber

Ergebnisse von qualitativen Marketingstudien: Renate Buber Ergebnisse von qualitativen Marketingstudien: Evident and Bulky oder: Suprising and Comprehensive? () Institut für Qualitative Forschung Übersicht 1. Rahmenbedingungen 2. Ziele für Marktforschungsstudien

Mehr

HR Strategy & Human Capital Management. Univ.-Prof. Dr. Christian Scholz Wintersemester 2014/2015

HR Strategy & Human Capital Management. Univ.-Prof. Dr. Christian Scholz Wintersemester 2014/2015 HR Strategy & Human Capital Management Univ.-Prof. Dr. Christian Scholz Wintersemester 2014/2015 1. Grundlagen shrm Lernziele: Verstehen zentraler (strategischer) Grundlagen, die für die gesamte Diskussion

Mehr

Seminar Controlling WS 10/11 (Bachelor) Institut für Controlling 07.07.2010 http://www.uni-ulm.de/mawi/mawi-ifc.html

Seminar Controlling WS 10/11 (Bachelor) Institut für Controlling 07.07.2010 http://www.uni-ulm.de/mawi/mawi-ifc.html Seminar Controlling WS 10/11 (Bachelor) Institut für Controlling 07.07.2010 http://www.uni-ulm.de/mawi/mawi-ifc.html Seite 2 Seminardetails Termine Anmeldung: 14.07.2010, 18.00 Uhr bei Gordon Kromschröder,

Mehr

Publikationen. Baumgarth & Baumgarth Brandconsulting

Publikationen. Baumgarth & Baumgarth Brandconsulting Publikationen Baumgarth & Baumgarth Brandconsulting MONOGRAPHIEN UND HERAUSGEBERWERKE 1. Baumgarth, C.: Vertikale Marketingstrategien im Investitionsgüterbereich dargestellt am Beispiel von Einsatzstoffen,

Mehr

Markenerfolg steigern durch systematische Markenarchitektur

Markenerfolg steigern durch systematische Markenarchitektur Markenerfolg steigern durch systematische Markenarchitektur Viele Unternehmen agieren mit unterschiedlichen Marken auf unterschiedlichen Ebenen. Ob Marken akquirierter Unternehmen, regionale Marken für

Mehr

DIE 8 SCHLÜSSEL ZUR MARKENORIENTIERTEN KULTUR

DIE 8 SCHLÜSSEL ZUR MARKENORIENTIERTEN KULTUR DIE 8 SCHLÜSSEL ZUR MARKENORIENTIERTEN KULTUR Marken sind in einem schier unüberblickbaren Angebot an Produkten und Dienstleistungen oft die einzige Orientierungshilfe. Sie schaffen Identifikation - zumindest

Mehr

Handbuch Produktmanagement

Handbuch Produktmanagement Sönke Albers/Andreas Herrmann (Hrsg.) Handbuch Produktmanagement Strategieentwicklung - Produktplanung Organisation - Kontrolle 2., überarbeitete und erweiterte Auflage GABLER Inhaltsverzeichnis Vorwort

Mehr

2 THEORETISCHE GRUNDLAGEN ZUM KUNDENBINDUNGSMANAGEMENT 11

2 THEORETISCHE GRUNDLAGEN ZUM KUNDENBINDUNGSMANAGEMENT 11 INHALTSVERZEICHNIS ABBILDUNGSVERZEICHNIS XVII TABELLENVERZEICHNIS XIX ABKÜRZUNGSVERZEICHNIS XXI 1 EINLEITUNG 1 1.1 Zur Notwendigkeit eines Kundenbindungsmanagements auf Business-to-Consumer Märkten.1 1.2

Mehr

Seminar Controlling SS 2016 (B.Sc.) Institut für Controlling 28.01.2016 http://www.uni-ulm.de/mawi/mawi-ifc.html

Seminar Controlling SS 2016 (B.Sc.) Institut für Controlling 28.01.2016 http://www.uni-ulm.de/mawi/mawi-ifc.html Seminar Controlling SS 2016 (B.Sc.) Institut für Controlling 28.01.2016 http://www.uni-ulm.de/mawi/mawi-ifc.html Seite 2 Seminardetails Termine Anmeldung: 03.02.2016, Raum He18/2.20 um 18.00 Uhr s.t. Die

Mehr

1. Anwendungspotentiale der flexiblen Planung zur Bewertung von Organisationen eine kritische

1. Anwendungspotentiale der flexiblen Planung zur Bewertung von Organisationen eine kritische Grundlagenliteratur für die Themen 1 6: Eisenführ, F.; Weber, M.; Langer, T. (2010): Rationales Entscheiden, 5. überarb. u. erw. Aufl., Springer Verlag: Berlin [u.a.], S. 19 37. Laux, H.; Gillenkirch,

Mehr

Inhaltsverzeichnis. 1 Zur Relevanz der Identifizierung von Kannibalisierungseffekten in Markenportfolios...1

Inhaltsverzeichnis. 1 Zur Relevanz der Identifizierung von Kannibalisierungseffekten in Markenportfolios...1 Inhaltsverzeichnis I INHALTSVERZEICHNIS 1 Zur Relevanz der Identifizierung von Kannibalisierungseffekten in Markenportfolios...1 2 KannibalisierungalszentralerEffektvonMehrmarkenstrategien...3 2.1 DasPhänomenderProduktkannibalisierung...3

Mehr

Die Marke. als Marketinginstrument. RATIO Betriebsberatungsges.m.b.H. A - 1070 Wien, Hermanngasse 3. Mag. Michael Dell, CMC

Die Marke. als Marketinginstrument. RATIO Betriebsberatungsges.m.b.H. A - 1070 Wien, Hermanngasse 3. Mag. Michael Dell, CMC Die Marke RATIO Betriebsberatungsges.m.b.H. A - 1070 Wien, Hermanngasse 3 Mag. Michael Dell, CMC +43/1/523 06 21-0 FAX +43/1/523 06 21-17 dell@ratio.at als Marketinginstrument seit 1958 interdisziplinär

Mehr

Strategie und Technik der Markenführung

Strategie und Technik der Markenführung Strategie und Technik der Markenführung von Franz-Rudolf Esch 3., überarbeitete und erweiterte Auflage Strategie und Technik der Markenführung Esch schnell und portofrei erhältlich bei beck-shop.de DIE

Mehr

Strategie und Technik der Markenführung

Strategie und Technik der Markenführung Strategie und Technik der Markenführung von Prof. Dr. Franz-Rudolf Esch 1. Auflage Strategie und Technik der Markenführung Esch wird vertrieben von beck-shop.de Thematische Gliederung: Marketing, Handelsmanagement

Mehr

Mein Studienplan an der Steinbeis-SMI für den Executive MBA Klasse 2015 Berlin

Mein Studienplan an der Steinbeis-SMI für den Executive MBA Klasse 2015 Berlin Mein Studienplan an der Steinbeis-SMI für den Executive MBA Klasse 2015 Berlin Wann? Was? Tage? LNW Wo? 25.11.2015 Eröffnungsveranstaltung (ab 10 Uhr) 0,5 Berlin 26.-27.11.15 Neue Managementperspektiven

Mehr

Insights aus dem FMCG und OTC Marketing

Insights aus dem FMCG und OTC Marketing Steel with Pride! Insights aus dem FMCG und OTC Marketing Mag. Christiane Janauschek Stadler (FastForward MarketingWerkstatt) Mag. Susanne Eibegger (Bayer Consumer Care) Zeitalter des Überangebots! Starke

Mehr

3. Fritz, W.: Determinanten der Produktinnovation, in: Die Unternehmung 40, 1986, Nr. 2, S. 134-147.

3. Fritz, W.: Determinanten der Produktinnovation, in: Die Unternehmung 40, 1986, Nr. 2, S. 134-147. Abhandlungen in Fachzeitschriften 1. Fritz, W.: Der vergleichende Warentest als Herausforderung für das strategische Marketing, in: Schmalenbachs Zeitschrift für betriebswirtschaftliche Forschung 37, 1985,

Mehr

Andrea Honal (Hrsg.) Aktuelle Marketing- und. Das Beste aus Theorie und Praxis

Andrea Honal (Hrsg.) Aktuelle Marketing- und. Das Beste aus Theorie und Praxis (Hrsg.) Aktuelle Marketing- und Management-Trends Das Beste aus Theorie und Praxis Verlag Dr. Kovac Hamburg 2014 Inhaltsverzeichnis Erstes Kapitel: Aktuelle Entwicklungen und Trends im Marketing Markenallianzen

Mehr

Lehrstuhl für Allgemeine BWL Strategisches und Internationales Management Prof. Dr. Mike Geppert Carl-Zeiß-Str. 3 07743 Jena

Lehrstuhl für Allgemeine BWL Strategisches und Internationales Management Prof. Dr. Mike Geppert Carl-Zeiß-Str. 3 07743 Jena Lehrstuhl für Allgemeine BWL Strategisches und Internationales Management Prof. Dr. Mike Geppert Carl-Zeiß-Str. 3 07743 Jena http://www.im.uni-jena.de Contents I. Learning Objectives II. III. IV. Recap

Mehr

Management von Markenerweiterungen und Markenallianzen. Portfolio-Werbung als Technik des Impression Management

Management von Markenerweiterungen und Markenallianzen. Portfolio-Werbung als Technik des Impression Management Monographien Management von Markenerweiterungen und Markenallianzen Honal, A. (2010): Management von Markenerweiterungen und Markenallianzen: Eine verhaltenswissenschaftlich-empirische Vergleichsstudienreihe

Mehr

Marketing. Vertiefungsmodul in Volkswirtschaft

Marketing. Vertiefungsmodul in Volkswirtschaft Modulbeschreibung VI.1.1. Modulbezeichnung Branding Beitrag des Moduls zu den Studienzielen Die Marke (englisch Brand) ist für viele Unternehmen der wichtigste Wertschöpfer. Dies gilt insbesondere bei

Mehr

Handbuch Produktmanagement

Handbuch Produktmanagement Sonke Albers I Andreas Herrmann (Hrsg.) Handbuch Produktmanagement Strategieentwicklung - Produktplanung Organisation - Kontrolle 3., uberarbeitete und erweiterte Auflage GABLER Inhaltsverzeichnis Vorwort

Mehr

Vorwort...V Abkürzungsverzeichnis...XV. 1.1 Multi Channel Handel Verkaufsform der Zukunft... 1. 1.2 Ungenutzte Potenziale im Multi Channel Handel...

Vorwort...V Abkürzungsverzeichnis...XV. 1.1 Multi Channel Handel Verkaufsform der Zukunft... 1. 1.2 Ungenutzte Potenziale im Multi Channel Handel... Inhaltsverzeichnis Vorwort...V Abkürzungsverzeichnis...XV 1 Schlüsselthema Cross Channel Management... 1 1.1 Multi Channel Handel Verkaufsform der Zukunft... 1 1.2 Ungenutzte Potenziale im Multi Channel

Mehr

Inhaltsverzeichnis. Erster Teil Begriff und Anliegen des Produktmanagement. Zweiter Teil Strategische Aspekte des Produktmanagement

Inhaltsverzeichnis. Erster Teil Begriff und Anliegen des Produktmanagement. Zweiter Teil Strategische Aspekte des Produktmanagement Inhaltsverzeichnis Vorwort Autorenverzeichnis V XV Erster Teil Begriff und Anliegen des Produktmanagement Sänke Albers und Andreas Herr mann Ziele, Aufgaben und Grundkonzept des Produktmanagement 1 Zweiter

Mehr

Markenmanagement. Grundfragen der identitätsorientierten Markenführung. Mit Best Practice - Fallstudien

Markenmanagement. Grundfragen der identitätsorientierten Markenführung. Mit Best Practice - Fallstudien Markenmanagement Grundfragen der identitätsorientierten Markenführung. Mit Best Practice - Fallstudien von Heribert Meffert, Christoph Burmann, Martin Koers 2002 Springer Gabler Wiesbaden 2002 Verlag C.H.

Mehr

PROF. DR. RUTH STOCK-HOMBURG WINTERSEMESTER 2015 / 2016

PROF. DR. RUTH STOCK-HOMBURG WINTERSEMESTER 2015 / 2016 PROF. DR. RUTH STOCK-HOMBURG WINTERSEMESTER 2015 / 2016 KUNDENBEZIEHUNGSMANAGEMENT IST interdisziplinär. [ TEIL 1: THEORETISCHE GRUNDLAGEN DES KBM ] Wie hat sich das Kundenbeziehungsmanagement entwickelt?

Mehr

BWL-Spezialisierung: International Management

BWL-Spezialisierung: International Management BWL-Spezialisierung: International Management Professuren: Swoboda und Haunschild Kurzcharakterisierung und Einordnung: Die BWL-Spezialisierung International Management ist ein Spezialisierungsmöglichkeit

Mehr

Marketing und Werbung im Produktmanagement Ein 2,5 tägiges praxisorientiertes Grundlagenseminar

Marketing und Werbung im Produktmanagement Ein 2,5 tägiges praxisorientiertes Grundlagenseminar Marketing und Werbung im Produktmanagement Ein 2,5 tägiges praxisorientiertes Grundlagenseminar für gesteigerte Marketing-Performance und bessere Markenführung in Pharma-, Chemie-, und Technologiebranche

Mehr

Handbuch Produktmanagement

Handbuch Produktmanagement Sönke Albers I Andreas Herrmann (Hrsg.) 2008 AGI-Information Management Consultants May be used for personal purporses only or by libraries associated to dandelon.com network. Handbuch Produktmanagement

Mehr

Call for Papers. DERMARKENTAG2011 29. 30. September 2011 Berlin, Deutschland

Call for Papers. DERMARKENTAG2011 29. 30. September 2011 Berlin, Deutschland Call for Papers DERMARKENTAG2011 29. 30. September 2011 Berlin, Deutschland DERMARKENTAG2011 will den aktuellen Stand und neue Projekte der deutschsprachigen und internationalen Markenwissenschaft präsentieren

Mehr

Inhaltsverzeichnis. 1 Einleitung...15 1.1 Vom Qualitätswettbewerb zum Imagewettbewerb...15 1.2 Zielsetzung und Aufbau der Arbeit...

Inhaltsverzeichnis. 1 Einleitung...15 1.1 Vom Qualitätswettbewerb zum Imagewettbewerb...15 1.2 Zielsetzung und Aufbau der Arbeit... INHALTSVERZEICHNIS 5 Inhaltsverzeichnis 1 Einleitung...15 1.1 Vom Qualitätswettbewerb zum Imagewettbewerb...15 1.2 Zielsetzung und Aufbau der Arbeit...17 2 Die Grundlagen des Images...19 2.1 Etymologie

Mehr

Prof. Dr. Sven Henkel. Publications

Prof. Dr. Sven Henkel. Publications Prof. Dr. Sven Henkel Chair of Customer Behaviour and Sales EBS Universität für Wirtschaft & Recht EBS Business School Department of Marketing Gustav-Stresemann-Ring 3 D-65189 Wiesbaden Phone +49 611 7102

Mehr

Strategie und Technik der Markenführung

Strategie und Technik der Markenführung Strategie und Technik der Markenführung von Prof. Dr. Franz-Rudolf Esch 6., vollständig überarbeitete und erweiterte Auflage Strategie und Technik der Markenführung Esch wird vertrieben von beck-shop.de

Mehr

Strategie und Technik der Markenführung

Strategie und Technik der Markenführung Franz-Rudolf Esch Strategie und Technik der Markenführung 3 V überarbeitete und erweiterte Auflage Verlag Franz Vahlen München Inhaltsverzeichnis Vorwort zur 3. Auflage Vorwort zur 1. Auflage Abbildungsverzeichnis

Mehr

Potenzielle Kunden: Wer könnte Interesse an meiner Leistung haben? Ich konzentriere mich auf:

Potenzielle Kunden: Wer könnte Interesse an meiner Leistung haben? Ich konzentriere mich auf: Arbeitsblatt 6: Die Marktdefinition i Potenzielle Kunden: Wer könnte Interesse an meiner Leistung haben? Ich konzentriere mich auf: Bedürfnis: Was könnte mein Produkt leisten? Welche Bedürfnisse könnte

Mehr

Green Apple CSR als Marke etablieren

Green Apple CSR als Marke etablieren apple Green Apple CSR als Marke etablieren Prof. Dr. Carsten Baumgarth Prof. Dr. Carsten Baumgarth (cb@cbaumgarth.net) 1 Prof. Dr. Carsten Baumgarth 1988 1993: BWL-Studium an der Universität Siegen 1994

Mehr

Themenvorschläge für Abschlussarbeiten (Bachelor- oder Masterarbeiten) an der Juniorprofessur für Controlling

Themenvorschläge für Abschlussarbeiten (Bachelor- oder Masterarbeiten) an der Juniorprofessur für Controlling UHH Fakultät für Wirtschafts- und Sozialwissenschaften von-melle-park 9 20146 Hamburg An die Studierenden im Fachbereich Sozialökonomie 04.11.2015 Prof. Dr. Lucia Bellora-Bienengräber Fakultät für Wirtschafts-

Mehr

Forschungsprojekt Marketing- und Vertriebsberufsfelder. Zusammenfassung. Prof. Dr. Julia Naskrent (Stand: 20.06.2013)

Forschungsprojekt Marketing- und Vertriebsberufsfelder. Zusammenfassung. Prof. Dr. Julia Naskrent (Stand: 20.06.2013) Forschungsprojekt Marketing- und Vertriebsberufsfelder Zusammenfassung Julia (Stand: 20.06.2013) Branchen im Vergleich: TOP 5 der geforderten Fachkompetenzen 50 45 40 35 30 25 20 15 10 5 0 Fachkompetenz:

Mehr

Unternehmensführung. - Wintersemester 2008/2009 - Vorlesungsprogramm

Unternehmensführung. - Wintersemester 2008/2009 - Vorlesungsprogramm Prof. Dr. Harald Hungenberg Lehrstuhl für Unternehmensführung Fachbereich Wirtschaftswissenschaften Lange Gasse 20 90403 Nürnberg Unternehmensführung - Wintersemester 2008/2009 - Vorlesungsprogramm Grundgedanke

Mehr

Handbuch Kundenbindungsmanagement

Handbuch Kundenbindungsmanagement Manfred Bruhn/Christian Homburg (Hrsg.) Handbuch Kundenbindungsmanagement Grundlagen - Konzepte - Erfahrungen 2., aktualisierte und erweiterte Auflage GABLER Inhaltsverzeichnis Vorwort zur zweiten und

Mehr

Thomas Decker STRATEGISCHE POSITIONIERUNG EINES INTERIM MANAGERS. Ressourcen - Wettbewerb - Variable Vergütung PL ACADEMIC RESEARCH

Thomas Decker STRATEGISCHE POSITIONIERUNG EINES INTERIM MANAGERS. Ressourcen - Wettbewerb - Variable Vergütung PL ACADEMIC RESEARCH Thomas Decker STRATEGISCHE POSITIONIERUNG EINES INTERIM MANAGERS Ressourcen - Wettbewerb - Variable Vergütung PL ACADEMIC RESEARCH Inhaltsverzeichnis Abbildungsverzeichnis Abkürzungsverzeichnis Einführung

Mehr

DIE MISSION DER MARKE

DIE MISSION DER MARKE BRAND DEVELOPMENT Sinn und Seele für den entscheidenden Unterschied. EILER2 berät und unterstützt Marketing- und Vertriebsverantwortliche bei der Neuentwicklung, Weiterentwicklung und Optimierung ihrer

Mehr

Gegenstand des Marketing-Studiums ist eine Synthese theoretischer Erkenntnisse des Marketing und den Marketing-Aufgaben der Praxis.

Gegenstand des Marketing-Studiums ist eine Synthese theoretischer Erkenntnisse des Marketing und den Marketing-Aufgaben der Praxis. Marketing Gegenstand des Marketing-Studiums ist eine Synthese theoretischer Erkenntnisse des Marketing und den Marketing-Aufgaben der Praxis. Marketing wird verstanden als die bewußt marktorientierte Führung

Mehr

Berufsbegleitendes Studium zur Externenprüfung als Bachelor B.A.

Berufsbegleitendes Studium zur Externenprüfung als Bachelor B.A. Modulbezeichnung VI.9 Industrie- und Handelsmarketing Modulverantwortliche/r: Modulart: Wahlpflichtfach Prüfungsleistungen 5 12 Art: K 90 Lernziele Die Studierenden kennen die Ziele, Strategien und Instrumente

Mehr

Interne Markenführung

Interne Markenführung Interne Markenführung IDENTITÄTSBASIERTES BEHAVIORAL BRANDING IN LUXUSMARKENUNTERNEHMEN von DR. NADINE SCHUMACHER FÖRDERGESELLSCHAFT PRODUKT-MARKETING E.V. Inhaltsverzeichnis Seite ABBILDUNGSVERZEICHNIS

Mehr

Sommersemester 2011. TU Darmstadt FG Marketing & Personalmanagement Univ.-Prof. Dr. Ruth Stock-Homburg Sommersemester 2011 1

Sommersemester 2011. TU Darmstadt FG Marketing & Personalmanagement Univ.-Prof. Dr. Ruth Stock-Homburg Sommersemester 2011 1 Innovations- und Marketingmanagement im B2B-Marketing Konzept zur Vorlesung Sommersemester 2011 TU Darmstadt FG Marketing & Personalmanagement Univ.-Prof. Dr. Ruth Stock-Homburg Sommersemester 2011 1 Lernziele

Mehr

Die Auswirkung von Kollaborationsvielfalt auf den Erfolg von radikal neuen Produkten entlang des Produktentwicklungsprozesses

Die Auswirkung von Kollaborationsvielfalt auf den Erfolg von radikal neuen Produkten entlang des Produktentwicklungsprozesses Institut für Marktorientierte Unternehmensführung Kompetenz in Wissenschaft & Management Prof. Dr. Dr. h.c. mult. Christian Homburg, Prof. Dr. Sabine Kuester IMU Research Insights # 028 Die Auswirkung

Mehr

Steuerung der Unternehmensleistung

Steuerung der Unternehmensleistung Allgemeine Betriebswirtschaftslehre und Innovation - Band 6 ABWL & Innovation Prof. Dr. Dr. h.c. Ulrich Wehrlin (Hrsg.) Steuerung der Unternehmensleistung Unternehmensziele entwickeln, messen und steuern

Mehr

B-to-B-Markenführung

B-to-B-Markenführung B-to-B-Markenführung Status-Quo und neue Konzepte Priv.-Doz. Dr. Carsten Baumgarth UNIVERSITÄT SIEGEN Baumgarth & Baumgarth Brandconsulting 1 Nobody ever got fired for buying an IBM $67.50 The World s

Mehr

Markenaufbau Die Schritte zum Erfolg

Markenaufbau Die Schritte zum Erfolg TWIST DESIGN KOMMUNIKATION Die Schritte zum Erfolg Markenaufbau Unternehmens- und Markenstrategie In der Regel wird die Markenstrategie aus der Unternehmensstrategie abgeleitet. Oft geschieht es aber ebenso,

Mehr

VERÖFFENTLICHUNGEN DES INSTITUTS

VERÖFFENTLICHUNGEN DES INSTITUTS VERÖFFENTLICHUNGEN DES INSTITUTS Stand: 30.01.2012 Alexander Deichsel Siehe separates Werkverzeichnis Manfred Schmidt 1. Herausforderungen bei der Mobilisierung und Sanierung von Marken, in: Alexander

Mehr

Strategie und Technik der Markenführung

Strategie und Technik der Markenführung Strategie und Technik der Markenführung von Franz-Rudolf Esch 6., vollständig überarbeitete und erweiterte Auflage Strategie und Technik der Markenführung Esch schnell und portofrei erhältlich bei beck-shop.de

Mehr

Institut für Handel & Marketing (H&M)

Institut für Handel & Marketing (H&M) Institut für Handel & Marketing (H&M) Literatureingangsprüfung: Erste Leistungsüberprüfung SBWL Handel & Marketing (H&M), SS 2015; 24.02.2015, 10:00 Uhr bis 12:00 Uhr (Arbeitszeit: 1 Stunde) 1. Bitte eintragen:

Mehr

Unternehmensstrategie und Marke. Parallelen zwischen erfolgreichen Unternehmensstrategien und erfolgreichem Markenaufbau

Unternehmensstrategie und Marke. Parallelen zwischen erfolgreichen Unternehmensstrategien und erfolgreichem Markenaufbau Achim Burkhardt Unternehmensstrategie und Marke. Parallelen zwischen erfolgreichen Unternehmensstrategien und erfolgreichem Markenaufbau Ausgangslage und Problemstellung... 1 Kennzeichen erfolgreicher

Mehr

CrowdDialog 2014. Zusammenarbeit 2.0 24.06.2014. CrowdSourcing! Status Quo - Chancen und Risiken! einer modernen Arbeitgeber-Arbeitnehmer Beziehung

CrowdDialog 2014. Zusammenarbeit 2.0 24.06.2014. CrowdSourcing! Status Quo - Chancen und Risiken! einer modernen Arbeitgeber-Arbeitnehmer Beziehung CrowdSourcing Status Quo - Chancen und Risiken einer modernen Arbeitgeber-Arbeitnehmer Beziehung Zusammenarbeit 2.0 24.06.2014 CrowdDialog 2014 Crowd - Evolution Open - Closed und Crowd - Innovationsprozesse

Mehr

Teil 1: Herausforderungen nachhaltiger Markenführung und Markenimplementierung 1

Teil 1: Herausforderungen nachhaltiger Markenführung und Markenimplementierung 1 Teil 1: Herausforderungen nachhaltiger Markenführung und Markenimplementierung 1 Markenführung als Erfolgsfaktor für einzigartige und konsistente Geschäftsmodelle 3 RALF SAUTER und TIM WOLF (Horváth &

Mehr

HANDBUCH WIRTSCHAFTS- PRÜFUNG UND STEUER- BERATUNG 2015

HANDBUCH WIRTSCHAFTS- PRÜFUNG UND STEUER- BERATUNG 2015 Jörg Hossenfelder Thomas Lünendonk (Hrsg.) HANDBUCH WIRTSCHAFTS- PRÜFUNG UND STEUER- BERATUNG 2015 60 FÜHRENDE PARTNER FÜR IHR UNTERNEHMEN Haufe Gruppe Freiburg München Prof. Dr. Matthias H. J. Gouthier

Mehr

Aaker, D.A. (1992), Management des Markenwertes, Frankfurt.

Aaker, D.A. (1992), Management des Markenwertes, Frankfurt. Literaturverzeichnis Aaker, D.A. (1996), Building Strong Brands, New York. Aaker, D.A. (1991), Managing Brand Equity: Capitalizing on the Value of a Brand Name, New York. Literaturverzeichnis Aaker, D.A.

Mehr

Employer Branding als strategisches Instrument fu r KMU

Employer Branding als strategisches Instrument fu r KMU Employer Branding als strategisches Instrument fu r KMU 1. Wirtschaftswissenschaftliches Forum Essen Wirtschaftliche Implikationen des demographischen Wandels Herausforderungen und Lösungsansätze 29. September

Mehr

The world has changed: always on Marken erfordern neue, innovative Wege des Denken und Handeln um Konsumenten zu aktivieren und zu betreuen.

The world has changed: always on Marken erfordern neue, innovative Wege des Denken und Handeln um Konsumenten zu aktivieren und zu betreuen. welcome.success TO EMPORER YOUR BRAND AND SERVICE VALUES Über uns WE BUILD GREAT VALUES Als "full service marketing and brand communication"- Unternehmen verfügen wir über einen breiten Kompetenzpool,

Mehr

Call for Papers. DERMARKENTAG2014 25. 26. September 2014 Koblenz, Deutschland

Call for Papers. DERMARKENTAG2014 25. 26. September 2014 Koblenz, Deutschland Call for Papers DERMARKENTAG2014 25. 26. September 2014 Koblenz, Deutschland DERMARKENTAG2014 will den aktuellen Stand und neue Projekte der deutschsprachigen und internationalen Markenwissenschaft präsentieren

Mehr

Fact Sheet und Positionsprofil

Fact Sheet und Positionsprofil Erfolgreiches Traditionsunternehmen mit einem diversifizierten Portfolio an Gesellschaften und Ventures 28.11.2012 Inhalt Das Unternehmen Die Funktion Ihr Profil Ihre Chancen Interesse Kontakt Dieses Profil

Mehr

Markt- und Wettbewerbsanalyse im deutschen Uhrenmarkt. MP II Prof. Dr. Jan-Philipp Büchler, CASEM in Kooperation mit TEMPOREX Uhren GmbH

Markt- und Wettbewerbsanalyse im deutschen Uhrenmarkt. MP II Prof. Dr. Jan-Philipp Büchler, CASEM in Kooperation mit TEMPOREX Uhren GmbH Markt- und Wettbewerbsanalyse im deutschen Uhrenmarkt MP II Prof. Dr. Jan-Philipp Büchler, CASEM in Kooperation mit TEMPOREX Uhren GmbH Temporex Uhren GmbH Unternehmensporträt Mittelständisches Unternehmen

Mehr

Das Risikomanagement gewinnt verstärkt an Bedeutung

Das Risikomanagement gewinnt verstärkt an Bedeutung Das Risikomanagement gewinnt verstärkt an Bedeutung 3/9/2009 Durch die internationale, wirtschaftliche Verpflechtung gewinnt das Risikomanagement verstärkt an Bedeutung 2 3/9/2009 Das IBM-Cognos RiskCockpit:

Mehr

Business IT Alignment

Business IT Alignment Hochschule für angewandte Wissenschaften Würzburg-Schweinfurt Fakultät Informatik und Wirtschaftsinformatik Prof. Dr. Kristin Weber Business IT Alignment Dr. Christian Mayerl Senior Management Consultant,

Mehr

Verzeichnis der Veröffentlichungen Univ.-Prof. Dr. Ruth Stock-Homburg - Stand November 2005 -

Verzeichnis der Veröffentlichungen Univ.-Prof. Dr. Ruth Stock-Homburg - Stand November 2005 - Verzeichnis der Veröffentlichungen Univ.-Prof. Dr. Ruth Stock-Homburg - Stand November 2005 - I. Veröffentlichungen in referierten Zeitschriften 2005: Stock, Ruth (2005), Interorganizational Teams as Boundary

Mehr

Semester: -- Workload: 300 h ECTS Punkte: 10

Semester: -- Workload: 300 h ECTS Punkte: 10 Modulbezeichnung: Modulnummer: DLMWSAM Sales Management Semester: -- Dauer: Minimaldauer 1 Semester Modultyp: Wahlpflicht Regulär angeboten im: WS, SS Workload: 300 h ECTS Punkte: 10 Zugangsvoraussetzungen:

Mehr

Qualitätsmanagement für Dienstleistungen

Qualitätsmanagement für Dienstleistungen Qualitätsmanagement für Dienstleistungen Grundlagen, Konzepte, Methoden von Manfred Bruhn erweitert, überarbeitet Qualitätsmanagement für Dienstleistungen Bruhn schnell und portofrei erhältlich bei beck-shop.de

Mehr

Market ing 2.0 >> St rat egien der digit alen Markenführung und Kom m unikat ion

Market ing 2.0 >> St rat egien der digit alen Markenführung und Kom m unikat ion Market ing 2.0 >> St rat egien der digit alen Markenführung und Kom m unikat ion >> Marketing 2.0 - Strategien der digitalen Markenführung und Kommunikation 1 Digit al 1) Unternehmen 3) Kommunikation und

Mehr

Inhaltsübersicht. Teil A: Grundkonzepte des Kundenbeziehungs-Managements

Inhaltsübersicht. Teil A: Grundkonzepte des Kundenbeziehungs-Managements Inhaltsübersicht Geleitwort Reinhold Rapp 11 Voice of the Customer 13 Kundenbeziehungs-Management zwischen Kundenorientierung und Wirtschaftlichkeit - Einführung in das Handbuch Eckhard Reimann, Hagen

Mehr

Inhalt. Vorwort. 1. Teil I Theoretische Ansätze und Modelle

Inhalt. Vorwort. 1. Teil I Theoretische Ansätze und Modelle Inhalt Vorwort. 1 Teil I Theoretische Ansätze und Modelle Kapitel 1 Einführung und Begriffsklärung. 1. Begriff der Unternehmenskommunikation. 10 2. Public Relations als Kommunikationsmanagement von Unternehmen.

Mehr