UberModulnundCodes. UlrichEidt

Größe: px
Ab Seite anzeigen:

Download "UberModulnundCodes. UlrichEidt"

Transkript

1 UberModulnundCodes UlrichEidt Bayreuth,den14.August1992 VorgelegtalsDiplomarbeitbei LehrstuhlIIfurMathematik deruniversitatbayreuth Prof.Dr.A.Kerber

2 1DarstellungstheoretischeGrundlagen Vorwort Inhaltsverzeichnis 2CodierungstheoretischeAnwendungen 1.2JamesGewichtsraume::::::::::::::::::::::::::::10 1.3AllgorithmenzuJamesGewichtsraumen:::::::::::::::::: TabloidevomInhalt::::::::::::::::::::::::::: EndlicheKorper 2.2JamesGewichtsraumealsCodes:::::::::::::::::::::::27 2.1EinfuhrunginalgebraischeCodierungstheorie::::::::::::::: MDS-Codes::::::::::::::::::::::::::::: Majoritatslogik-decodierbareCodes::::::::::::::::: BinareReed-MullerCodes::::::::::::::::::::::34 ATabellenmitJames-GewichtsraumenD#;; 3.1TheoretischeGrundlagenfurendlicheKorperinNormalbasenreprasentation40 3.2DieImplementierungfurSYMMETRICA:::::::::::::::::: Quellcode::::::::::::::::::::::::::::::: DokumentationderbereitgestelltenFunktionen::::::::::48 A.1undPartitionenvon5::::::::::::::::::::::::::78 A.2undPartitionenvon6::::::::::::::::::::::::::79 A.3undPartitionenvon7::::::::::::::::::::::::::80 A.4undPartitionenvon8::::::::::::::::::::::::::81 A.5undPartitionenvon9::::::::::::::::::::::::::83 Literaturverzeichnis Urhebervermerk

3 Vorwort James[2]fuhrtedenK?r-ModulM;!ein(!=(1r);`r)undbestimmtedieBasen derdarinenthaltenenvektorraumed#;;!((#;)einpaarvonpartitionenfurr). DannfolgteineErweiterungseinesBasissatzesaufdieVektorraumeD#;;M;. DieseRaumewurdenaufihreEigenschaftenalsCodesnaheruntersucht.Dabeisind ImerstenKapitelverallgemeinernwirzunachstJames'Denitionvon-Tabloidenauf- TabloidevomInhalt,wobeieineuneigentlichePartitionvonrinhochstensrTeileist. CodesmitgutenEigenschaftengefundenworden,dieimzweitenKapitel,nacheiner CodierungstheoretischenEinfuhrung,naherbeschriebenwerden. ZumUberblickvonJames-GewichtsraumenalsCodessindimAnhangdieserArbeiteinigeTabellennomegezeigtunddieImplementierungendlicherKorperfurdasAlgebrasystemSYMhandelt,dieScheerhorn[6]eingefurthat.EswirddieExistenztrace-kompatiblerPoly- METRICAvorgestellt. AndieserStellemochteichHerrnDr.Karl-HeinzZimmermannvomLehrstuhlfurInformatikdanken,dermirmitRatundTatzurSeitestand,undmitdemesvielSpa dankeherrnprof.dr.adalbertkerberfurdieunterstutzungundforderungderar- gemachthat,imdschungelderjames-gewichtsraumenachgutencodeszusuchen.ich ImdrittenKapitelwerdentrace-kompatibleKorpererweiterungenendlicherKorperbe- Bayreuth,den14.August1992 METRICAnichtmoglichgewesenware. undherrndr.axelkohnert,ohnediedieimplementierungendlicherkorperfursym- beit. AuerdemdankeichHerrnAlfredScheerhornvomIBMScienticCenterinHeidelberg UlrichEidt 2

4 Kapitel1 Darstellungstheoretische Grundlagen SeialsoreinepositiveganzeZahl,einePartitionvonrundeineuneigentliche PartitionvonrinhochstensrTeilefurdenRestdesKapitels. WirzeigenindiesemUnterkapiteldie1:1Beziehungzwischenden-Tabloidenvom 1.1-TabloidevomInhalt 1.1.1Denitionen: Inhaltundden?-Orbitsvon-Sequenzen.DieseBeziehungnutzenwirdannfur einenalgorithmuszurkonstruktioneinertransversaleder-tabloidevominhalt. b)sei=(1;:::;n)j=ninhochstensnteile.i=(i1;:::;ir)heit-sequenz a)furn2inbezeichnetnrdiemengeallerfunktionenvonr=f1;:::;rgnach (i(1);:::;i(r))furallei2nr. aller-sequenzenwirdmitseq()bezeichnet. genaudann,wennjedesj2ngenauj-malinialsbildvorkommt.diemenge beschrieben.die?roperiertvonrechtsaufnrvermogeplatzpermutationi= n=f1;:::;ng.einefunktionwirddurcheinefolgei=(i1;:::;ir)vonbilder 1.1.2Vereinbarung:Diemonotonsteigende-Sequenzwirdbezeichnetmit Seiz.B.=(2;2;0;1)j=5dannisti=(1;4;2;2;1)2Seq()undm=(1;1;2;2;4). m=(1 1;:::;1;2 z} { z} { 2;:::;2;:::;n n;:::;n): z} { deniert,wobeiadiezeileundbdiespalteangibt Denition:DasDiagramm[]vonwirddurcheineMengevonPaaren []:=f(a;b)2ininj1a^1big 3

5 KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN ineinergedachtenmatrixanderstelle(a;b)einkreuzmacht Vereinbarung:Diagrammewerdenveranschaulicht,indemmanfur(a;b)2[] Denition:Ein-TableauisteineAbbildungvomDiagramm[]ineinenichtleereMenge. Z.B.=(3;2;2;1)dannist[]= 1.1.6Vereinbarung:EinsolchesTableaustellenwirdar,indemwirimDiagramm []stattderkreuzedasderabbildungentsprechendemengenelementeintragen. Wirxierendasbijektive-TableauT:[]!r, T:=1 1+1:::1+2 :::::: 1 ein-tableauundwirdmittibezeichnet. Furjedesi2nristauchiTwegen[]T :::::: 1.1.7Bemerkung:DieAbbildungvon?r[]![]?!ri isteineoperation. (;(a;b))7!t?1t(a;b)=:(a;b):?!n Beweis: b)seien;2?r.dannist a)1(a;b)=t?11t(a;b)=(a;b) 1.1.8Denition: ((a;b))=(t?1t(a;b))=t?1tt?1t(a;b)= Mengeder-Tableaux.Furjedes-TableautundjedePermutationdenierenwirt wiefolgt: Dadie?raufdemUrbildraumvon-Tableauxoperiert,operiertsieauchaufder =T?1T(a;b)=(a;b) t((a;b)):=t(?1(a;b)): 2

6 KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN 1.1.9Beispiel:Sei=(3;3;1),d.h. T=123 5 t((1;1))=t(?1(1;1))=t(t?1?1t(1;1))=t(t?1?11)=t(t?17)=t((3;1))=4; und=(157)2?7.dannist ;auerdemseit=135 ebensot((2;2))=1undt((3;1))=6: AlleanderenBildervontwerdendurchnichtbeeinut.Wirhabenalso Bemerkung:Die?roperiertalsoaufderMengeder-Tableauxdurch Platzpermutation,wobeidiePlatzevon[]wieinTnumeriertsind. t= Denitionen: : a)esseij=rinhochstensrteile.mit?rmfurbeliebigesmrwerdedieuntergruppeder?rbezeichnet,diealleelementeausrnmunverandertlat.auerdem DiekanonischeYounguntergruppezuwirddannmit i:=f1+i?1?:=?r1?r2:::?rr Xj=1j;:::;iXj=1jg: seiirfurallei2rdiemengederelementeausdemi-ten-block, b)derzeilenstabilisatorrtistdiezugehorigekanonischeyounguntergruppe deniert. c)ein-tabloidftgistdieaquivalenzklassevom-tableautunterderaquivalenzrelationct:=?rf1;1+1;1+2+1;:::g?rf2;1+2;:::g?f3;1+3;:::g:::: der?r. DerSpaltenstabilisatorwirddeniertmit t1t2:()esexistiertein2rt:t1=t2:

7 1.1.12Vereinbarung:ftgwirddargestellt,indembeitLinienzwischendieZeilen KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN 6 undzusatzlicheineliniedaruberundeinedaruntergezogenwerden. diemonotonesequenzmsinddieelementeausdemi-ten-blockiallegleichi.? istdemnachgenaudieuntergruppeder?r,diemunverandertlat Bemerkung:SeieineuneigentlichePartitionvonrinhochstensrTeile.Fur Z.B.fTg=1 1+1:::1+2 :::::: 1: DieMengeder-TabloidevomInhaltwirdmitTab(;)bezeichnet. Dannist[]= Beispiel:Sei=(3;2);=(2;2;1) Denition:ftgheit-TabloidvomInhalt,genaudann,wennjedes j2rgenauj-malalsbildintvorkommt..ein-tableaut:[]!5istz.b.124 RT=?5f1;2;3g?5f4;5g 35: somitistdas-tabloidftg d.h.diereihenfolgeindenzeilenspieltfurftgkeinerolle. Dieverschiedenen-TabloidevomInhaltsind ;113 35=214 22;122 53=142 13;123 35=412 12und223 53=usw., Entscheidendisthier,dadieBilder1,1und2indererstenZeileund2und3inder inwelcherzeilesind. DiewesentlichenInformationender-Tabloideliegendarin,welcheBildervonftg Wirbetrachtenz.B : 11: jedemtabloideinetupelmengezuordnen.wichtigisthierbei,daeinetupelmenge genaudanneinem-tabloidentspricht,wenneinefolge,bestehendausdenersten dadasbildbinderzeilealiegt.mankannalsojedertupelmengeeintabloidund zweitenzeilestehen.diemengevontupelnf(1;1);(1;2);(1;2);(2;2);(2;3)genthalt demnachallenotigeninformationenvonobigemtabloid,wobeieintupel(a;b)angibt, KoordinatenderTupelmenge,eine-Sequenzist.Daruberhinausentsprichtsieeinem

8 KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN -TabloidvomInhalt,wennzusatzlicheineFolgederzweitenKoordinateneine- Sequenzist.EsentsprichtzumBeispielf(2;3);(1;5);(2;5);(3;1);(1;4);(1;2)gwegen (2;1;2;3;1;1)2Seq(3;2;1)und(3;5;5;1;4;2)2Seq(1;1;1;1;2)einem(3;2;1)-Tabloid Denitionen: vominhalt(1;1;1;1;2),namlich a)seikeinkorperundneinepositiveganzezahl. RK(n)=K[fcs;tjs;t2ng]bezeichnetdie(kommutative)AlgebraallerPolynome 542 uberkindenn2unbekanntencs;t,s;t2n.furr2inmitrnseirk(n;r) 35 1 : b)seii2seq()undj2seq(). vomgradraufgespanntwird. derunterraumvonrk(n),dervondenmonomen inzweiternormalform(2.nf). EinMonomderFormcm;jbzw.ci;mheitinersterNormalform(1.NF)bzw. ci;j:=ci1;j1:::cir;jr;i=(i1;:::;ir);j=(j1;:::;jr)2rr; Vereinbarung:HabenwireinMonomin2.NF,sowirdesveranschaulichtmit Korollar:Furallei;k2Seq();j;l2Seq()gilt: ji1:::i1ji1+1:::i1+2j:::j:=ci;m: Beweis: b)ci?1;j=ci;jfurallei2?r: a)ci;j=ck;l()92?r:i=k^j=l: b)folgtunmittelbarausa). a)folgtausderdenitionundderkommutativitatvonrk(n). c)jedesmonomci;jkannin1.nfbzw.in2.nfgebrachtwerden. c)esexistieren;2?r,sodai=mundj=m,d.h.iundjentstehenaus denmonotonensequenzendurchentsprechende(sortierende)platzpermutationen. Mitg=j?1kannmanci;jin1.NFci;j=cm;j=cm;g(sieheb))bringen. Analogbringtmanmith=i?1ci;jin2.NFci;j=ch;m.

9 1.1.19Bemerkung:ci;j2RK(n;r)entsprichtderMengef(i1;j1);:::;(ir;jr)g,d.h. KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN 2 8 einem-tabloidvominhaltgenaudann,wenni2seq()undj2seq().esgibt genaudenbildernder2.reiheusw. somiteinebijektionvondermengedermonomeci;j(i2;j2)aufdiemengeder Beispiel:=(3;2),=(1;1;1;2) Bilderj1;:::;j1genaudenBildernder1.ReihedesTabloids,dieBilderj1+1;:::;j1+2 -TabloidevomInhalt. j2seq(),in1.nfvorliegenhaben.esentsprechendannnamlichinderfolgejdie DieseBijektionistalssolchebesondersgutzuerkennen,wennwirdieMonomecm;j, tlegttfestundumgekehrt.andertmanbeitdiereihenfolgevon(4;2;3;1;4)innerhalb der-blocke,somutnachobigerbemerkungimmernochtentsprechen. t:=423 t=c(1;1;1;2;2);(3;4;2;4;1)=c1;3c1;4c1;2c2;4c2;1 c1;4c1;2c1;3c2;1c2;4=c(1;1;1;2;2);(4;2;3;1;4)=:t 14!f(1;4);(1;2);(1;3);(2;1);(2;4)g!! f(1;3);(1;4);(1;2);(2;4);(2;1)g!342 entwedernachdererstenodernachderzweitensequenz,waswegenderkommutativitat 2.NF: UmvoneinerNormalformindieanderezugelangen,sortiertmaneinfachdasMonom In2.NFspieltdieReihenfolgeinnerhalbder-BlockekeineRolle.ObigesMonomin j2j1j1j12j=c(2;1;1;1;2);(1;2;3;4;4)=c(2;1;1;2;1);(1;2;3;4;4)=j2j1j1j21j 41=t vonrk(n)moglichist. zukonstruieren.dafurermittelnwiralleverschiedenenmonomeci;jmiti2seq() $!c(1;1;1;2;2);(4;2;3;1;4)=c(2;1;1;1;2);(1;2;3;4;4)=j2j1j1j12jbzw: undj2seq(). WirwendenunsjetztderAufgabezu,eineTransversaleder-TabloidevomInhalt j2j1j1j21j=c(2;1;1;2;1);(1;2;3;4;4)=c(1;1;1;2;2);(2;3;4;1;4) $342 41! heit?-bahnvoni Denition:Seii2rr.DieMenge?(i):=fij2?g

10 KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN Korollar:ZweiMonomeci;mundck;min2.NFsindgenaudanngleich, wenndie-sequenzeni,kinderselben?-bahnliegen. 9 Beweis:MitKorollar1.1.18gilt: esfolgtmitbemerkung ci;m=ck;m,92?r:i=k^m=m; bringenlat.wirentnehmenalsojeder?-bahnvon-sequenzeneinenreprasentanten nachkorollar1.1.18aufmonomein2.nfbeschranken,dasichjedesmonomauf2.nf Bemerkung:ZurKonstruktionallerverschiedenenMonomekonnenwiruns d.h.iundkliegeninderselben?-bahn. ci;m=ck;m,92?:i=k; undinterpretierendiesedannalsmonomein2.nf. 2

11 KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN ImfolgendenKapitelwirdderBasissatzfurJamesGewichtsraumebewiesen,dereine 1.2JamesGewichtsraume 10 hat.derbeweiszudieserverallgemeinerungfolgtindergrundideedembeweisvon VerallgemeinerungdesBasissatzesfurSpechtmodulnist,denJames[2]durchgefuhrt Zimmermann[9]. EsseifurdasganzeKapitelneinenaturlicheZahl,einePartitionvonn,eine genaunteileundkeinfestgewahlterkorper Denitionen: uneigentlichepartitionvonninhochstensnteile,!=(1n)diepartitionvonnin b)sein02in,mitn0n.sei#`n0.daspaar(#;)heitpaarvonpartitionenfurn,wenngilt: M;:=M a)esbezeichne denk-vektorraum,derdurchdie-tabloidevominhalterzeugtwird. #iifurallei1: ftg2tab(;)kftg d)seit:[]!nein-tableau.als#;-polytabloidzutwird c)sei(#;)einpaarvonpartitionenfurn.mitct(#)wirddieuntergruppedes SpaltenstabilisatorsCTbezeichnet,diedieElementeauerhalbdesDiagramms deniert. [#]unverandertlat. e#; t:=x 2CT(#)sgn()ftg 1.2.2Beispiel:Sei#=(2;2)und=(3;2;2). FurdenRestdiesesKapitelssei(#;)immereinPaarvonPartitionenfurn. Furt= iste#; t2m;(2;2;2;1);namlich ftg?f(14)tg?f(25)tg+f(14)(25)tg= ? ? :

12 BilderinderselbenSpalte,sogilt:e#; KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN 1.2.3Korollar:Stehenbeieinem-Tableaut:[]!ninnerhalbvon[#]zweigleiche t=0: 11 Beweis:Esseien(a;b);(a0;b)dieStellenint,andenendiegleichenBilderinderselben Spaltebstehen.Esseij=T(a;b);k=T(a0;b).EsexistierteineUntergruppeHvon Wirhaben CT(#),furdiegilt: 1.2.4Denition:WirdenierendieFunktionsub:n!nwiefolgt: dat=(jk)t. e#; t=x2hsgn()ftg?x2hsgn()f(jk)tg=0; CT(#)=H[H(jk): WirerweiterndieDenitionvonsubaufnnmit sub(s)=r:()r?1 Xk=1k<srXk=1kfuralles2n: Bemerkung:Isti2Seq(!)dannistsub(i)2Seq(). Beweis:Seis2f1;:::;1g.Danngilt0<s1,d.h.sub(s)=1.Desgleichenwird Analogwirdsubauchauf-Tableauxdeniert. sub(i)=(sub(i1);:::;sub(in))furallei=(i1;:::;in)2nn: 2-maldieZweienthaltusw.,d.h.sub(i)2Seq(). DieSequenzienthaltjedesBildausngenaueinmal,sodasub(i)1-maldieEins, einbilds2f1+1;:::;1+2gwegen1<s1+2aufdiezweiabgebildet,usw. 2 Miti=(1;6;4;3;2;5)2Seq(!)istsub(i)=(1;3;2;1;1;2)2Seq().Fur 1.2.6Beispiel: Sei=(3;2;1),dannist sub(1)=sub(2)=sub(3)=1;sub(4)=sub(5)=2undsub(6)=3: t= ;erhaltmansub(t)= :

13 KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN 1.2.7Denitionen: a)wirdenierendieabbildung ;:M;!!M;.Seiftg2Tab(;!),dannist 12 b) D#;;!:=X ;(ftg):=fsub(t)g: c) heit(#;;!)-jamesgewichtsraum. i2seq(!)e#; heit(#;;)-jamesgewichtsraum. D#;;:= ;(D#;;!) Ti 1.2.8Bemerkungen: b)d#;;!entsprichtdemvektorraums#;beijames[2].daruberhinausistd;;! a)dieabbildung ftgexistiertein-tableaut0mitftg=fsub(t0)g: gleichdemspechtmoduls. ;isteink-epimorphismus,dennzujedem-tabloidvominhalt c)esseit:[]!nein-tableau.dannist ;(e#; t)=e#; 1.2.9Beispiel: Diesentsprichtdem#;-Polytabloidzusub(t),dasub(t)=sub(t)fur alle2?n. ;(e#; t)=x 2CT(#)sgn() ;(ftg)=x sub(t);denn Sei=(3;3);=(3;2;1)und!=(16). 2CT(#)sgn()fsub(t)g: Mit#=(2;2)ist Furftg= M;!ist ;(ftg)=111 ;(e#; e#; t= M;: t)= ?211 ; 123? ? ? =e#; : sub(t): 126!=

14 gemacht.voneinersolchenbasisausgehend,kannmaneinerzeugendensystemvon DiefolgendenDenitioneninJames[2]wurdenzurBestimmungderBasisvonD#;;! KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN UnsereAufgabebestehtdarin,dieBasisvonD#;;zubestimmen. 13 D#;;bestimmen Denitionen: b)sein2in;einepartitionvonnundi2seq(),dannwirddiequalitatjedes a)ein?tableaut:[]!nheitstandard,wenndiebilderentlangderzeilen monotonundentlangderspaltenstrengmonotonwachsen. einzelnenbildesvoniwiefolgtdeniert: 1.Alle1'ensindgut. d)durchfolgendekonstruktionwirdeineabbildungvonseq()indiemengeder c)seq(#;)istdiemengederjenigensequenzeni2seq(),beidenenfurjede 2.Furbeliebigesk1isteinauftretendesk+1genaudanngut,wenndie -Tableauxdeniert: positivezahlkdieanzahlderguteniniauftretendenk'smindestens#kist. k+1'enist.andernfallsistdask+1schlecht. Anzahldervorherigengutenk'sechtgroeralsdieAnzahldervorherigen e)wirdeniereneinetotalordnung<tabaufdermengetab(;):esseienftg Seii2Seq().Tiwirdwiefolgtkonstruiert: undft0gzweiverschiedene-tabloidevominhalt,sunds0diejenigentableaux ausftgbzw.ft0g,dieentlangderzeilenmonotonwachsendsind. Esistftg<Tabft0g,wennsindererstenZeilevonunten,indersichsunds0 Istisgut,dannsetzessoweitwiemoglichinderis-tenReihenachlinks.Ist Furjedess=1;:::;n(indieserReihenfolge)fuhrefolgendesdurch: unterscheiden,lexikographischkleineristalss0. isschlecht,dannsoweitwiemoglichnachrechts Beispiel:BeiderfolgendenSequenzwurdenBildermitderQualitat'schlecht' durchxgekennzeichnet: (1;2;x2;3;x3;1;2;3;1;1)2Seq((4;2;2);(4;3;3)),da4gute1'er,2gute2'erund2 gute3'erenthaltensind. maenaus: Seii=(2;1;3;1;2)2Seq((2;1);(2;2;1)).DieKonstruktionvonTisiehtfolgender- (#2;1;3;1;2)7?! 1

15 KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN (2;#1;3;1;2)7?!2 14 (2;1;#3;1;2)7?!2 (2;1;3;#1;2)7?!24 (2;1;3;1;#2)7?!24 1 damiti2seq(#;)tiinnerhalbdes#-diagrammsstandardist. BildeinesgutenElementessteht,dasinderSequenzvorrauftritt.Somitgiltallgemein, Sei=(3;2)und=(2;2;1).Die-TabloidevomInhalthabenfolgendeOrdnung: DieseKonstruktionsorgtdafur,daeinBildeinesgutenElementesrimmerunterdem <Tab123 12<Tab122 13<Tab Bemerkung:JamesbeweistinseinerArbeit,da 22<Tab112 EinErzeugendensystemfurD#;;istalsowegen einek-basisfurd#;;!ist. fe#; Tiji2Seq(#;)g ;(e#; t)=e#; sub(t)(siehebemerkung1.2.8)diemenge Lemma:Seii2Seq(#;),=(k;k+1);(k2f1;:::;n?1g)eineTranspo- Isti2Seq(#;),danngilte#; sitionaus?(i)mitik<ik+1 DiesesErzeugendensystemgilteszuminimieren. fe#; sub(ti)ji2seq(#;)g: 23: fallsi62seq(#;),habenwire#; beitiindieil-tezeilediezahlleingetragen,diedannzusub(l)wird.dasbedeutet, sub(ti)=e#; dadieersten1stellenvoniaufdie1,diedarauolgende2stellenvoniaufdie2 Beweis:WirbetrachtendieAbbildungi7!sub(Ti).Furdiel-teStellevoniwird sub(ti)=0: sub(t(i)); abgebildetwerdenundsoweiter. WirunterscheidenzweiFalle:

16 KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN i)durchdietranspositionandertsichdiequalitatdesbildesderstellek+1nicht. Diesistnurmoglich,wennauchi2Seq(#;).Da2?,liegendieStellenk undk+1imselben-block,siewerdenfolglichunabhangigvonaufdieselbe 15 ii)dietranspositionandertdiequalitatdesbildesderstellek+1. Zahlabgebildet,d.h.sub(Ti)=sub(T(i)). DamitdieseWirkunghatmussenfolgendeBedingungengelten: Istnuni2Seq(#;),sostimmeninnerhalbvon[#]sub(Ti)undsub(T(i)) ik+1=ik+1. diezeilenalsmengensindgleich,dadiequalitateineselementesinibeider DieAnzahlpderbiszurStellek?1iniauftretenden'guten'ik'sistgleich KonstruktionvonTikeinenEinuaufdieZeilen,sondernnuraufdieSpalten uberein.auerhalbvon[#]konnensichdiesetableauxzwarunterscheiden,aber deranzahlderbiszurstellek?1auftretenden'guten'ik+1'en. hat. InisinddieStellenkundk+1'gut'. Die#;-Polytabloidevont=sub(Ti)undt0=sub(T(i))sindgleich,da beitabloidendiereihenfolgeinnerhalbderzeilenkeinerollespieltundtundt0 Isti62Seq(#;),soliegtdasBildderStellek+1voniinTiinnerhalbvon [#].SindwiralsobeiderKonstruktionvonTianderStellek?1angelangt, habenwirdiesituation,dainderzeileikundinderzeileik+1genaudieersten pstellenbelegtsind.somitstehenkundk+1intiinderspaltepinden innerhalbvon[#]ubereinstimmen. Zeilenikundik+1.kundk+1sindimgleichen-Blockvoni,dasbedeutetfur Denition:Seq(#;)wirddeniertalsdieMengevonSequenzeni2 sub(ti),dainnerhalbvon[#]zweigleichebildersub(k)stehen.somitfolgt Seq(#;),furdieientlangder-Blockemonotonfallendist. mitkorollar1.2.3: e#; sub(ti)=0: 2

17 KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN Satz:DieMengefe#; sub(ti)ji2seq(#;)g 16 Beweis: isteinek-basisvond#;;. i)erzeugendensystem: Esseii2Seq(0;).WirwahleneineTransposition1=(k;k+1)2?,mit ii)lineareunabhangigkeit: ik<ik+1.isti162seq(0;)soistnachlemma1.2.13e#; Andernfallsiste#; 1)2?wahlenmitjk0<jk0+1unddasVerfahrenwiederholen.Nachendlichvielen Wiederholungenerhaltenwirentwederi2Seq(#;),wobei=12:::,oder e#; sub(ti)=0: sub(ti)=e#; sub(t(i1))undwirkonnenfurj=i1ein2=(k0;k0+ sub(ti)=0. Seieni;j2Seq(#;),i6=j.j62?(i),daiundjentlangder-Blocke Wirdurfenannehmen,daix>jx. absteigendsortiertsind. EsseixdieersteStelle,andersichiundjunterscheiden.xseiimk-ten-Block. SindwirbeiderKonstruktionvonsub(Ti)anderStellexangelangt,tragenwir inderzeileixsub(x)=kein.beijstehenabderstelleximk-ten-blocknur Bilder,diekleineralsixsind,d.h.dainsub(Ti)inderZeileixmindestens einmalmehrkstehtalsinsub(tj).wirhabenalso: Esseit=sub(Ti).ImTragervone#; groteelementinderordnung<tab,datstandardin[#]. EsseijSeq(#;)j=m.i1;:::;imseiendieSequenzenSeq(#;). OhneBeschrankungderAllgemeinheitkonnenwirannehmen,da i;j2seq(0;);i6=j=)fsub(ti)g6=fsub(tj)g: fsub(tir)g<tabfsub(tis)g;fallsr<s. sub(ti)miti2seq(#;)istftgdas WirbetrachtendieGleichung Dannistkm=0,dafsub(Tim)gimTragervone# auchkm?1=km?2=:::=k1=0. keinempolytabloidsonst.mitdergleichenargumentationkannmanzeigen,da k1e#; sub(ti1)+:::+kme#; sub(tim)=0: sub(tim)enthaltenist,aberin 2

18 KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN Korollar:Seienn;n02INmitn0n,#`n0,(#;)einPaarvonPartitionen furnundeinepartitionvonninhochstensnteile.seieinepartitionvonn0?1, 17 Esgilt a) =(#1;:::;#i?1;#i?1;#i+1;:::);#i1: Beweis: b) a)wirzeigen,daeinbeliebigespolytabloidausd#;;!ind;;!enthaltenist.sei D#;;!D;;!; t=ti,i2seq(!)undf1;:::;kgeinetransversalederrechtsnebenklassenvon CT()inCT(#).WirhabenD#;;D;;: =X 2CT()sgn(1)f1tg+:::+X e#; t=x 2CT(#)sgn()ftg= b)folgtausa)wegend#;;= =sgn(1)e; ;(D#;;!) 1t+:::+sgn(k)e; 2CT()sgn(k)fktg= ;(D;;!)=D;;: kt2d;;!: 2

19 KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN ZurErzeugungeinerBasisvonM;gehtmanwiefolgtvor:Mandurchlauftdie- 1.3AllgorithmenzuJamesGewichtsraumen 18 Monomeci;jmiti2Seq();j2Seq(),furdiemanleichtdiezugehorigen-Tabloide SequenzeninlexikographischerReihenfolgeundspeichertnurdiejenigen,dieentlang 1.3.1Beispiel:=(3;2),=(2;2;1) vominhaltermittelnkann,diedanneinebasisvonm;bilden(siehekapitel1.1). der-blockemonotonfallendsind.soerhaltmanausjedem?-orbitgenaueinen Reprasentanten.NachBemerkung1.1.23erhaltmanaufdieseWeisealleverschiedenen m1=j11j21j2j=c(1;1;2;1;2);(1;1;2;2;3) m2=j11j22j1j=c(1;1;2;2;1);(1;1;2;2;3) (j11j12j2j=m1) m3=j21j11j2j=c(2;1;1;1;2);(1;1;2;2;3) (j12j11j2j=m3) (j12j12j1j=m4) (j12j21j2j=m4) alsodiessindalleverschiedenenmonomeci;mmiti2seq().diebasisvonm;ist c(1;1;2;1;2);(1;1;2;2;3)=c(1;1;1;2;2);(1;1;2;2;3)7!112 m4=j21j21j1j=c(2;1;2;1;1);(1;1;2;2;3) m5=j22j11j1j=c(2;2;1;1;1);(1;1;2;2;3) (j21j12j1j=m4) c(1;1;2;2;1);(1;1;2;2;3)=c(1;1;1;2;2);(1;1;3;2;2)7!113 c(2;1;1;1;2);(1;1;2;2;3)=c(1;1;1;2;2);(1;2;2;1;3)7!122 23=:b1 c(2;1;2;1;1);(1;1;2;2;3)=c(1;1;1;2;2);(1;2;3;1;2)7!123 22=:b2 c(2;2;1;1;1);(1;1;2;2;3)=c(1;1;1;2;2);(2;2;3;1;1)7!223 13=:b3 12=:b4 11=:b5

20 KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN monotonfallendsind,unduberpruft,obdieseinseq(#;)undsomitinseq(#;) ManbetrachtetalsonurdiejenigenSequenzenausSeq(),dieentlangder-Blocke FurdieErzeugungeinerBasisvonD#;;benotigenwirSequenzenausSeq(#;). 19 m1;m2;m3;m4undm5ausdemvorherigembeispielbetrachtenunddiesealssequenzen enthaltensind Beispiel: auassen: Essei;wieobenund#=(2;1).WirmussennurdieMonomein2.Normalform (1;1;2;1;2)2Seq(#;) DieBasisvonD#;;istalso(1;1;2;2;1)2Seq(#;) (2;1;1;1;2)2Seq(#;) (2;1;2;1;1)2Seq(#;) sub(t(1;1;2;1;2))=112 (2;2;1;1;1)62Seq(#;) sub(t(1;1;2;2;1))=113 sub(t(2;1;1;1;2))=122 23?212 22?213 31?322 MonomsummendiefolgendeForm: UnterVerwendungder2.NormalformhabendiedenPolytabloidenentsprechenden e#; sub(t(2;1;2;1;1))=123 21?223 sub(t(1;1;2;1;2))7!j11j21j2j?j21j11j2j sub(t(1;1;2;2;1))7!j11j22j1j?j21j21j1j 11 implementiertundkonnenjederzeitzurverfugunggestelltwerden. DieAlgorithmenzurErmittlungderBasenvonM;undD#;;,wurdeninC e#; sub(t(2;1;1;1;2))7!j21j11j2j?j22j11j1j sub(t(2;1;2;1;1))7!j21j21j1j?j22j11j1j

21 Codierungstheoretische Kapitel2 IndiesemKapitelwerdenzunachstdieallgemeinenGrundkonzeptederallgebraischen Anwendungen 2.1EinfuhrunginalgebraischeCodierungstheorie Codierungungstheorievorgestellt,dabeiwerdenweitgehendDenitionenvonHill[1] verwendet.dannbefassenwirunsmitlinearencodesuberendlichenkorpern. KanalsentstehendenUbertragungsfehlerzuerkennenundwennmoglich,zukorrigieren. habenfolgendesmodel: ZielderCodierungstheorieistes,Nachrichtenmoglichstfehlerfreizuubertragen.Wir 2.1.1Denitionen: QuelleNachricht?!CodiererCodewort?!Rauschen KanalEmpfangenes #?!Decodiererdecodierte a)eineendlichenichtleeremengea=fa1;a2;:::;akg DieAufgabederCodierungstheoriebestehtnundarin,diedurchdasRauschendes Wort?!Senke b)eineendlichefolgevonbuchstaben heitalphabet,ihreelementesindbuchstaben. c)eincodeuberaisteinenichtleereteilmengevonan. heitwortderlangen.diemengeallerworterderlangenwirdmitan bezeichnet. x=(x1;x2;:::;xn);xi2a,furallei2n 20

22 KAPITEL2.CODIERUNGSTHEORETISCHEANWENDUNGEN UmUbertragungsfehlernaheruntersuchenzukonnen,mussenwirsiemebarmachen Denitionen: 21 b)seicaneincode.dannbezeichnetdiezahl a)dieabbildungd:anan!ir, heitderhamming-abstandzwischenxundy. d(x;y)=jfi2njxi6=yigj;x=(x1;:::;xn);y=(y1;:::;yn)2an 2.1.3Lemma:DerHamming-AbstandisteineMetrik,d.h. dieminimaldistanzvonc. dc=minfd(u;v)ju;v2c;u6=vg b)d(x;y)=d(y;x),furallex;y2an. a)d(x;y)=0,genaudann,wennx=y. d(x;y)gibtdiekleinsteanzahlderzuanderndenbuchstabenan,wolltemanxzuy Beweis:a)undb)sindklar,zuc): machen.mankannaberauchmitd(x;z)+d(z;y)anderungenzunachstxinzund dannzinyverwandeln.diezahlderanderungenistdannmindestensd(x;y). c)d(x;y)d(x;z)+d(z;y),furallex;y;z2an Satz:SeiCAneinCode. beschreibtd(x;y)dieanzahlderaufgetretenenfehler. a)ckannbiszusfehlererkennen,wenndcs+1. WenneinCodewortxgesendetwurdeundderVektoryempfangenwurde,dann 2 Beweis: b)ckannbiszutfehlerkorrigieren,wenndc2t+1. a)seidcs+1undxeincodewort,beidessenubertragunghochstenssfehler seinundsokonneneventuelleubertragungfehlererkanntwerden. aufgetretensind.derempfangenevektorkannkeinvonxverschiedenescodewort

23 KAPITEL2.CODIERUNGSTHEORETISCHEANWENDUNGEN b)seidc2t+1,xdasgesendetecodewortundyderempfangenevektor,dersich vonxinhochstenststellenunterscheidet,d.h.d(x;y)t.istx0einanderes Codewortalsx,dannistd(x0;y)t+1,daandernfallsd(x0;x)d(x;y)+ 22 yjetztalsx,hatmaneventuellaufgetretenefehlerkorrigiert. Dasbedeutet,daxdasCodewortist,daszuyamnachstenist.Decodiertman d(x0;y)2tgeltenwurde,waseinwiderspruchzudc2t+1ist. distanzistdrei,dercodeistalsoinderlagezweifehlerzuerkennenundeinenfehler 2.1.5Beispiel:SeiA=f0;1g;n=9.DieNachrichtenseienTripel(x1;x2;x3);xi2 zukorrigieren. CodewortfurdieNachricht(x1;x2;x3)ist(x1;x2;x3;x1;x2;x3;x1;x2;x3).DieMinimal- A;i=1;2;3.DieCodierungbestehedarin,die3-Tupeldreimalzuwiederholen,d.h.das 2 DerDecodiererkann,wennhochstenseinFehlerauftritt,diesenkorrigieren.Wareder empfangenevektoraberz.b.(1,0,0,1,0,0,1,0,1)gewesen,d.h.eswarenzweifehleraufgetreten,sohattederdecodiererzwarerkannt,dadieubertragungfehlerhaftwar,aber Nachricht=(1;0;1)?! (1;0;1;1;0;0;1;0;1)(1;0;1;1;0;1;1;0;1)7!(1;0;1)?!empfangene (1;0;1)7!(1;0;1;1;0;1;1;0;1)?! Codierer (1;0;1;1;0;#0;1;0;1)?! Nachricht=(1;0;1) Rauschen behandelt Denitionen:Sein2IN. qelementen,bezeichnetmitfq.endlichekorperwerdenim3.kapitelausfuhrlich ImWeiterenbesteheunserAlphabetAausdenElementeneinesendlichenKorpersmit erhatte(1,0,0)alsnachrichtweitergegeben. b)ein(linearer)[n,k]-codeuberfqisteink-dimensionalerunterraumeinesndimensionalenfq-vektorraums. a)einlinearercodeuberfqisteinunterraumeinesfq-vektorraums. ImBeispielhandelteessichalsoumeinenlinearen[9,3,3]-CodeuberF2. c)ein(linearer)[n,k,d]-codeuberfqisteink-dimensionalerunterraumeinesndimensionalenfq-vektorraumsmitminimaldistanzd. ImAllgemeinenwirdeseinZielderCodierungstheoriesein,[n,k,d]-Codesmitkleinem n,moglichstgroemkundmoglichstgroemdzunden Denition:Einekn-Matrix,derenZeilenvektoreneineBasisfureinenlinearen [n;k]-codedarstellen,heitgeneratormatrixzudiesemcode.

24 2.1.8Beispiel:EineGeneratormatrixzum[9,3,3]-CodeausBeispiel1istz.B. KAPITEL2.CODIERUNGSTHEORETISCHEANWENDUNGEN mittelsmultiplikationcodiertwerdenkann: DieseMatrixhatdaruberhinausdieEigenschaft,dadiezuubertragendeNachricht (x1;x2;x3) =(x1;x2;x3;x1;x2;x3;x1;x2;x3): : G0,dieausGmitHilfefolgenderOperationenerzeugtwerdenkann: 2.1.9Bemerkung:IstGeineGeneratormatrixvomCodeC,dannauchjedeMatrix AllgemeinwerdeninderPraxisMatrizenalsCodiererlinearerCodesverwendet. (Z2)MultiplikationeinerZeilemiteinemElementg2Fqnf0g. (Z1)PermutationenderZeilen Denitionen: Beweis:NachjederdieserOperationenspannendieZeilenvektorenimmernochden UnterraumCauf. (Z3)Additiondesg-facheneinerZeilezueineranderen,wobeig2Fq. a)zweilinearecodesc1undc2heienaquivalent,wenneinegeneratormatrix vonc1durchfolgendeoperationenineinegeneratormatrixvonc2ubergefuhrt werdenkann: 2 b)einegeneratormatrixgeines[n,k]-codesheitinstandardform,wenn (S1)PermutationderSpalten. (S2)MultiplikationeinerSpaltemiteinemElementg2Fqnf0g. wobeiikdiekk-einheitsmatrixistundaeinekn?k-matrix. G=[Ik;A];

25 Code,y=(y1;:::;yk);y1;:::;yk2FqeinVektormiteinerzucodierendenNachricht, wennmanmithilfedieserdiecodierungvonnachrichtenvornimmt.seicein[n;k]- KAPITEL2.CODIERUNGSTHEORETISCHEANWENDUNGEN DiebesondereBedeutungderStandardformvonGeneratormatrizenwirddeutlich, 24 Codevektory0wegen G=[Ik;A]dieGeneratormatrix,mitdercodiertwird.Dannenthaltderzuygehorige indenerstenkeintragendienachricht.alleweitereneintragesindprufeintrage,mit derenhilfeman,fallsfehlerbeiderubertragungauftreten,dieseaufspurenundgegebenenfallskorrigierenkann Bemerkungen: y0=y[ik;a] b)jedegeneratormatrixkannmitdenoperationen(z1),(z2),(z3),(s1)und(s2) a)aquivalentecodesstimmeninihrencodierungstheoretischeneigenschaften a)esseienz1;:::;zkdiezeilenvektorenvonc.(s1)bedeutetfurdiezeilenvektoren,daihreeintragealleindergleichenweisepermutiertwerden.beieinem Beweis: instandardformgebrachtwerden. uberein,d.h.siehabendiegleichedimensionunddiegleicheminimaldistanz. beliebigencodevektorxwerdensomitnurdieeintragepermutiert,d.h.weder b)mangehtwiefolgtvor: DimensionnochMinimaldistanzverandert. (S2)andertnichtdenRangvonG,d.h.dieDimensionenaquivalenterCodessind CodevektorenundsomitdieMinimaldistanzbleibendadurchunbeeinut. ManpermutiertdieSpalten,bisindererstenZeilederersteEintragverschieden gleich.(s2)entsprichtbeidencodevektoreneinermultiplikationeineseintrages von0ist.manteiltdieerstezeiledurchdieseneintragundsetztihnsomit miteinemvon0verschiedenemelementausfq.derhamming-abstandbeliebiger auf1.alleweitereneintragedieserspaltewerdenauf0gebracht,indemman DiesesVerfahrenwiederholtmanfurdieubrigenZeilen2;3;:::;kunderhaltso entsprechendevielfachedererstenzeilevondenubrigenzeilenabzieht Denitionen: ZurAngabeeineseinfachenDecodierungsverfahrenssindfolgendeDenitionennotig. a)sein2in,x2fqneinvektor.dasgewichtwgt(x)wirddeniertalsdieanzahl Wirhabengesehen,wiemitHilfeeinerGeneratormatrixNachrichtencodiertwerden. diegewunschteform. 2 dervon0verschiedeneneintragevonx.

26 KAPITEL2.CODIERUNGSTHEORETISCHEANWENDUNGEN b)sein2in,ceinlinearer[n;k]-codeuberfq.eine(slepian)standardmatrix SCzuCisteineqn?kqn-Matrix,diewiefolgtkonstruiertwird: 25 iii)furjedespaltetragemanindiezweitezeilev2+w,wobeiwdervektoraus iv)dieswiederholemanfurdiedrittezeilemitv32fqnn(c[(v2+c))usw. ii)manwahleeinenvektorv22fqnnc,derminimalesgewichthat. i)manschreibtindieerstezeileallecodeworterausc,wobeimanmitdem Codewort0beginnt. dererstenzeileist.

27 2.1.13Bemerkung:JederVektorausFqnkommtinSCgenaueinmalvor,dadie Nebenklassena+Cundb+Cfurb62a+CdisjunktsindundFqn=(0+C)[(v1+ KAPITEL2.CODIERUNGSTHEORETISCHEANWENDUNGEN C)[(v2+C)+:::: 26 derubertragungsfehlergeringist.mangehtmiteinemempfangenenvektorywiefolgt FurdieMaximum-LikelihoodDecodierunggehtmandavonaus,dasdieAnzahl vor:ermittlungderspalteivonsc,inderysteht. istx=y?vj.umeincodewortzuerhalten,mumanvonyeinenvektorv02vj+c Esgilt: abziehen.vjistinvj+ceinvektorvonminimalemgewicht,esgiltalso Beweis:ysteheinderj-tenZeilevonSC,d.h.y2vj+C.NachKonstruktionvonSC DenVektorxausgeben,derinSCindererstenZeileinderSpalteisteht. d(y;x0)=wgt(y?x0)y?x02vj+c d(y;x0)d(y;x)furallex02c Beispiel:Wirbetrachtenden[6,2,3]-CodeCuberF2mitderGeneratormatrix wgt(vj)=d(y;x): DieerstendreiZeileneinerStandardmatrixzuCsindz.B. G=" #: 2 mitdemgeringstenabstandzuy. IsteinempfangerVektorz.B.y=(1;1;0;1;0;1),soist(0;1;0;1;0;1)dasCodewort (0;0;0;0;0;0)(1;0;1;0;1;0)(0;1;0;1;0;1)(1;1;1;1;1;1) (1;0;0;0;0;0)(0;0;1;0;1;0)(1;1;0;1;0;1)(0;1;1;1;1;1) (1;1;0;0;0;0)(0;1;1;0;1;0)(1;0;0;1;0;1)(0;0;1;1;1;1)

H2 1862 mm. H1 1861 mm

H2 1862 mm. H1 1861 mm 1747 mm 4157 mm H2 1862 mm H1 1861 mm L1 4418 mm L2 4818 mm H2 2280-2389 mm H1 1922-2020 mm L1 4972 mm L2 5339 mm H3 2670-2789 mm H2 2477-2550 mm L2 5531 mm L3 5981 mm L4 6704 mm H1 2176-2219 mm L1 5205

Mehr

Berufliches Gymnasium Gelnhausen

Berufliches Gymnasium Gelnhausen Berufliches Gymnasium Gelnhausen Fachbereich Mathematik Die inhaltlichen Anforderungen für das Fach Mathematik für Schülerinnen und Schüler, die in die Einführungsphase (E) des Beruflichen Gymnasiums eintreten

Mehr

35 Stetige lineare Abbildungen

35 Stetige lineare Abbildungen 171 35 Stetige lineare Abbildungen Lernziele: Konzepte: Lineare Operatoren und ihre Normen Resultate: Abschätzungen für Matrizennormen Kompetenzen: Abschätzung von Operatornormen 35.1 Lineare Abbildungen.

Mehr

Rekursionen (Teschl/Teschl 8.1-8.2)

Rekursionen (Teschl/Teschl 8.1-8.2) Rekursionen (Teschl/Teschl 8.1-8.2) Eine Rekursion kter Ordnung für k N ist eine Folge x 1, x 2, x 3,... deniert durch eine Rekursionsvorschrift x n = f n (x n 1,..., x n k ) für n > k, d. h. jedes Folgenglied

Mehr

Didaktik der Algebra Jürgen Roth Didaktik der Algebra 4.1

Didaktik der Algebra Jürgen Roth Didaktik der Algebra 4.1 Didaktik der Algebra 4.1 Didaktik der Algebra Didaktik der Algebra 4.2 Inhalte Didaktik der Algebra 1 Ziele und Inhalte 2 Terme 3 Funktionen 4 Gleichungen Didaktik der Algebra 4.3 Didaktik der Algebra

Mehr

UbungenzurAnalysis2 Prof.Dr.Kohnen WS1996/97 Dr.O.Delzeith

UbungenzurAnalysis2 Prof.Dr.Kohnen WS1996/97 Dr.O.Delzeith UbungenzurAnalysis2 Prof.Dr.Kohnen WS1996/97 Dr.O.Delzeith 1.(i)EntscheidenSie,obdieFunktion (ii)berechnensiedieintegrale impunktx0=0dierenzierbarist.bestimmensieggfs.dieableitungf0(x0). (a)1 Z0xf:(R!R

Mehr

15 2,835. 63843 Niedernberg, Nordring/Industriegebiet, Telefon (0 60 28) 9 70 70, Telefax (0 60 28) 97 07 20

15 2,835. 63843 Niedernberg, Nordring/Industriegebiet, Telefon (0 60 28) 9 70 70, Telefax (0 60 28) 97 07 20 Aluminium-Flachstange kg/mtr 10 x 2 0,054 3 0,081 4 0,108 5 0,135 6 0,162 8 0,216 12 x 3 0,097 5 0,162 6 0,200 8 0,259 15 x 2 0,081 3 0,121 4 0,162 5 0,202 6 0,243 8 0,324 10 0,405 20 x 2 0,108 3 0,162

Mehr

x LINEARE GLEICHUNGSSYSTEME In diesem Paragraph beginnen wir mit einer elementaren Behandlung linearer Gleichungssysteme Bevor wir versuchen eine allg

x LINEARE GLEICHUNGSSYSTEME In diesem Paragraph beginnen wir mit einer elementaren Behandlung linearer Gleichungssysteme Bevor wir versuchen eine allg SKRIPTUM { LINEARE ALGEBRA I JB COOPER Inhaltsverzeichnis: x Lineare Gleichungssysteme x Geometrie der Ebene und des Raumes x Vektorraume x Lineare Abbildungen Typeset by AMS-T E X x LINEARE GLEICHUNGSSYSTEME

Mehr

V DETERMINANTEN In diesem Kapitel entwickeln wir die Theorie der Determinanten Die folgenden Beispiele sollen die Einfuhrung dieses Begries motivieren

V DETERMINANTEN In diesem Kapitel entwickeln wir die Theorie der Determinanten Die folgenden Beispiele sollen die Einfuhrung dieses Begries motivieren SKRIPTUM { LINEARE ALGEBRA II JB COOPER Inhaltsverzeichnis: x Determinanten x Eigenwerte x Euklidische Raume x8 Dualitat, Tensorprodukte, Alternierende Formen Anhang: ) Mengen, Abbildungen ) Gruppen )

Mehr

Partitionen natürlicher Zahlen

Partitionen natürlicher Zahlen Partitionen natürlicher Zahlen wgnedin@math.uni-koeln.de 9. Oktober 03 In dieser Notiz wird der Beweis des Satzes über die Anzahl der Partitionen einer natürlichen Zahl vorgestellt. Die Darstellung folgt

Mehr

EinfuhrungundGrundlagen Lie-Gruppen HansGeorgFreiermuth HermannSchonecker FlorentineBunke MathiasSchulze NorbertGob Wintersemester1996/1997 Sommersemester1996 1 Inhaltsverzeichnis 1Lie-Gruppen:DenitionundBeispiele

Mehr

Höhere Mathematik 3. Apl. Prof. Dr. Norbert Knarr. Wintersemester 2015/16. FB Mathematik

Höhere Mathematik 3. Apl. Prof. Dr. Norbert Knarr. Wintersemester 2015/16. FB Mathematik Höhere Mathematik 3 Apl. Prof. Dr. Norbert Knarr FB Mathematik Wintersemester 2015/16 4. Homogene lineare Dierentialgleichungen 4.1. Grundbegrie 4.1.1. Denition. Es sei J R ein Intervall und a 0 ; : :

Mehr

Jurgen Muller Analysis I-IV

Jurgen Muller Analysis I-IV Jurgen Muller Analysis I-IV Skriptum zur Vorlesung Wintersemester 5/6 bis Sommersemester 7 Universitat Trier Fachbereich IV Mathematik/Analysis Dank an Elke Gawronski und Judith Wahlen fur die Mithilfe

Mehr

Übungen zu Zahlentheorie für TM, SS 2013

Übungen zu Zahlentheorie für TM, SS 2013 Übungen zu Zahlentheorie für TM, SS 2013 zusammengestellt von Johannes Morgenbesser Übungsmodus: Ausarbeitung von 10 der Beisiele 1 38, 5 der Beisiele A O und 15 der Beisiele i xxxi. 1. Zeigen Sie, dass

Mehr

TechnischeUniversitatMunchen ZentrumMathematik Kreditrisiko ModelleundDerivatebewertung Diplomarbeit AlexanderSzimayer von Abgabetermin:12.Mai1999 Betreuer: Themensteller:Prof.Dr.C.Kluppelberg Dr.M.Borkovec

Mehr

Sicherheitsanalyse und Implementierung einer hierarchischen Zugriffskontrolle für sichere Gruppenkommunikation auf Basis des chinesischen Restesatzes

Sicherheitsanalyse und Implementierung einer hierarchischen Zugriffskontrolle für sichere Gruppenkommunikation auf Basis des chinesischen Restesatzes Inhalt Sicherheitsanalyse und Implementierung einer hierarchischen Zugriffskontrolle für sichere Gruppenkommunikation auf Basis des chinesischen Restesatzes Masterarbeit von Mark Manulis CRTHACS Chinese

Mehr

Veröffentlichung der Besteuerungsgrundlagen gemäß 5 InvStG für

Veröffentlichung der Besteuerungsgrundlagen gemäß 5 InvStG für (alle Angaben je 1 Anteil und in EUR) Veröffentlichung der Besteuerungsgrundlagen gemäß 5 InvStG für Bantleon Anleihenfonds Bantleon Return Anteilklasse IA (ISIN: LU0109659770) WKN: 615250 für den Zeitraum

Mehr

2 Mengen und Abbildungen

2 Mengen und Abbildungen 2.1 Mengen Unter einer Menge verstehen wir eine Zusammenfassung von Objekten zu einem Ganzen. Die Objekte heiÿen Elemente. Ist M eine Menge und x ein Element von M so schreiben wir x M. Wir sagen auch:

Mehr

3 Anwendungen der Differentialrechnung. (x 1, x 2,..., x n 1, x n ) f xn (x 1, x 2,..., x n 1, x n ), 1 i n 1. y + cos z

3 Anwendungen der Differentialrechnung. (x 1, x 2,..., x n 1, x n ) f xn (x 1, x 2,..., x n 1, x n ), 1 i n 1. y + cos z R Es sei f : R n D R eine einmal stetig differenzierbare Funktion, für die in einer Umgebung eines Punkte a = a 1, a,, a n D gilt: fa 1, a,, a n = 0, f xn a 1, a,, a n 0 Dann gibt es eines Umgebung U des

Mehr

Komplexität und Komplexitätsklassen

Komplexität und Komplexitätsklassen Dr. Sebastian Bab WiSe 12/13 Theoretische Grundlagen der Informatik für TI Termin: VL 21 vom 21.01.2013 Komplexität und Komplexitätsklassen Die meisten Probleme mit denen wir zu tun haben sind entscheidbar.

Mehr

Klapptest Lineare Gleichungen I

Klapptest Lineare Gleichungen I Klapptest Lineare Gleichungen I (Lösungen als ganze Zahlen) 1. 6(x + 2)(x - 7) = x(6x + 6) - 48 1. x = -1 2. -7(x + 3)(x + 1) = x(-7x - 2) - 255 2. x = 9 3. 4(x - 7)(x + 7) = x(4x - 8) - 156 3. x = 5 4.

Mehr

356 Stand: 03/2016. 5,5Jx15 42 VA/HA 165 VR 15 Pirelli CN36 N4 - - - 356 C, alle Modelljahre

356 Stand: 03/2016. 5,5Jx15 42 VA/HA 165 VR 15 Pirelli CN36 N4 - - - 356 C, alle Modelljahre 356 Stand: 03/2016 Typ 356 Radgröße 4,5Jx15 42 VA/HA 165 VR 15 Pirelli CN36 N4 - - - 356 B, alle Modelljahre 15 Zoll 356 C, alle Modelljahre 5,5Jx15 42 VA/HA 165 VR 15 Pirelli CN36 N4 - - - 356 C, alle

Mehr

356 Stand: 08/ ,5Jx15 42 VA/HA 165 HR 15 Michelin XAS C, alle Modelljahre

356 Stand: 08/ ,5Jx15 42 VA/HA 165 HR 15 Michelin XAS C, alle Modelljahre 356 Stand: 08/2014 Typ 356 Radgröße 4,5Jx15 42 VA/HA 165 HR 15 Michelin XAS - - - 356 B, alle Modelljahre 15 Zoll 356 C, alle Modelljahre 5,5Jx15 42 VA/HA 165 HR 15 Michelin XAS - - - 356 C, alle Modelljahre

Mehr

Vorkurs Informatik Wintersemester 2015/2016. Programmtexte

Vorkurs Informatik Wintersemester 2015/2016. Programmtexte www.vorkurs-informatik.de Vorkurs Informatik Wintersemester 2015/2016 Programmtexte 1 Grundkonzepte der Programmierung Java-Programm zur Suche des Minimums: class ProgrammMinSuche{ int[] a = {11,7,8,3,15,13,9,19,18,10,4;

Mehr

Technische Hilfeleistung Stand 01/2010

Technische Hilfeleistung Stand 01/2010 Technische Hilfeleistung Stand 01/2010 Rettungskarten SUZUKI Hilfe für Helfer Suzuki Alto Typ: AMF 310 Baujahr: ab 2009 Suzuki Grand Vitara Typ: JB (alle Motoren) Baujahr: ab 2005 3 türig Suzuki Grand

Mehr

Mathematik 3 für Informatik

Mathematik 3 für Informatik Gunter Ochs Wintersemester 5/6 Mathematik 3 für Informatik Lösungen zum Hausaufgabenblatt Lösungshinweise ohne Garnatie auf Fehlerfreiheit c 5. Berechnen Sie die folgenden unbestimmten Integrale: a x 4

Mehr

Übungen für Woche 10

Übungen für Woche 10 Übungen für Woche 10 Martin Rubey 12. Januar 2011 Die folgenden Übungen sollen den Umgang mit Backtracking und kombinatorischen Spezies näherbringen. Genaue Hinweise gibt es erst auf Seite 5. Zur Erinnerung:

Mehr

Endgültige Gruppeneinteilung Kohorte Innere-BP Sommersemester 2016 (Stand: )

Endgültige Gruppeneinteilung Kohorte Innere-BP Sommersemester 2016 (Stand: ) A A1a 2197120 on on A A1a 2311330 on on on on on on on A A1a 2316420 on on A A1a 2332345 on on on on on on on A A1a 2371324 on on on on on on on A A1a 2382962 on on A A1a 2384710 on on on on on on on A

Mehr

Durchflussmessgeräte SITRANS F

Durchflussmessgeräte SITRANS F SITRANS F O delta p - Drosselgeräte Anwendungsbereich Geeignet für nichtaggressive und aggressive Gase, Dämpfe und Flüssigkeiten; -60 bis +00 C. Aufbau Zwei Fassungsringe mit auswechselbarer Messscheibe

Mehr

Ergänzungen zur Analysis I

Ergänzungen zur Analysis I 537. Ergänzungsstunde Logik, Mengen Ergänzungen zur Analysis I Die Behauptungen in Satz 0.2 über die Verknüpfung von Mengen werden auf die entsprechenden Regelnfür die Verknüpfung von Aussagen zurückgeführt.

Mehr

Vorlesung Analysis I / Lehramt

Vorlesung Analysis I / Lehramt Vorlesung Analysis I / Lehramt TU Dortmund, Wintersemester 2012/ 13 Winfried Kaballo Die Vorlesung Analysis I für Lehramtsstudiengänge im Wintersemester 2012/13 an der TU Dortmund basiert auf meinem Buch

Mehr

Angewandte Umweltsystemanalyse: Finite-Elemente-Methode (FEM)

Angewandte Umweltsystemanalyse: Finite-Elemente-Methode (FEM) Angewandte Umweltsystemanalyse: Finite-Elemente-Methode (FEM) Prof. Dr.-Ing. habil. Olaf Kolditz 1 Helmholtz Centre for Environmental Research UFZ, Leipzig 2 Technische Universität Dresden TUD, Dresden

Mehr

Eine zweidimensionale Stichprobe

Eine zweidimensionale Stichprobe Eine zweidimensionale Stichprobe liegt vor, wenn zwei qualitative Merkmale gleichzeitig betrachtet werden. Eine Urliste besteht dann aus Wertepaaren (x i, y i ) R 2 und hat die Form (x 1, y 1 ), (x 2,

Mehr

18 Höhere Ableitungen und Taylorformel

18 Höhere Ableitungen und Taylorformel 8 HÖHERE ABLEITUNGEN UND TAYLORFORMEL 98 8 Höhere Ableitungen und Taylorformel Definition. Sei f : D R eine Funktion, a D. Falls f in einer Umgebung von a (geschnitten mit D) differenzierbar und f in a

Mehr

Ebene algebraische Kurven

Ebene algebraische Kurven Ebene algebraische Kurven Tangenten und Singularitäten Meyrer Claudine 4. November 010 Inhaltsverzeichnis 1 Lokale Eigenschaften an-algebraischer Kurven (in C ) 1.1 Denitionen..............................

Mehr

Der Zwei-Quadrate-Satz von Fermat

Der Zwei-Quadrate-Satz von Fermat Der Zwei-Quadrate-Satz von Fermat Proseminar: Das BUCH der Beweise Fridtjof Schulte Steinberg Institut für Informatik Humboldt-Universität zu Berlin 29.November 2012 1 / 20 Allgemeines Pierre de Fermat

Mehr

Taylorentwicklung der k ten Dimension

Taylorentwicklung der k ten Dimension Taylorentwicklung der k ten Dimension 1.) Taylorentwicklung... 2 1.1.) Vorgehenesweise... 2 1.2.) Beispiel: f ((x, y)) = e x2 +y 2 8x 2 4y 4... 3 2.) Realisierung des Algorithmus im CAS Sage Math... 5

Mehr

Mathematischer Vorkurs

Mathematischer Vorkurs Mathematischer Vorkurs Dr. Agnes Lamacz Mathematischer Vorkurs TU Dortmund Seite 1 / 170 Kapitel 11 Aussageformen Mathematischer Vorkurs TU Dortmund Seite 103 / 170 11.1 Denition: Aussageformen Eine Aussageform

Mehr

Differenzengleichungen. und Polynome

Differenzengleichungen. und Polynome Lineare Differenzengleichungen und Polynome Franz Pauer Institut für Mathematik, Universität Innsbruck Technikerstr. 13/7, A-600 Innsbruck, Österreich franz.pauer@uibk.ac.at 1 Einleitung Mit linearen Differenzengleichungen

Mehr

Seite Dd-1 Dd-2 1C Dd-2. Dichtkegel mit Überwurfmutter und O-Ring schwere Reihe. 90 Bogen. Seite Dd-3 Dd-4 B2 Dd-4. Dichtkopf mit BSP-Überwurfmutter

Seite Dd-1 Dd-2 1C Dd-2. Dichtkegel mit Überwurfmutter und O-Ring schwere Reihe. 90 Bogen. Seite Dd-3 Dd-4 B2 Dd-4. Dichtkopf mit BSP-Überwurfmutter Armaturen-Übersicht DIN Metrisch C9 Dd-1 Dichtkegel mit und O-Ring schwere Reihe ISO 12151-2-SWS-S DKOS 0C Dd-1 Dichtkegel mit und O-Ring schwere Reihe ISO 12151-2 SWE 45 -S DKOS 45 Seite Dd-1 Dd-2 1C

Mehr

Beleuchtungen für die industrielle Bildverarbeitung

Beleuchtungen für die industrielle Bildverarbeitung Beleuchtungen für die industrielle Bildverarbeitung Teilkatalog Domlichter Version: 01/2013 SPECK SENSORSYSTEME GmbH www.led-beleuchtungen.com www.optosensoric.de Göschwitzer Str. 32 D-07745 Jena Fax.:

Mehr

HUMBOLDT-UNIVERSITATZUBERLIN INSTITUTFURINFORMATIK D-10099BERLIN

HUMBOLDT-UNIVERSITATZUBERLIN INSTITUTFURINFORMATIK D-10099BERLIN HUMBOLDT-UNIVERSITATZUBERLIN INSTITUTFURINFORMATIK D-10099BERLIN GraphenundAlgorithmen Einfuhrung Th.Emden-Weinert, S.Hougardy, H.J.Promel, B.Kreuter, A.Steger c13.september1996 VorlaugeFassung Inhaltsverzeichnis

Mehr

7 Die Determinante einer Matrix

7 Die Determinante einer Matrix 7 Die Determinante einer Matrix ( ) a11 a Die Determinante einer 2 2 Matrix A = 12 ist erklärt als a 21 a 22 det A := a 11 a 22 a 12 a 21 Es ist S 2 = { id, τ}, τ = (1, 2) und sign (id) = 1, sign (τ) =

Mehr

Beispiel vor dem Beweis:

Beispiel vor dem Beweis: Beispiel vor dem Beweis: Beispiel vor dem Beweis: A = ¼3 6 2 3 11 2½ Beispiel vor dem Beweis: 2½ 2½ ¼3 6 A = 2 3 11 311 E 12 A = 3 6 Beispiel vor dem Beweis: 2½ 2½ ¼3 6 A = 2 3 11 311 E 12 A = 3 6 3 11

Mehr

6. Mathematik Olympiade 2. Stufe (Kreisolympiade) Klasse 8 Saison 1966/1967 Aufgaben und Lösungen

6. Mathematik Olympiade 2. Stufe (Kreisolympiade) Klasse 8 Saison 1966/1967 Aufgaben und Lösungen 6 Mathematik Olympiade 2 Stufe (Kreisolympiade) Saison 1966/1967 ufgaben und Lösungen 1 OJM 6 Mathematik-Olympiade 2 Stufe (Kreisolympiade) ufgaben Hinweis: Der Lösungsweg mit egründungen und Nebenrechnungen

Mehr

Lösungsvorschlag zu den Hausaufgaben der 8. Übung

Lösungsvorschlag zu den Hausaufgaben der 8. Übung FAKULTÄT FÜR MATHEMATIK Prof Dr Patrizio Ne Frank Osterbrink Johannes Lankeit 9503 Lösungsvorschlag zu den Hausaufgaben der 8 Übung Hausaufgabe : Beweise den Satz über die Parallelogrammgleichung Sei H

Mehr

2 3 x3 17. x k dx = x k x k+1 k +1. Mit jeder weiteren partiellen Integration reduziert sich der Grad des Faktors x n, induktiv erhalten wir also

2 3 x3 17. x k dx = x k x k+1 k +1. Mit jeder weiteren partiellen Integration reduziert sich der Grad des Faktors x n, induktiv erhalten wir also Universität Konstanz Fachbereich Mathematik und Statistik Repetitorium Analysis 0 Dr DK Huynh Blatt 8 Aufgabe 6 Bestimmen Sie (a) (x + x 7x+)dx (c) (f) x n exp(x)dx (n N fest) sin (x)dx (g) (b) (d) ln(x)dx

Mehr

Oliver Marc Hartwich. Wettbewerb, Werbung und Recht

Oliver Marc Hartwich. Wettbewerb, Werbung und Recht Oliver Marc Hartwich Wettbewerb, Werbung und Recht Eine Kritik des Rechts des unlauteren Wettbewerbs aus historischer, rechtsvergleichender und ökonomischer Sicht zusammengeführt am Beispiel der vergleichenden

Mehr

Beispiel 2 ([1], Ex ) Sei jxj = m, jy j = n. Wieviele Funktionen f : X! Y

Beispiel 2 ([1], Ex ) Sei jxj = m, jy j = n. Wieviele Funktionen f : X! Y Kombinatorik Nach [1], Chap.4 (Counting Methods and the Pigeonhole Principle). Multiplikationsprinzip Beispiel 1 Wieviele Wörter der Länge 4 kann man aus den Buchstaben A,B,C,D,E bilden,... 1. wenn Wiederholungen

Mehr

4.4 Taylorentwicklung

4.4 Taylorentwicklung 4.4. TAYLORENTWICKLUNG 83 4.4 Taylorentwicklung. Definitionen f sei eine reellwertige m + -mal stetig differenzierbare Funktion der n Variablen x bis x n auf einem Gebiet M R n. Die Verbindungsgerade der

Mehr

Kapitel 2: Matrizen. 2.1 Matrizen 2.2 Determinanten 2.3 Inverse 2.4 Lineare Gleichungssysteme 2.5 Eigenwerte 2.6 Diagonalisierung

Kapitel 2: Matrizen. 2.1 Matrizen 2.2 Determinanten 2.3 Inverse 2.4 Lineare Gleichungssysteme 2.5 Eigenwerte 2.6 Diagonalisierung Kapitel 2: Matrizen 2.1 Matrizen 2.2 Determinanten 2.3 Inverse 2.4 Lineare Gleichungssysteme 2.5 Eigenwerte 2.6 Diagonalisierung 2.1 Matrizen M = n = 3 m = 3 n = m quadratisch M ij : Eintrag von M in i-ter

Mehr

Rekursion und Iteration - Folgen und Web-Diagramme

Rekursion und Iteration - Folgen und Web-Diagramme Rekursion und Iteration - Folgen und Web-Diagramme Ac Einführungsbeispiel Quadratpflanze Ein Quadrat mit der Seitenlänge m wächst wie in der Grafik beschrieben: Figur Figur2 Figur3 Täglich kommt eine Generation

Mehr

Leseprobe zu. Bittner/Clausnitzer/Föhlisch Das neue Verbrauchervertragsrecht

Leseprobe zu. Bittner/Clausnitzer/Föhlisch Das neue Verbrauchervertragsrecht Leseprobe zu Bittner/Clausnitzer/Föhlisch Das neue Verbrauchervertragsrecht Leitfaden für die Beratungspraxis 2014, ca. 272 Seiten, Monographie / Praxisbuch / Ratgeber ISBN 978 3 504 47107 1 39,80 Seite

Mehr

Wolfgang Werner. Der Architekt Heinrich Müller und die Bayrische Postbauschule in der Pfalz

Wolfgang Werner. Der Architekt Heinrich Müller und die Bayrische Postbauschule in der Pfalz Wolfgang Werner Der Architekt Heinrich Müller und die Bayrische Postbauschule in der Pfalz Wolfgang Werner Der Architekt Heinrich Müller und die Bayrische Postbauschule in der Pfalz Materialien zu Bauforschung

Mehr

Programmieren in C. Rekursive Funktionen. Prof. Dr. Nikolaus Wulff

Programmieren in C. Rekursive Funktionen. Prof. Dr. Nikolaus Wulff Programmieren in C Rekursive Funktionen Prof. Dr. Nikolaus Wulff Rekursive Funktionen Jede C Funktion besitzt ihren eigenen lokalen Satz an Variablen. Dies bietet ganze neue Möglichkeiten Funktionen zu

Mehr

ERGÄNZUNGEN ZUR ANALYSIS II MITTELWERTSATZ UND ANWENDUNGEN

ERGÄNZUNGEN ZUR ANALYSIS II MITTELWERTSATZ UND ANWENDUNGEN ERGÄNZUNGEN ZUR ANALYSIS II MITTELWERTSATZ UND ANWENDUNGEN CHRISTIAN HARTFELDT. Zweiter Mittelwertsatz Der Mittelwertsatz Satz VI.3.4) lässt sich verallgemeinern zu Satz.. Seien f, g : [a, b] R auf [a,

Mehr

Praxisorientierte Einführung in C++ Lektion: "Die Compiler-Chain (Vom Quellcode zum ausführbaren Programm)"

Praxisorientierte Einführung in C++ Lektion: Die Compiler-Chain (Vom Quellcode zum ausführbaren Programm) Praxisorientierte Einführung in C++ Lektion: "Die Compiler-Chain (Vom Quellcode zum ausführbaren Programm)" Christof Elbrechter Neuroinformatics Group, CITEC April 24, 2014 Christof Elbrechter Praxisorientierte

Mehr

Einführung in die Kodierungstheorie

Einführung in die Kodierungstheorie Einführung in die Kodierungstheorie Einführung Vorgehen Beispiele Definitionen (Code, Codewort, Alphabet, Länge) Hamming-Distanz Definitionen (Äquivalenz, Coderate, ) Singleton-Schranke Lineare Codes Hamming-Gewicht

Mehr

BADEN-WÜRTTEMBERG. Prüfung der Fachhochschulreife

BADEN-WÜRTTEMBERG. Prüfung der Fachhochschulreife MINISTERIUM FÜR KULTUS, JUGEND UND SPORT BADEN-WÜRTTEMBERG Prüfung der Fachhochschulreife an Berufskollegs zum Erwerb der Fachhochschulreife u.a. I Prüfungsfach I Mathematik Püfungstag 03. Juni 005 Bearbeitungszeit

Mehr

Lineare Gleichungssysteme

Lineare Gleichungssysteme Lineare Gleichungssysteme Sei K ein Körper, a ij K für 1 i m, 1 j n. Weiters seien b 1,..., b m K. Dann heißt a 11 x 1 + a 12 x 2 +... + a 1n x n = b 1 a 21 x 1 + a 22 x 2 +... + a 2n x n = b 2... a m1

Mehr

11 Stochastisches Integral und Itô-Formel

11 Stochastisches Integral und Itô-Formel 11 Stochastisches Integral und Itô-Formel Im diskreten Finanzmodell bei selbstfinanzierender Strategie ϑ = {ϑ n n=,...,n mit Anfangswert V gilt : Ṽ n ϑ = V + n ϑ T j S j. j=1 Dieser diskontierte Wertprozess

Mehr

Austausch- bzw. Übergangsprozesse und Gleichgewichtsverteilungen

Austausch- bzw. Übergangsprozesse und Gleichgewichtsverteilungen Austausch- bzw. Übergangsrozesse und Gleichgewichtsverteilungen Wir betrachten ein System mit verschiedenen Zuständen, zwischen denen ein Austausch stattfinden kann. Etwa soziale Schichten in einer Gesellschaft:

Mehr

2 Lösungen "Peptide de novo Sequencing"

2 Lösungen Peptide de novo Sequencing Lösungen "Peptide de novo Sequencing". Algorithm : PeptideSequencingOnlySux Input: a spectrum M with array of masses M = {m, m,, m n }, Σ, µ : Σ R >0 Output: the peptide string of the spectrum begin peptide

Mehr

Wirtschaftsmathematik für International Management (BA) und Betriebswirtschaft (BA)

Wirtschaftsmathematik für International Management (BA) und Betriebswirtschaft (BA) Wirtschftsmthemtik für Interntionl Mngement (BA) und Betriebswirtschft (BA) Wintersemester 2013/14 Stefn Etschberger Hochschule Augsburg Mthemtik: Gliederung 1 Aussgenlogik 2 Linere Algebr 3 Linere

Mehr

Weiterbildung für Ingenieure Numerische Methoden für Differentialgleichungen Prinzipien und Praxis Taubert, Heitmann Universität Hamburg WS03/04

Weiterbildung für Ingenieure Numerische Methoden für Differentialgleichungen Prinzipien und Praxis Taubert, Heitmann Universität Hamburg WS03/04 Weiterbildung für Ingenieure Numerische Methoden für Differentialgleichungen Prinzipien und Praxis Taubert, Heitmann Universität Hamburg WS03/04 Linearisierung 1 K. Taubert LINEARISIERUNG und das VERHALTEN

Mehr

dientdannzurklassikationneuerproblemstellungenunddamitzurbestimmungeinerspeziellsten

dientdannzurklassikationneuerproblemstellungenunddamitzurbestimmungeinerspeziellsten LernenvonAbstraktionshierarchienzurOptimierungderAuswahl vonmaschinellabstrahiertenplanen RalphBergmannundWolfgangWilke FBInformatik-AG-Richter UniversitatKaiserslautern MitHilfevon\Multistrategy"Ansatzen,dieerklarungsbasiertesundinduktivesLernenintegrieren,ist

Mehr

Literatur zu geometrischen Konstruktionen

Literatur zu geometrischen Konstruktionen Literatur zu geometrischen Konstruktionen Hadlock, Charles Robert, Field theory and its classical problems. Carus Mathematical Monographs, 19. Mathematical Association of America, Washington, D.C., 1978.

Mehr

Lineare Gleichungssysteme

Lineare Gleichungssysteme Lineare Gleichungssysteme Eine Familie von Gleichungen der Form a 11 x 1 + a 12 x 2 +... + a 1n x n = b 1 a 21 x 1 + a 22 x 2 +... + a 2n x n = b 2............ a m1 x 1 + a m2 x 2 +... + a mn x n = b m

Mehr

Ringe und Moduln. ausgearbeitet von. Corinna Dohle Matrikelnummer 6299128 corinna@math.upb.de

Ringe und Moduln. ausgearbeitet von. Corinna Dohle Matrikelnummer 6299128 corinna@math.upb.de Ringe und Moduln ausgearbeitet von Corinna Dohle Matrikelnummer 6299128 corinna@math.upb.de Seminar Darstellungstheorie Prof. Dr. H. Krause, PD Dr. D. Kussin Wintersemester 2007/2008 Grundlagen 1 Grundlagen

Mehr

Fortgeschrittene Konzepte

Fortgeschrittene Konzepte advanced.nb 1 Fortgeschrittene Konzepte Funktionen und Optionen Optionen in eigenen Funktionsdefinitionen ClearAll"Global " Sin2x Sin3x PlotSinx,,,x, 0, 2Π 2 3 1.0 0.5 1 2 3 4 5 6 0.5 1.0 advanced.nb 2

Mehr

Erweiterte Koordinaten

Erweiterte Koordinaten Erweiterte Koordinaten Sei K n ein n dimensionaler affiner Raum Die erweiterten Koordinaten des Punktes x x n K n sind x x n Kn+ (Das ist für alle K sinnvoll, weil in jedem Körper K wohldefiniert ist In

Mehr

3.2 Black-Scholes Analyse

3.2 Black-Scholes Analyse 3.. BLACK-SCHOLES ANALYSE 39 3. Black-Scholes Analyse Allgemeine Vorüberlegungen Eine Aktie ist eine Anlage ähnlich einem Kredit. Der Anleger bekommt eine Verzinsung, da Kapital ein Arbeitsfaktor ist.

Mehr

Stochastische Eingangsprüfung, 17.05.2008

Stochastische Eingangsprüfung, 17.05.2008 Stochastische Eingangsprüfung, 17.5.8 Wir gehen stets von einem Wahrscheinlichkeitsraum (Ω, A, P) aus. Aufgabe 1 ( Punkte) Sei X : Ω [, ) eine integrierbare Zufallsvariable mit XdP = 1. Sei Q : A R, Q(A)

Mehr

Typenblatt TT8000. Isolationsaufbau Elementart Querschnitt Außenabm. Form Best.-Nr. ab Lager mm 2 mm

Typenblatt TT8000. Isolationsaufbau Elementart Querschnitt Außenabm. Form Best.-Nr. ab Lager mm 2 mm Seite 1/6 Ausgleichsleitungen und Thermoleitungen für Thermoelemente nach DIN EN 43710: Fe-CuNi Typ L, DIN EN 60584: Fe-CuNi Typ J, NiCr-Ni Typ K, Pt 10 Rh-Pt Typ S und B Thermoleitungen auf Anfrage lieferbar

Mehr

/46. Abschlussprüfung Fachoberschule 2013 Mathematik

/46. Abschlussprüfung Fachoberschule 2013 Mathematik Abschlussprüfung Fachoberschule 0 Aufgabenvorschlag B /46 Am. Februar 0 wird um 4:00 Uhr ein Erdbeben mit der Anfangsstärke auf der sogenannten Richter-Skala gemessen. Das Beben dauert etwas länger als

Mehr

Summe und Teilbarkeit

Summe und Teilbarkeit BIP Kreativitätsgymnasium Leipzig Schuljahr 009/10 Begabtenförderung Mathematik - Klassenstufe 8 Summe und Teilbarkeit Matthias Richter 19. März 010 Aufgabenstellung Betrachten die Summe von n aufeinander

Mehr

15ab 21bc 9b = 3b 5a 7c 3

15ab 21bc 9b = 3b 5a 7c 3 4 4.1 Einführung Haben alle Summanden einer algebraischen Summe einen gemeinsamen Faktor, so kann man diesen gemeinsamen Faktor ausklammern. Die Summe wird dadurch in ein Produkt umgewandelt. Tipp: Kontrolle

Mehr

Funktionen mehrerer Variabler

Funktionen mehrerer Variabler Funktionen mehrerer Variabler Fakultät Grundlagen Juli 2015 Fakultät Grundlagen Funktionen mehrerer Variabler Übersicht Funktionsbegriff 1 Funktionsbegriff Beispiele Darstellung Schnitte 2 Partielle Ableitungen

Mehr

T-PIECES T-STÜCKE. 02/2016 www.dockweiler.com

T-PIECES T-STÜCKE. 02/2016 www.dockweiler.com T-PIECES T-STÜCKE 02/206 www.dockweiler.com 2 DT-4..2- (DT-9) utomatic Tube Weld: Straight Tee Mit nschweißenden: T-Stück ll prices ex works lle Preise ab Werk Order Code / rtikel-nr. Inch mm Inch mm SF

Mehr

Seminar Analysis Konvexe Funktionen und einige wichtige Ungleichungen

Seminar Analysis Konvexe Funktionen und einige wichtige Ungleichungen Seminar Analysis Konvexe Funktionen und einige wichtige Ungleichungen Michael Schaeer 3.04.03 Abstract This seminar is about convex functions and several imortant ineualities. At the beginning the term

Mehr

Theoretische Grundlagen der Informatik

Theoretische Grundlagen der Informatik Theoretische Grundlagen der Informatik Vorlesung am 12.01.2012 INSTITUT FÜR THEORETISCHE 0 KIT 12.01.2012 Universität des Dorothea Landes Baden-Württemberg Wagner - Theoretische und Grundlagen der Informatik

Mehr

Quadratische Gleichungen

Quadratische Gleichungen Quadratische Gleichungen Aufgabe: Versuche eine Lösung zu den folgenden Zahlenrätseln zu finden:.) Verdoppelt man das Quadrat einer Zahl und addiert, so erhält man 00..) Addiert man zum Quadrat einer Zahl

Mehr

Stützen für Fördersysteme

Stützen für Fördersysteme Stützen für Fördersysteme Inhalt Führungsprofile, Befestigungswinkel und Füße...317 Stützenvarianten...31 Tragprofile...319 Verbindungswinkel - Auswahlmöglichkeiten...320 Verbindungswinkel für Tropfrinnen...320

Mehr

Dun & Bradstreet Compact Report

Dun & Bradstreet Compact Report Dun & Bradstreet Compact Report Identification & Summary (C) 20XX D&B COPYRIGHT 20XX DUN & BRADSTREET INC. - PROVIDED UNDER CONTRACT FOR THE EXCLUSIVE USE OF SUBSCRIBER 86XXXXXX1. ATTN: Example LTD Identification

Mehr

Gewöhnliche Dierentialgleichungen

Gewöhnliche Dierentialgleichungen Gewöhnliche Dierentialgleichungen sind Gleichungen, die eine Funktion mit ihren Ableitungen verknüpfen. Denition Eine explizite Dierentialgleichung (DGL) nter Ordnung für die reelle Funktion t x(t) hat

Mehr

3 Elementare Umformung von linearen Gleichungssystemen und Matrizen

3 Elementare Umformung von linearen Gleichungssystemen und Matrizen 3 Elementare Umformung von linearen Gleichungssystemen und Matrizen Beispiel 1: Betrachte das Gleichungssystem x 1 + x 2 + x 3 = 2 2x 1 + 4x 2 + 3x 3 = 1 3x 1 x 2 + 4x 3 = 7 Wir formen das GLS so lange

Mehr

Thema 1 Die natürlichen Zahlen

Thema 1 Die natürlichen Zahlen Thema 1 Die natürlichen Zahlen Wir bezeichnen mit N die Menge der natürlichen Zahlen dh N {1,,, } Falls wir das Nullelement 0 dazu nehmen, dann bezeichnen wir die resultierende Menge mit N 0 also N 0 {0,

Mehr

Gutachten BK 2301 (Lärmschwerhörigkeit)

Gutachten BK 2301 (Lärmschwerhörigkeit) Ihr Zeichen: Ihre Nachricht vom: Unser Zeichen: Ihr Ansprechpartner: Telefon: Fax: E-Mail: Datum: Name, Vorname: geb.: Gutachten BK 2301 (Lärmschwerhörigkeit) 1 Vorgeschichte Wesentliche Zeitabschnitte

Mehr

Vorkurs: Mathematik für Informatiker Steven Köhler, Anja Moldenhauer, Marcel Morisse

Vorkurs: Mathematik für Informatiker Steven Köhler, Anja Moldenhauer, Marcel Morisse Vorkurs: Mathematik für Informatiker Steven Köhler, Anja Moldenhauer, Marcel Morisse Wintersemester 2014/15 Aufgaben I-1. Es seien die folgenden Mengen A = {5,7,9}, B = {5,6,7} und C = {1,3,5,7,9} gegeben.

Mehr

Herzlich Willkommen ! " $' #$% (!)% " * +,'-. ! 0 12" 12'" " #$%"& /!' '- 2! 2' 3 45267 2-5267

Herzlich Willkommen !  $' #$% (!)%  * +,'-. ! 0 12 12'  #$%& /!' '- 2! 2' 3 45267 2-5267 Page 1/1 Herzlich Willkommen! " #$%"&! " $' #$% (!)% " * +,'-. /!' '-! 0 12" 12'" 2! 2' 3 45267 2-5267 -26 89 : 9; ;/!!' 0 '6'!!2' 2(' '' ' &! =>! = / 5,?//'6 20%! ' 6', 62 '! @ @! &> $'( #'/

Mehr

lineare-algeba.wxmx 1 / 7 Mathematik in wxmaxima www.mathematik-verstehen.de Haftendorn Dez 2010

lineare-algeba.wxmx 1 / 7 Mathematik in wxmaxima www.mathematik-verstehen.de Haftendorn Dez 2010 lineare-algeba.wxmx / Lineare Algebra Mathematik in wxmaxima www.mathematik-verstehen.de Haftendorn Dez. Handling Achtung: Durch Anklicken der linken Zellmarkierung kann man die Abschnitte und auch einzelne

Mehr

Empfindlichkeit und Rauschmaß eines DVB T Sticks

Empfindlichkeit und Rauschmaß eines DVB T Sticks Empfindlichkeit und Rauschmaß eines DVB T Sticks Messung kritischer Spezifikationen eines Salcar Stick DVB T RTL 2832U&R820T SDR Salcar Stick, oder ähnlich Blockschaltbild des R820T Tuners Aufbau für Empfindlichkeitsmessung:

Mehr

Outsourcing bei Kreditinstituten: Rechtsfragen im Zusammenhang mit dem Bank- und Datenschutzrecht

Outsourcing bei Kreditinstituten: Rechtsfragen im Zusammenhang mit dem Bank- und Datenschutzrecht Melanie Gutmann Outsourcing bei Kreditinstituten: Rechtsfragen im Zusammenhang mit dem Bank- und Datenschutzrecht Wirtschaftliche Interessen der Banken im Spannungsverhältnis zum Geheimhaltungsinteresse

Mehr

Die absolut kleinsten Diskriminanten der biquadratischen Zahlkörper

Die absolut kleinsten Diskriminanten der biquadratischen Zahlkörper Akademie d. Wissenschaften Wien; download unter www.biologiezentrum.at Die absolut kleinsten Diskriminanten der biquadratischen Zahlkörper Von Josef Mayer (Vorgelegt in der Sitzung am 14. Novem ber 1929)

Mehr

Analyse von Zeitreihen in der Umweltphysik und Geophysik Stochastische Prozesse

Analyse von Zeitreihen in der Umweltphysik und Geophysik Stochastische Prozesse Analyse von Zeitreihen in der Umweltphysik und Geophysik Stochastische Prozesse Yannik Behr Gliederung 1 Stochastische Prozesse Stochastische Prozesse Ein stochastischer Prozess ist ein Phänomen, dessen

Mehr

Mathematik für Informatiker II Übungsblatt 7

Mathematik für Informatiker II Übungsblatt 7 Mathematik für Informatiker II Übungsblatt 7 Vincent Blaskowitz Übungsblatt 7 vom 03.06.20 Aufgabe Aufgabenstellung Berechnen Sie die folgenden Logarithmen ohne Taschenrechner: i log 0,008 ii log 2 Lösung

Mehr

Mathematics. - Ueber die Difterentialkovariante erster Ordnung der binären kubischen Difterentialform. Von P. G. MOLENAAR.

Mathematics. - Ueber die Difterentialkovariante erster Ordnung der binären kubischen Difterentialform. Von P. G. MOLENAAR. Mathematics. - Ueber die Difterentialkovariante erster Ordnung der binären kubischen Difterentialform. Von P. G. MOLENAAR. (Communicated by Prof. R. WEITZENBÖCK.) (Communicated at the meeting of December

Mehr

Thema14 Der Satz über inverse Funktionen und der Satz über implizite Funktionen

Thema14 Der Satz über inverse Funktionen und der Satz über implizite Funktionen Thema14 Der Satz über inverse Funktionen und der Satz über implizite Funktionen In diesem Kapitel betrachten wir die Invertierbarkeit von glatten Abbildungen bzw. die Auflösbarkeit von impliziten Gleichungen.

Mehr

4.1. Aufgaben zu linearen Funktionen

4.1. Aufgaben zu linearen Funktionen .. Aufgaben zu linearen Funktionen Aufgabe : Koordinatensystem a) Gib die Koordinaten der Punkte P - P 8 in dem rechts abgebildeten Koordinatensystem an. b) Markiere die Punkte A( ); B( ); C( ); D( );

Mehr

Hardwarepraktikum WS05/06

Hardwarepraktikum WS05/06 Hardwarepraktikum WS5/6 Sven Eckelmann 2..26 Inhaltsverzeichnis Versuch Komb. NANDNANDRealisierung.......................2 NORNORRealisierung.........................3 Schaltung................................

Mehr