UberModulnundCodes. UlrichEidt

Größe: px
Ab Seite anzeigen:

Download "UberModulnundCodes. UlrichEidt"

Transkript

1 UberModulnundCodes UlrichEidt Bayreuth,den14.August1992 VorgelegtalsDiplomarbeitbei LehrstuhlIIfurMathematik deruniversitatbayreuth Prof.Dr.A.Kerber

2 1DarstellungstheoretischeGrundlagen Vorwort Inhaltsverzeichnis 2CodierungstheoretischeAnwendungen 1.2JamesGewichtsraume::::::::::::::::::::::::::::10 1.3AllgorithmenzuJamesGewichtsraumen:::::::::::::::::: TabloidevomInhalt::::::::::::::::::::::::::: EndlicheKorper 2.2JamesGewichtsraumealsCodes:::::::::::::::::::::::27 2.1EinfuhrunginalgebraischeCodierungstheorie::::::::::::::: MDS-Codes::::::::::::::::::::::::::::: Majoritatslogik-decodierbareCodes::::::::::::::::: BinareReed-MullerCodes::::::::::::::::::::::34 ATabellenmitJames-GewichtsraumenD#;; 3.1TheoretischeGrundlagenfurendlicheKorperinNormalbasenreprasentation40 3.2DieImplementierungfurSYMMETRICA:::::::::::::::::: Quellcode::::::::::::::::::::::::::::::: DokumentationderbereitgestelltenFunktionen::::::::::48 A.1undPartitionenvon5::::::::::::::::::::::::::78 A.2undPartitionenvon6::::::::::::::::::::::::::79 A.3undPartitionenvon7::::::::::::::::::::::::::80 A.4undPartitionenvon8::::::::::::::::::::::::::81 A.5undPartitionenvon9::::::::::::::::::::::::::83 Literaturverzeichnis Urhebervermerk

3 Vorwort James[2]fuhrtedenK?r-ModulM;!ein(!=(1r);`r)undbestimmtedieBasen derdarinenthaltenenvektorraumed#;;!((#;)einpaarvonpartitionenfurr). DannfolgteineErweiterungseinesBasissatzesaufdieVektorraumeD#;;M;. DieseRaumewurdenaufihreEigenschaftenalsCodesnaheruntersucht.Dabeisind ImerstenKapitelverallgemeinernwirzunachstJames'Denitionvon-Tabloidenauf- TabloidevomInhalt,wobeieineuneigentlichePartitionvonrinhochstensrTeileist. CodesmitgutenEigenschaftengefundenworden,dieimzweitenKapitel,nacheiner CodierungstheoretischenEinfuhrung,naherbeschriebenwerden. ZumUberblickvonJames-GewichtsraumenalsCodessindimAnhangdieserArbeiteinigeTabellennomegezeigtunddieImplementierungendlicherKorperfurdasAlgebrasystemSYMhandelt,dieScheerhorn[6]eingefurthat.EswirddieExistenztrace-kompatiblerPoly- METRICAvorgestellt. AndieserStellemochteichHerrnDr.Karl-HeinzZimmermannvomLehrstuhlfurInformatikdanken,dermirmitRatundTatzurSeitestand,undmitdemesvielSpa dankeherrnprof.dr.adalbertkerberfurdieunterstutzungundforderungderar- gemachthat,imdschungelderjames-gewichtsraumenachgutencodeszusuchen.ich ImdrittenKapitelwerdentrace-kompatibleKorpererweiterungenendlicherKorperbe- Bayreuth,den14.August1992 METRICAnichtmoglichgewesenware. undherrndr.axelkohnert,ohnediedieimplementierungendlicherkorperfursym- beit. AuerdemdankeichHerrnAlfredScheerhornvomIBMScienticCenterinHeidelberg UlrichEidt 2

4 Kapitel1 Darstellungstheoretische Grundlagen SeialsoreinepositiveganzeZahl,einePartitionvonrundeineuneigentliche PartitionvonrinhochstensrTeilefurdenRestdesKapitels. WirzeigenindiesemUnterkapiteldie1:1Beziehungzwischenden-Tabloidenvom 1.1-TabloidevomInhalt 1.1.1Denitionen: Inhaltundden?-Orbitsvon-Sequenzen.DieseBeziehungnutzenwirdannfur einenalgorithmuszurkonstruktioneinertransversaleder-tabloidevominhalt. b)sei=(1;:::;n)j=ninhochstensnteile.i=(i1;:::;ir)heit-sequenz a)furn2inbezeichnetnrdiemengeallerfunktionenvonr=f1;:::;rgnach (i(1);:::;i(r))furallei2nr. aller-sequenzenwirdmitseq()bezeichnet. genaudann,wennjedesj2ngenauj-malinialsbildvorkommt.diemenge beschrieben.die?roperiertvonrechtsaufnrvermogeplatzpermutationi= n=f1;:::;ng.einefunktionwirddurcheinefolgei=(i1;:::;ir)vonbilder 1.1.2Vereinbarung:Diemonotonsteigende-Sequenzwirdbezeichnetmit Seiz.B.=(2;2;0;1)j=5dannisti=(1;4;2;2;1)2Seq()undm=(1;1;2;2;4). m=(1 1;:::;1;2 z} { z} { 2;:::;2;:::;n n;:::;n): z} { deniert,wobeiadiezeileundbdiespalteangibt Denition:DasDiagramm[]vonwirddurcheineMengevonPaaren []:=f(a;b)2ininj1a^1big 3

5 KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN ineinergedachtenmatrixanderstelle(a;b)einkreuzmacht Vereinbarung:Diagrammewerdenveranschaulicht,indemmanfur(a;b)2[] Denition:Ein-TableauisteineAbbildungvomDiagramm[]ineinenichtleereMenge. Z.B.=(3;2;2;1)dannist[]= 1.1.6Vereinbarung:EinsolchesTableaustellenwirdar,indemwirimDiagramm []stattderkreuzedasderabbildungentsprechendemengenelementeintragen. Wirxierendasbijektive-TableauT:[]!r, T:=1 1+1:::1+2 :::::: 1 ein-tableauundwirdmittibezeichnet. Furjedesi2nristauchiTwegen[]T :::::: 1.1.7Bemerkung:DieAbbildungvon?r[]![]?!ri isteineoperation. (;(a;b))7!t?1t(a;b)=:(a;b):?!n Beweis: b)seien;2?r.dannist a)1(a;b)=t?11t(a;b)=(a;b) 1.1.8Denition: ((a;b))=(t?1t(a;b))=t?1tt?1t(a;b)= Mengeder-Tableaux.Furjedes-TableautundjedePermutationdenierenwirt wiefolgt: Dadie?raufdemUrbildraumvon-Tableauxoperiert,operiertsieauchaufder =T?1T(a;b)=(a;b) t((a;b)):=t(?1(a;b)): 2

6 KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN 1.1.9Beispiel:Sei=(3;3;1),d.h. T=123 5 t((1;1))=t(?1(1;1))=t(t?1?1t(1;1))=t(t?1?11)=t(t?17)=t((3;1))=4; und=(157)2?7.dannist ;auerdemseit=135 ebensot((2;2))=1undt((3;1))=6: AlleanderenBildervontwerdendurchnichtbeeinut.Wirhabenalso Bemerkung:Die?roperiertalsoaufderMengeder-Tableauxdurch Platzpermutation,wobeidiePlatzevon[]wieinTnumeriertsind. t= Denitionen: : a)esseij=rinhochstensrteile.mit?rmfurbeliebigesmrwerdedieuntergruppeder?rbezeichnet,diealleelementeausrnmunverandertlat.auerdem DiekanonischeYounguntergruppezuwirddannmit i:=f1+i?1?:=?r1?r2:::?rr Xj=1j;:::;iXj=1jg: seiirfurallei2rdiemengederelementeausdemi-ten-block, b)derzeilenstabilisatorrtistdiezugehorigekanonischeyounguntergruppe deniert. c)ein-tabloidftgistdieaquivalenzklassevom-tableautunterderaquivalenzrelationct:=?rf1;1+1;1+2+1;:::g?rf2;1+2;:::g?f3;1+3;:::g:::: der?r. DerSpaltenstabilisatorwirddeniertmit t1t2:()esexistiertein2rt:t1=t2:

7 1.1.12Vereinbarung:ftgwirddargestellt,indembeitLinienzwischendieZeilen KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN 6 undzusatzlicheineliniedaruberundeinedaruntergezogenwerden. diemonotonesequenzmsinddieelementeausdemi-ten-blockiallegleichi.? istdemnachgenaudieuntergruppeder?r,diemunverandertlat Bemerkung:SeieineuneigentlichePartitionvonrinhochstensrTeile.Fur Z.B.fTg=1 1+1:::1+2 :::::: 1: DieMengeder-TabloidevomInhaltwirdmitTab(;)bezeichnet. Dannist[]= Beispiel:Sei=(3;2);=(2;2;1) Denition:ftgheit-TabloidvomInhalt,genaudann,wennjedes j2rgenauj-malalsbildintvorkommt..ein-tableaut:[]!5istz.b.124 RT=?5f1;2;3g?5f4;5g 35: somitistdas-tabloidftg d.h.diereihenfolgeindenzeilenspieltfurftgkeinerolle. Dieverschiedenen-TabloidevomInhaltsind ;113 35=214 22;122 53=142 13;123 35=412 12und223 53=usw., Entscheidendisthier,dadieBilder1,1und2indererstenZeileund2und3inder inwelcherzeilesind. DiewesentlichenInformationender-Tabloideliegendarin,welcheBildervonftg Wirbetrachtenz.B : 11: jedemtabloideinetupelmengezuordnen.wichtigisthierbei,daeinetupelmenge genaudanneinem-tabloidentspricht,wenneinefolge,bestehendausdenersten dadasbildbinderzeilealiegt.mankannalsojedertupelmengeeintabloidund zweitenzeilestehen.diemengevontupelnf(1;1);(1;2);(1;2);(2;2);(2;3)genthalt demnachallenotigeninformationenvonobigemtabloid,wobeieintupel(a;b)angibt, KoordinatenderTupelmenge,eine-Sequenzist.Daruberhinausentsprichtsieeinem

8 KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN -TabloidvomInhalt,wennzusatzlicheineFolgederzweitenKoordinateneine- Sequenzist.EsentsprichtzumBeispielf(2;3);(1;5);(2;5);(3;1);(1;4);(1;2)gwegen (2;1;2;3;1;1)2Seq(3;2;1)und(3;5;5;1;4;2)2Seq(1;1;1;1;2)einem(3;2;1)-Tabloid Denitionen: vominhalt(1;1;1;1;2),namlich a)seikeinkorperundneinepositiveganzezahl. RK(n)=K[fcs;tjs;t2ng]bezeichnetdie(kommutative)AlgebraallerPolynome 542 uberkindenn2unbekanntencs;t,s;t2n.furr2inmitrnseirk(n;r) 35 1 : b)seii2seq()undj2seq(). vomgradraufgespanntwird. derunterraumvonrk(n),dervondenmonomen inzweiternormalform(2.nf). EinMonomderFormcm;jbzw.ci;mheitinersterNormalform(1.NF)bzw. ci;j:=ci1;j1:::cir;jr;i=(i1;:::;ir);j=(j1;:::;jr)2rr; Vereinbarung:HabenwireinMonomin2.NF,sowirdesveranschaulichtmit Korollar:Furallei;k2Seq();j;l2Seq()gilt: ji1:::i1ji1+1:::i1+2j:::j:=ci;m: Beweis: b)ci?1;j=ci;jfurallei2?r: a)ci;j=ck;l()92?r:i=k^j=l: b)folgtunmittelbarausa). a)folgtausderdenitionundderkommutativitatvonrk(n). c)jedesmonomci;jkannin1.nfbzw.in2.nfgebrachtwerden. c)esexistieren;2?r,sodai=mundj=m,d.h.iundjentstehenaus denmonotonensequenzendurchentsprechende(sortierende)platzpermutationen. Mitg=j?1kannmanci;jin1.NFci;j=cm;j=cm;g(sieheb))bringen. Analogbringtmanmith=i?1ci;jin2.NFci;j=ch;m.

9 1.1.19Bemerkung:ci;j2RK(n;r)entsprichtderMengef(i1;j1);:::;(ir;jr)g,d.h. KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN 2 8 einem-tabloidvominhaltgenaudann,wenni2seq()undj2seq().esgibt genaudenbildernder2.reiheusw. somiteinebijektionvondermengedermonomeci;j(i2;j2)aufdiemengeder Beispiel:=(3;2),=(1;1;1;2) Bilderj1;:::;j1genaudenBildernder1.ReihedesTabloids,dieBilderj1+1;:::;j1+2 -TabloidevomInhalt. j2seq(),in1.nfvorliegenhaben.esentsprechendannnamlichinderfolgejdie DieseBijektionistalssolchebesondersgutzuerkennen,wennwirdieMonomecm;j, tlegttfestundumgekehrt.andertmanbeitdiereihenfolgevon(4;2;3;1;4)innerhalb der-blocke,somutnachobigerbemerkungimmernochtentsprechen. t:=423 t=c(1;1;1;2;2);(3;4;2;4;1)=c1;3c1;4c1;2c2;4c2;1 c1;4c1;2c1;3c2;1c2;4=c(1;1;1;2;2);(4;2;3;1;4)=:t 14!f(1;4);(1;2);(1;3);(2;1);(2;4)g!! f(1;3);(1;4);(1;2);(2;4);(2;1)g!342 entwedernachdererstenodernachderzweitensequenz,waswegenderkommutativitat 2.NF: UmvoneinerNormalformindieanderezugelangen,sortiertmaneinfachdasMonom In2.NFspieltdieReihenfolgeinnerhalbder-BlockekeineRolle.ObigesMonomin j2j1j1j12j=c(2;1;1;1;2);(1;2;3;4;4)=c(2;1;1;2;1);(1;2;3;4;4)=j2j1j1j21j 41=t vonrk(n)moglichist. zukonstruieren.dafurermittelnwiralleverschiedenenmonomeci;jmiti2seq() $!c(1;1;1;2;2);(4;2;3;1;4)=c(2;1;1;1;2);(1;2;3;4;4)=j2j1j1j12jbzw: undj2seq(). WirwendenunsjetztderAufgabezu,eineTransversaleder-TabloidevomInhalt j2j1j1j21j=c(2;1;1;2;1);(1;2;3;4;4)=c(1;1;1;2;2);(2;3;4;1;4) $342 41! heit?-bahnvoni Denition:Seii2rr.DieMenge?(i):=fij2?g

10 KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN Korollar:ZweiMonomeci;mundck;min2.NFsindgenaudanngleich, wenndie-sequenzeni,kinderselben?-bahnliegen. 9 Beweis:MitKorollar1.1.18gilt: esfolgtmitbemerkung ci;m=ck;m,92?r:i=k^m=m; bringenlat.wirentnehmenalsojeder?-bahnvon-sequenzeneinenreprasentanten nachkorollar1.1.18aufmonomein2.nfbeschranken,dasichjedesmonomauf2.nf Bemerkung:ZurKonstruktionallerverschiedenenMonomekonnenwiruns d.h.iundkliegeninderselben?-bahn. ci;m=ck;m,92?:i=k; undinterpretierendiesedannalsmonomein2.nf. 2

11 KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN ImfolgendenKapitelwirdderBasissatzfurJamesGewichtsraumebewiesen,dereine 1.2JamesGewichtsraume 10 hat.derbeweiszudieserverallgemeinerungfolgtindergrundideedembeweisvon VerallgemeinerungdesBasissatzesfurSpechtmodulnist,denJames[2]durchgefuhrt Zimmermann[9]. EsseifurdasganzeKapitelneinenaturlicheZahl,einePartitionvonn,eine genaunteileundkeinfestgewahlterkorper Denitionen: uneigentlichepartitionvonninhochstensnteile,!=(1n)diepartitionvonnin b)sein02in,mitn0n.sei#`n0.daspaar(#;)heitpaarvonpartitionenfurn,wenngilt: M;:=M a)esbezeichne denk-vektorraum,derdurchdie-tabloidevominhalterzeugtwird. #iifurallei1: ftg2tab(;)kftg d)seit:[]!nein-tableau.als#;-polytabloidzutwird c)sei(#;)einpaarvonpartitionenfurn.mitct(#)wirddieuntergruppedes SpaltenstabilisatorsCTbezeichnet,diedieElementeauerhalbdesDiagramms deniert. [#]unverandertlat. e#; t:=x 2CT(#)sgn()ftg 1.2.2Beispiel:Sei#=(2;2)und=(3;2;2). FurdenRestdiesesKapitelssei(#;)immereinPaarvonPartitionenfurn. Furt= iste#; t2m;(2;2;2;1);namlich ftg?f(14)tg?f(25)tg+f(14)(25)tg= ? ? :

12 BilderinderselbenSpalte,sogilt:e#; KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN 1.2.3Korollar:Stehenbeieinem-Tableaut:[]!ninnerhalbvon[#]zweigleiche t=0: 11 Beweis:Esseien(a;b);(a0;b)dieStellenint,andenendiegleichenBilderinderselben Spaltebstehen.Esseij=T(a;b);k=T(a0;b).EsexistierteineUntergruppeHvon Wirhaben CT(#),furdiegilt: 1.2.4Denition:WirdenierendieFunktionsub:n!nwiefolgt: dat=(jk)t. e#; t=x2hsgn()ftg?x2hsgn()f(jk)tg=0; CT(#)=H[H(jk): WirerweiterndieDenitionvonsubaufnnmit sub(s)=r:()r?1 Xk=1k<srXk=1kfuralles2n: Bemerkung:Isti2Seq(!)dannistsub(i)2Seq(). Beweis:Seis2f1;:::;1g.Danngilt0<s1,d.h.sub(s)=1.Desgleichenwird Analogwirdsubauchauf-Tableauxdeniert. sub(i)=(sub(i1);:::;sub(in))furallei=(i1;:::;in)2nn: 2-maldieZweienthaltusw.,d.h.sub(i)2Seq(). DieSequenzienthaltjedesBildausngenaueinmal,sodasub(i)1-maldieEins, einbilds2f1+1;:::;1+2gwegen1<s1+2aufdiezweiabgebildet,usw. 2 Miti=(1;6;4;3;2;5)2Seq(!)istsub(i)=(1;3;2;1;1;2)2Seq().Fur 1.2.6Beispiel: Sei=(3;2;1),dannist sub(1)=sub(2)=sub(3)=1;sub(4)=sub(5)=2undsub(6)=3: t= ;erhaltmansub(t)= :

13 KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN 1.2.7Denitionen: a)wirdenierendieabbildung ;:M;!!M;.Seiftg2Tab(;!),dannist 12 b) D#;;!:=X ;(ftg):=fsub(t)g: c) heit(#;;!)-jamesgewichtsraum. i2seq(!)e#; heit(#;;)-jamesgewichtsraum. D#;;:= ;(D#;;!) Ti 1.2.8Bemerkungen: b)d#;;!entsprichtdemvektorraums#;beijames[2].daruberhinausistd;;! a)dieabbildung ftgexistiertein-tableaut0mitftg=fsub(t0)g: gleichdemspechtmoduls. ;isteink-epimorphismus,dennzujedem-tabloidvominhalt c)esseit:[]!nein-tableau.dannist ;(e#; t)=e#; 1.2.9Beispiel: Diesentsprichtdem#;-Polytabloidzusub(t),dasub(t)=sub(t)fur alle2?n. ;(e#; t)=x 2CT(#)sgn() ;(ftg)=x sub(t);denn Sei=(3;3);=(3;2;1)und!=(16). 2CT(#)sgn()fsub(t)g: Mit#=(2;2)ist Furftg= M;!ist ;(ftg)=111 ;(e#; e#; t= M;: t)= ?211 ; 123? ? ? =e#; : sub(t): 126!=

14 gemacht.voneinersolchenbasisausgehend,kannmaneinerzeugendensystemvon DiefolgendenDenitioneninJames[2]wurdenzurBestimmungderBasisvonD#;;! KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN UnsereAufgabebestehtdarin,dieBasisvonD#;;zubestimmen. 13 D#;;bestimmen Denitionen: b)sein2in;einepartitionvonnundi2seq(),dannwirddiequalitatjedes a)ein?tableaut:[]!nheitstandard,wenndiebilderentlangderzeilen monotonundentlangderspaltenstrengmonotonwachsen. einzelnenbildesvoniwiefolgtdeniert: 1.Alle1'ensindgut. d)durchfolgendekonstruktionwirdeineabbildungvonseq()indiemengeder c)seq(#;)istdiemengederjenigensequenzeni2seq(),beidenenfurjede 2.Furbeliebigesk1isteinauftretendesk+1genaudanngut,wenndie -Tableauxdeniert: positivezahlkdieanzahlderguteniniauftretendenk'smindestens#kist. k+1'enist.andernfallsistdask+1schlecht. Anzahldervorherigengutenk'sechtgroeralsdieAnzahldervorherigen e)wirdeniereneinetotalordnung<tabaufdermengetab(;):esseienftg Seii2Seq().Tiwirdwiefolgtkonstruiert: undft0gzweiverschiedene-tabloidevominhalt,sunds0diejenigentableaux ausftgbzw.ft0g,dieentlangderzeilenmonotonwachsendsind. Esistftg<Tabft0g,wennsindererstenZeilevonunten,indersichsunds0 Istisgut,dannsetzessoweitwiemoglichinderis-tenReihenachlinks.Ist Furjedess=1;:::;n(indieserReihenfolge)fuhrefolgendesdurch: unterscheiden,lexikographischkleineristalss0. isschlecht,dannsoweitwiemoglichnachrechts Beispiel:BeiderfolgendenSequenzwurdenBildermitderQualitat'schlecht' durchxgekennzeichnet: (1;2;x2;3;x3;1;2;3;1;1)2Seq((4;2;2);(4;3;3)),da4gute1'er,2gute2'erund2 gute3'erenthaltensind. maenaus: Seii=(2;1;3;1;2)2Seq((2;1);(2;2;1)).DieKonstruktionvonTisiehtfolgender- (#2;1;3;1;2)7?! 1

15 KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN (2;#1;3;1;2)7?!2 14 (2;1;#3;1;2)7?!2 (2;1;3;#1;2)7?!24 (2;1;3;1;#2)7?!24 1 damiti2seq(#;)tiinnerhalbdes#-diagrammsstandardist. BildeinesgutenElementessteht,dasinderSequenzvorrauftritt.Somitgiltallgemein, Sei=(3;2)und=(2;2;1).Die-TabloidevomInhalthabenfolgendeOrdnung: DieseKonstruktionsorgtdafur,daeinBildeinesgutenElementesrimmerunterdem <Tab123 12<Tab122 13<Tab Bemerkung:JamesbeweistinseinerArbeit,da 22<Tab112 EinErzeugendensystemfurD#;;istalsowegen einek-basisfurd#;;!ist. fe#; Tiji2Seq(#;)g ;(e#; t)=e#; sub(t)(siehebemerkung1.2.8)diemenge Lemma:Seii2Seq(#;),=(k;k+1);(k2f1;:::;n?1g)eineTranspo- Isti2Seq(#;),danngilte#; sitionaus?(i)mitik<ik+1 DiesesErzeugendensystemgilteszuminimieren. fe#; sub(ti)ji2seq(#;)g: 23: fallsi62seq(#;),habenwire#; beitiindieil-tezeilediezahlleingetragen,diedannzusub(l)wird.dasbedeutet, sub(ti)=e#; dadieersten1stellenvoniaufdie1,diedarauolgende2stellenvoniaufdie2 Beweis:WirbetrachtendieAbbildungi7!sub(Ti).Furdiel-teStellevoniwird sub(ti)=0: sub(t(i)); abgebildetwerdenundsoweiter. WirunterscheidenzweiFalle:

16 KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN i)durchdietranspositionandertsichdiequalitatdesbildesderstellek+1nicht. Diesistnurmoglich,wennauchi2Seq(#;).Da2?,liegendieStellenk undk+1imselben-block,siewerdenfolglichunabhangigvonaufdieselbe 15 ii)dietranspositionandertdiequalitatdesbildesderstellek+1. Zahlabgebildet,d.h.sub(Ti)=sub(T(i)). DamitdieseWirkunghatmussenfolgendeBedingungengelten: Istnuni2Seq(#;),sostimmeninnerhalbvon[#]sub(Ti)undsub(T(i)) ik+1=ik+1. diezeilenalsmengensindgleich,dadiequalitateineselementesinibeider DieAnzahlpderbiszurStellek?1iniauftretenden'guten'ik'sistgleich KonstruktionvonTikeinenEinuaufdieZeilen,sondernnuraufdieSpalten uberein.auerhalbvon[#]konnensichdiesetableauxzwarunterscheiden,aber deranzahlderbiszurstellek?1auftretenden'guten'ik+1'en. hat. InisinddieStellenkundk+1'gut'. Die#;-Polytabloidevont=sub(Ti)undt0=sub(T(i))sindgleich,da beitabloidendiereihenfolgeinnerhalbderzeilenkeinerollespieltundtundt0 Isti62Seq(#;),soliegtdasBildderStellek+1voniinTiinnerhalbvon [#].SindwiralsobeiderKonstruktionvonTianderStellek?1angelangt, habenwirdiesituation,dainderzeileikundinderzeileik+1genaudieersten pstellenbelegtsind.somitstehenkundk+1intiinderspaltepinden innerhalbvon[#]ubereinstimmen. Zeilenikundik+1.kundk+1sindimgleichen-Blockvoni,dasbedeutetfur Denition:Seq(#;)wirddeniertalsdieMengevonSequenzeni2 sub(ti),dainnerhalbvon[#]zweigleichebildersub(k)stehen.somitfolgt Seq(#;),furdieientlangder-Blockemonotonfallendist. mitkorollar1.2.3: e#; sub(ti)=0: 2

17 KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN Satz:DieMengefe#; sub(ti)ji2seq(#;)g 16 Beweis: isteinek-basisvond#;;. i)erzeugendensystem: Esseii2Seq(0;).WirwahleneineTransposition1=(k;k+1)2?,mit ii)lineareunabhangigkeit: ik<ik+1.isti162seq(0;)soistnachlemma1.2.13e#; Andernfallsiste#; 1)2?wahlenmitjk0<jk0+1unddasVerfahrenwiederholen.Nachendlichvielen Wiederholungenerhaltenwirentwederi2Seq(#;),wobei=12:::,oder e#; sub(ti)=0: sub(ti)=e#; sub(t(i1))undwirkonnenfurj=i1ein2=(k0;k0+ sub(ti)=0. Seieni;j2Seq(#;),i6=j.j62?(i),daiundjentlangder-Blocke Wirdurfenannehmen,daix>jx. absteigendsortiertsind. EsseixdieersteStelle,andersichiundjunterscheiden.xseiimk-ten-Block. SindwirbeiderKonstruktionvonsub(Ti)anderStellexangelangt,tragenwir inderzeileixsub(x)=kein.beijstehenabderstelleximk-ten-blocknur Bilder,diekleineralsixsind,d.h.dainsub(Ti)inderZeileixmindestens einmalmehrkstehtalsinsub(tj).wirhabenalso: Esseit=sub(Ti).ImTragervone#; groteelementinderordnung<tab,datstandardin[#]. EsseijSeq(#;)j=m.i1;:::;imseiendieSequenzenSeq(#;). OhneBeschrankungderAllgemeinheitkonnenwirannehmen,da i;j2seq(0;);i6=j=)fsub(ti)g6=fsub(tj)g: fsub(tir)g<tabfsub(tis)g;fallsr<s. sub(ti)miti2seq(#;)istftgdas WirbetrachtendieGleichung Dannistkm=0,dafsub(Tim)gimTragervone# auchkm?1=km?2=:::=k1=0. keinempolytabloidsonst.mitdergleichenargumentationkannmanzeigen,da k1e#; sub(ti1)+:::+kme#; sub(tim)=0: sub(tim)enthaltenist,aberin 2

18 KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN Korollar:Seienn;n02INmitn0n,#`n0,(#;)einPaarvonPartitionen furnundeinepartitionvonninhochstensnteile.seieinepartitionvonn0?1, 17 Esgilt a) =(#1;:::;#i?1;#i?1;#i+1;:::);#i1: Beweis: b) a)wirzeigen,daeinbeliebigespolytabloidausd#;;!ind;;!enthaltenist.sei D#;;!D;;!; t=ti,i2seq(!)undf1;:::;kgeinetransversalederrechtsnebenklassenvon CT()inCT(#).WirhabenD#;;D;;: =X 2CT()sgn(1)f1tg+:::+X e#; t=x 2CT(#)sgn()ftg= b)folgtausa)wegend#;;= =sgn(1)e; ;(D#;;!) 1t+:::+sgn(k)e; 2CT()sgn(k)fktg= ;(D;;!)=D;;: kt2d;;!: 2

19 KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN ZurErzeugungeinerBasisvonM;gehtmanwiefolgtvor:Mandurchlauftdie- 1.3AllgorithmenzuJamesGewichtsraumen 18 Monomeci;jmiti2Seq();j2Seq(),furdiemanleichtdiezugehorigen-Tabloide SequenzeninlexikographischerReihenfolgeundspeichertnurdiejenigen,dieentlang 1.3.1Beispiel:=(3;2),=(2;2;1) vominhaltermittelnkann,diedanneinebasisvonm;bilden(siehekapitel1.1). der-blockemonotonfallendsind.soerhaltmanausjedem?-orbitgenaueinen Reprasentanten.NachBemerkung1.1.23erhaltmanaufdieseWeisealleverschiedenen m1=j11j21j2j=c(1;1;2;1;2);(1;1;2;2;3) m2=j11j22j1j=c(1;1;2;2;1);(1;1;2;2;3) (j11j12j2j=m1) m3=j21j11j2j=c(2;1;1;1;2);(1;1;2;2;3) (j12j11j2j=m3) (j12j12j1j=m4) (j12j21j2j=m4) alsodiessindalleverschiedenenmonomeci;mmiti2seq().diebasisvonm;ist c(1;1;2;1;2);(1;1;2;2;3)=c(1;1;1;2;2);(1;1;2;2;3)7!112 m4=j21j21j1j=c(2;1;2;1;1);(1;1;2;2;3) m5=j22j11j1j=c(2;2;1;1;1);(1;1;2;2;3) (j21j12j1j=m4) c(1;1;2;2;1);(1;1;2;2;3)=c(1;1;1;2;2);(1;1;3;2;2)7!113 c(2;1;1;1;2);(1;1;2;2;3)=c(1;1;1;2;2);(1;2;2;1;3)7!122 23=:b1 c(2;1;2;1;1);(1;1;2;2;3)=c(1;1;1;2;2);(1;2;3;1;2)7!123 22=:b2 c(2;2;1;1;1);(1;1;2;2;3)=c(1;1;1;2;2);(2;2;3;1;1)7!223 13=:b3 12=:b4 11=:b5

20 KAPITEL1.DARSTELLUNGSTHEORETISCHEGRUNDLAGEN monotonfallendsind,unduberpruft,obdieseinseq(#;)undsomitinseq(#;) ManbetrachtetalsonurdiejenigenSequenzenausSeq(),dieentlangder-Blocke FurdieErzeugungeinerBasisvonD#;;benotigenwirSequenzenausSeq(#;). 19 m1;m2;m3;m4undm5ausdemvorherigembeispielbetrachtenunddiesealssequenzen enthaltensind Beispiel: auassen: Essei;wieobenund#=(2;1).WirmussennurdieMonomein2.Normalform (1;1;2;1;2)2Seq(#;) DieBasisvonD#;;istalso(1;1;2;2;1)2Seq(#;) (2;1;1;1;2)2Seq(#;) (2;1;2;1;1)2Seq(#;) sub(t(1;1;2;1;2))=112 (2;2;1;1;1)62Seq(#;) sub(t(1;1;2;2;1))=113 sub(t(2;1;1;1;2))=122 23?212 22?213 31?322 MonomsummendiefolgendeForm: UnterVerwendungder2.NormalformhabendiedenPolytabloidenentsprechenden e#; sub(t(2;1;2;1;1))=123 21?223 sub(t(1;1;2;1;2))7!j11j21j2j?j21j11j2j sub(t(1;1;2;2;1))7!j11j22j1j?j21j21j1j 11 implementiertundkonnenjederzeitzurverfugunggestelltwerden. DieAlgorithmenzurErmittlungderBasenvonM;undD#;;,wurdeninC e#; sub(t(2;1;1;1;2))7!j21j11j2j?j22j11j1j sub(t(2;1;2;1;1))7!j21j21j1j?j22j11j1j

21 Codierungstheoretische Kapitel2 IndiesemKapitelwerdenzunachstdieallgemeinenGrundkonzeptederallgebraischen Anwendungen 2.1EinfuhrunginalgebraischeCodierungstheorie Codierungungstheorievorgestellt,dabeiwerdenweitgehendDenitionenvonHill[1] verwendet.dannbefassenwirunsmitlinearencodesuberendlichenkorpern. KanalsentstehendenUbertragungsfehlerzuerkennenundwennmoglich,zukorrigieren. habenfolgendesmodel: ZielderCodierungstheorieistes,Nachrichtenmoglichstfehlerfreizuubertragen.Wir 2.1.1Denitionen: QuelleNachricht?!CodiererCodewort?!Rauschen KanalEmpfangenes #?!Decodiererdecodierte a)eineendlichenichtleeremengea=fa1;a2;:::;akg DieAufgabederCodierungstheoriebestehtnundarin,diedurchdasRauschendes Wort?!Senke b)eineendlichefolgevonbuchstaben heitalphabet,ihreelementesindbuchstaben. c)eincodeuberaisteinenichtleereteilmengevonan. heitwortderlangen.diemengeallerworterderlangenwirdmitan bezeichnet. x=(x1;x2;:::;xn);xi2a,furallei2n 20

22 KAPITEL2.CODIERUNGSTHEORETISCHEANWENDUNGEN UmUbertragungsfehlernaheruntersuchenzukonnen,mussenwirsiemebarmachen Denitionen: 21 b)seicaneincode.dannbezeichnetdiezahl a)dieabbildungd:anan!ir, heitderhamming-abstandzwischenxundy. d(x;y)=jfi2njxi6=yigj;x=(x1;:::;xn);y=(y1;:::;yn)2an 2.1.3Lemma:DerHamming-AbstandisteineMetrik,d.h. dieminimaldistanzvonc. dc=minfd(u;v)ju;v2c;u6=vg b)d(x;y)=d(y;x),furallex;y2an. a)d(x;y)=0,genaudann,wennx=y. d(x;y)gibtdiekleinsteanzahlderzuanderndenbuchstabenan,wolltemanxzuy Beweis:a)undb)sindklar,zuc): machen.mankannaberauchmitd(x;z)+d(z;y)anderungenzunachstxinzund dannzinyverwandeln.diezahlderanderungenistdannmindestensd(x;y). c)d(x;y)d(x;z)+d(z;y),furallex;y;z2an Satz:SeiCAneinCode. beschreibtd(x;y)dieanzahlderaufgetretenenfehler. a)ckannbiszusfehlererkennen,wenndcs+1. WenneinCodewortxgesendetwurdeundderVektoryempfangenwurde,dann 2 Beweis: b)ckannbiszutfehlerkorrigieren,wenndc2t+1. a)seidcs+1undxeincodewort,beidessenubertragunghochstenssfehler seinundsokonneneventuelleubertragungfehlererkanntwerden. aufgetretensind.derempfangenevektorkannkeinvonxverschiedenescodewort

23 KAPITEL2.CODIERUNGSTHEORETISCHEANWENDUNGEN b)seidc2t+1,xdasgesendetecodewortundyderempfangenevektor,dersich vonxinhochstenststellenunterscheidet,d.h.d(x;y)t.istx0einanderes Codewortalsx,dannistd(x0;y)t+1,daandernfallsd(x0;x)d(x;y)+ 22 yjetztalsx,hatmaneventuellaufgetretenefehlerkorrigiert. Dasbedeutet,daxdasCodewortist,daszuyamnachstenist.Decodiertman d(x0;y)2tgeltenwurde,waseinwiderspruchzudc2t+1ist. distanzistdrei,dercodeistalsoinderlagezweifehlerzuerkennenundeinenfehler 2.1.5Beispiel:SeiA=f0;1g;n=9.DieNachrichtenseienTripel(x1;x2;x3);xi2 zukorrigieren. CodewortfurdieNachricht(x1;x2;x3)ist(x1;x2;x3;x1;x2;x3;x1;x2;x3).DieMinimal- A;i=1;2;3.DieCodierungbestehedarin,die3-Tupeldreimalzuwiederholen,d.h.das 2 DerDecodiererkann,wennhochstenseinFehlerauftritt,diesenkorrigieren.Wareder empfangenevektoraberz.b.(1,0,0,1,0,0,1,0,1)gewesen,d.h.eswarenzweifehleraufgetreten,sohattederdecodiererzwarerkannt,dadieubertragungfehlerhaftwar,aber Nachricht=(1;0;1)?! (1;0;1;1;0;0;1;0;1)(1;0;1;1;0;1;1;0;1)7!(1;0;1)?!empfangene (1;0;1)7!(1;0;1;1;0;1;1;0;1)?! Codierer (1;0;1;1;0;#0;1;0;1)?! Nachricht=(1;0;1) Rauschen behandelt Denitionen:Sein2IN. qelementen,bezeichnetmitfq.endlichekorperwerdenim3.kapitelausfuhrlich ImWeiterenbesteheunserAlphabetAausdenElementeneinesendlichenKorpersmit erhatte(1,0,0)alsnachrichtweitergegeben. b)ein(linearer)[n,k]-codeuberfqisteink-dimensionalerunterraumeinesndimensionalenfq-vektorraums. a)einlinearercodeuberfqisteinunterraumeinesfq-vektorraums. ImBeispielhandelteessichalsoumeinenlinearen[9,3,3]-CodeuberF2. c)ein(linearer)[n,k,d]-codeuberfqisteink-dimensionalerunterraumeinesndimensionalenfq-vektorraumsmitminimaldistanzd. ImAllgemeinenwirdeseinZielderCodierungstheoriesein,[n,k,d]-Codesmitkleinem n,moglichstgroemkundmoglichstgroemdzunden Denition:Einekn-Matrix,derenZeilenvektoreneineBasisfureinenlinearen [n;k]-codedarstellen,heitgeneratormatrixzudiesemcode.

24 2.1.8Beispiel:EineGeneratormatrixzum[9,3,3]-CodeausBeispiel1istz.B. KAPITEL2.CODIERUNGSTHEORETISCHEANWENDUNGEN mittelsmultiplikationcodiertwerdenkann: DieseMatrixhatdaruberhinausdieEigenschaft,dadiezuubertragendeNachricht (x1;x2;x3) =(x1;x2;x3;x1;x2;x3;x1;x2;x3): : G0,dieausGmitHilfefolgenderOperationenerzeugtwerdenkann: 2.1.9Bemerkung:IstGeineGeneratormatrixvomCodeC,dannauchjedeMatrix AllgemeinwerdeninderPraxisMatrizenalsCodiererlinearerCodesverwendet. (Z2)MultiplikationeinerZeilemiteinemElementg2Fqnf0g. (Z1)PermutationenderZeilen Denitionen: Beweis:NachjederdieserOperationenspannendieZeilenvektorenimmernochden UnterraumCauf. (Z3)Additiondesg-facheneinerZeilezueineranderen,wobeig2Fq. a)zweilinearecodesc1undc2heienaquivalent,wenneinegeneratormatrix vonc1durchfolgendeoperationenineinegeneratormatrixvonc2ubergefuhrt werdenkann: 2 b)einegeneratormatrixgeines[n,k]-codesheitinstandardform,wenn (S1)PermutationderSpalten. (S2)MultiplikationeinerSpaltemiteinemElementg2Fqnf0g. wobeiikdiekk-einheitsmatrixistundaeinekn?k-matrix. G=[Ik;A];

25 Code,y=(y1;:::;yk);y1;:::;yk2FqeinVektormiteinerzucodierendenNachricht, wennmanmithilfedieserdiecodierungvonnachrichtenvornimmt.seicein[n;k]- KAPITEL2.CODIERUNGSTHEORETISCHEANWENDUNGEN DiebesondereBedeutungderStandardformvonGeneratormatrizenwirddeutlich, 24 Codevektory0wegen G=[Ik;A]dieGeneratormatrix,mitdercodiertwird.Dannenthaltderzuygehorige indenerstenkeintragendienachricht.alleweitereneintragesindprufeintrage,mit derenhilfeman,fallsfehlerbeiderubertragungauftreten,dieseaufspurenundgegebenenfallskorrigierenkann Bemerkungen: y0=y[ik;a] b)jedegeneratormatrixkannmitdenoperationen(z1),(z2),(z3),(s1)und(s2) a)aquivalentecodesstimmeninihrencodierungstheoretischeneigenschaften a)esseienz1;:::;zkdiezeilenvektorenvonc.(s1)bedeutetfurdiezeilenvektoren,daihreeintragealleindergleichenweisepermutiertwerden.beieinem Beweis: instandardformgebrachtwerden. uberein,d.h.siehabendiegleichedimensionunddiegleicheminimaldistanz. beliebigencodevektorxwerdensomitnurdieeintragepermutiert,d.h.weder b)mangehtwiefolgtvor: DimensionnochMinimaldistanzverandert. (S2)andertnichtdenRangvonG,d.h.dieDimensionenaquivalenterCodessind CodevektorenundsomitdieMinimaldistanzbleibendadurchunbeeinut. ManpermutiertdieSpalten,bisindererstenZeilederersteEintragverschieden gleich.(s2)entsprichtbeidencodevektoreneinermultiplikationeineseintrages von0ist.manteiltdieerstezeiledurchdieseneintragundsetztihnsomit miteinemvon0verschiedenemelementausfq.derhamming-abstandbeliebiger auf1.alleweitereneintragedieserspaltewerdenauf0gebracht,indemman DiesesVerfahrenwiederholtmanfurdieubrigenZeilen2;3;:::;kunderhaltso entsprechendevielfachedererstenzeilevondenubrigenzeilenabzieht Denitionen: ZurAngabeeineseinfachenDecodierungsverfahrenssindfolgendeDenitionennotig. a)sein2in,x2fqneinvektor.dasgewichtwgt(x)wirddeniertalsdieanzahl Wirhabengesehen,wiemitHilfeeinerGeneratormatrixNachrichtencodiertwerden. diegewunschteform. 2 dervon0verschiedeneneintragevonx.

26 KAPITEL2.CODIERUNGSTHEORETISCHEANWENDUNGEN b)sein2in,ceinlinearer[n;k]-codeuberfq.eine(slepian)standardmatrix SCzuCisteineqn?kqn-Matrix,diewiefolgtkonstruiertwird: 25 iii)furjedespaltetragemanindiezweitezeilev2+w,wobeiwdervektoraus iv)dieswiederholemanfurdiedrittezeilemitv32fqnn(c[(v2+c))usw. ii)manwahleeinenvektorv22fqnnc,derminimalesgewichthat. i)manschreibtindieerstezeileallecodeworterausc,wobeimanmitdem Codewort0beginnt. dererstenzeileist.

27 2.1.13Bemerkung:JederVektorausFqnkommtinSCgenaueinmalvor,dadie Nebenklassena+Cundb+Cfurb62a+CdisjunktsindundFqn=(0+C)[(v1+ KAPITEL2.CODIERUNGSTHEORETISCHEANWENDUNGEN C)[(v2+C)+:::: 26 derubertragungsfehlergeringist.mangehtmiteinemempfangenenvektorywiefolgt FurdieMaximum-LikelihoodDecodierunggehtmandavonaus,dasdieAnzahl vor:ermittlungderspalteivonsc,inderysteht. istx=y?vj.umeincodewortzuerhalten,mumanvonyeinenvektorv02vj+c Esgilt: abziehen.vjistinvj+ceinvektorvonminimalemgewicht,esgiltalso Beweis:ysteheinderj-tenZeilevonSC,d.h.y2vj+C.NachKonstruktionvonSC DenVektorxausgeben,derinSCindererstenZeileinderSpalteisteht. d(y;x0)=wgt(y?x0)y?x02vj+c d(y;x0)d(y;x)furallex02c Beispiel:Wirbetrachtenden[6,2,3]-CodeCuberF2mitderGeneratormatrix wgt(vj)=d(y;x): DieerstendreiZeileneinerStandardmatrixzuCsindz.B. G=" #: 2 mitdemgeringstenabstandzuy. IsteinempfangerVektorz.B.y=(1;1;0;1;0;1),soist(0;1;0;1;0;1)dasCodewort (0;0;0;0;0;0)(1;0;1;0;1;0)(0;1;0;1;0;1)(1;1;1;1;1;1) (1;0;0;0;0;0)(0;0;1;0;1;0)(1;1;0;1;0;1)(0;1;1;1;1;1) (1;1;0;0;0;0)(0;1;1;0;1;0)(1;0;0;1;0;1)(0;0;1;1;1;1)

H2 1862 mm. H1 1861 mm

H2 1862 mm. H1 1861 mm 1747 mm 4157 mm H2 1862 mm H1 1861 mm L1 4418 mm L2 4818 mm H2 2280-2389 mm H1 1922-2020 mm L1 4972 mm L2 5339 mm H3 2670-2789 mm H2 2477-2550 mm L2 5531 mm L3 5981 mm L4 6704 mm H1 2176-2219 mm L1 5205

Mehr

Rekursionen (Teschl/Teschl 8.1-8.2)

Rekursionen (Teschl/Teschl 8.1-8.2) Rekursionen (Teschl/Teschl 8.1-8.2) Eine Rekursion kter Ordnung für k N ist eine Folge x 1, x 2, x 3,... deniert durch eine Rekursionsvorschrift x n = f n (x n 1,..., x n k ) für n > k, d. h. jedes Folgenglied

Mehr

Didaktik der Algebra Jürgen Roth Didaktik der Algebra 4.1

Didaktik der Algebra Jürgen Roth Didaktik der Algebra 4.1 Didaktik der Algebra 4.1 Didaktik der Algebra Didaktik der Algebra 4.2 Inhalte Didaktik der Algebra 1 Ziele und Inhalte 2 Terme 3 Funktionen 4 Gleichungen Didaktik der Algebra 4.3 Didaktik der Algebra

Mehr

UbungenzurAnalysis2 Prof.Dr.Kohnen WS1996/97 Dr.O.Delzeith

UbungenzurAnalysis2 Prof.Dr.Kohnen WS1996/97 Dr.O.Delzeith UbungenzurAnalysis2 Prof.Dr.Kohnen WS1996/97 Dr.O.Delzeith 1.(i)EntscheidenSie,obdieFunktion (ii)berechnensiedieintegrale impunktx0=0dierenzierbarist.bestimmensieggfs.dieableitungf0(x0). (a)1 Z0xf:(R!R

Mehr

15 2,835. 63843 Niedernberg, Nordring/Industriegebiet, Telefon (0 60 28) 9 70 70, Telefax (0 60 28) 97 07 20

15 2,835. 63843 Niedernberg, Nordring/Industriegebiet, Telefon (0 60 28) 9 70 70, Telefax (0 60 28) 97 07 20 Aluminium-Flachstange kg/mtr 10 x 2 0,054 3 0,081 4 0,108 5 0,135 6 0,162 8 0,216 12 x 3 0,097 5 0,162 6 0,200 8 0,259 15 x 2 0,081 3 0,121 4 0,162 5 0,202 6 0,243 8 0,324 10 0,405 20 x 2 0,108 3 0,162

Mehr

EinfuhrungundGrundlagen Lie-Gruppen HansGeorgFreiermuth HermannSchonecker FlorentineBunke MathiasSchulze NorbertGob Wintersemester1996/1997 Sommersemester1996 1 Inhaltsverzeichnis 1Lie-Gruppen:DenitionundBeispiele

Mehr

Jurgen Muller Analysis I-IV

Jurgen Muller Analysis I-IV Jurgen Muller Analysis I-IV Skriptum zur Vorlesung Wintersemester 5/6 bis Sommersemester 7 Universitat Trier Fachbereich IV Mathematik/Analysis Dank an Elke Gawronski und Judith Wahlen fur die Mithilfe

Mehr

Höhere Mathematik 3. Apl. Prof. Dr. Norbert Knarr. Wintersemester 2015/16. FB Mathematik

Höhere Mathematik 3. Apl. Prof. Dr. Norbert Knarr. Wintersemester 2015/16. FB Mathematik Höhere Mathematik 3 Apl. Prof. Dr. Norbert Knarr FB Mathematik Wintersemester 2015/16 4. Homogene lineare Dierentialgleichungen 4.1. Grundbegrie 4.1.1. Denition. Es sei J R ein Intervall und a 0 ; : :

Mehr

TechnischeUniversitatMunchen ZentrumMathematik Kreditrisiko ModelleundDerivatebewertung Diplomarbeit AlexanderSzimayer von Abgabetermin:12.Mai1999 Betreuer: Themensteller:Prof.Dr.C.Kluppelberg Dr.M.Borkovec

Mehr

Sicherheitsanalyse und Implementierung einer hierarchischen Zugriffskontrolle für sichere Gruppenkommunikation auf Basis des chinesischen Restesatzes

Sicherheitsanalyse und Implementierung einer hierarchischen Zugriffskontrolle für sichere Gruppenkommunikation auf Basis des chinesischen Restesatzes Inhalt Sicherheitsanalyse und Implementierung einer hierarchischen Zugriffskontrolle für sichere Gruppenkommunikation auf Basis des chinesischen Restesatzes Masterarbeit von Mark Manulis CRTHACS Chinese

Mehr

Veröffentlichung der Besteuerungsgrundlagen gemäß 5 InvStG für

Veröffentlichung der Besteuerungsgrundlagen gemäß 5 InvStG für (alle Angaben je 1 Anteil und in EUR) Veröffentlichung der Besteuerungsgrundlagen gemäß 5 InvStG für Bantleon Anleihenfonds Bantleon Return Anteilklasse IA (ISIN: LU0109659770) WKN: 615250 für den Zeitraum

Mehr

Komplexität und Komplexitätsklassen

Komplexität und Komplexitätsklassen Dr. Sebastian Bab WiSe 12/13 Theoretische Grundlagen der Informatik für TI Termin: VL 21 vom 21.01.2013 Komplexität und Komplexitätsklassen Die meisten Probleme mit denen wir zu tun haben sind entscheidbar.

Mehr

Vorkurs Informatik Wintersemester 2015/2016. Programmtexte

Vorkurs Informatik Wintersemester 2015/2016. Programmtexte www.vorkurs-informatik.de Vorkurs Informatik Wintersemester 2015/2016 Programmtexte 1 Grundkonzepte der Programmierung Java-Programm zur Suche des Minimums: class ProgrammMinSuche{ int[] a = {11,7,8,3,15,13,9,19,18,10,4;

Mehr

356 Stand: 03/2016. 5,5Jx15 42 VA/HA 165 VR 15 Pirelli CN36 N4 - - - 356 C, alle Modelljahre

356 Stand: 03/2016. 5,5Jx15 42 VA/HA 165 VR 15 Pirelli CN36 N4 - - - 356 C, alle Modelljahre 356 Stand: 03/2016 Typ 356 Radgröße 4,5Jx15 42 VA/HA 165 VR 15 Pirelli CN36 N4 - - - 356 B, alle Modelljahre 15 Zoll 356 C, alle Modelljahre 5,5Jx15 42 VA/HA 165 VR 15 Pirelli CN36 N4 - - - 356 C, alle

Mehr

Durchflussmessgeräte SITRANS F

Durchflussmessgeräte SITRANS F SITRANS F O delta p - Drosselgeräte Anwendungsbereich Geeignet für nichtaggressive und aggressive Gase, Dämpfe und Flüssigkeiten; -60 bis +00 C. Aufbau Zwei Fassungsringe mit auswechselbarer Messscheibe

Mehr

Übungen für Woche 10

Übungen für Woche 10 Übungen für Woche 10 Martin Rubey 12. Januar 2011 Die folgenden Übungen sollen den Umgang mit Backtracking und kombinatorischen Spezies näherbringen. Genaue Hinweise gibt es erst auf Seite 5. Zur Erinnerung:

Mehr

Angewandte Umweltsystemanalyse: Finite-Elemente-Methode (FEM)

Angewandte Umweltsystemanalyse: Finite-Elemente-Methode (FEM) Angewandte Umweltsystemanalyse: Finite-Elemente-Methode (FEM) Prof. Dr.-Ing. habil. Olaf Kolditz 1 Helmholtz Centre for Environmental Research UFZ, Leipzig 2 Technische Universität Dresden TUD, Dresden

Mehr

Taylorentwicklung der k ten Dimension

Taylorentwicklung der k ten Dimension Taylorentwicklung der k ten Dimension 1.) Taylorentwicklung... 2 1.1.) Vorgehenesweise... 2 1.2.) Beispiel: f ((x, y)) = e x2 +y 2 8x 2 4y 4... 3 2.) Realisierung des Algorithmus im CAS Sage Math... 5

Mehr

Der Zwei-Quadrate-Satz von Fermat

Der Zwei-Quadrate-Satz von Fermat Der Zwei-Quadrate-Satz von Fermat Proseminar: Das BUCH der Beweise Fridtjof Schulte Steinberg Institut für Informatik Humboldt-Universität zu Berlin 29.November 2012 1 / 20 Allgemeines Pierre de Fermat

Mehr

HUMBOLDT-UNIVERSITATZUBERLIN INSTITUTFURINFORMATIK D-10099BERLIN

HUMBOLDT-UNIVERSITATZUBERLIN INSTITUTFURINFORMATIK D-10099BERLIN HUMBOLDT-UNIVERSITATZUBERLIN INSTITUTFURINFORMATIK D-10099BERLIN GraphenundAlgorithmen Einfuhrung Th.Emden-Weinert, S.Hougardy, H.J.Promel, B.Kreuter, A.Steger c13.september1996 VorlaugeFassung Inhaltsverzeichnis

Mehr

Differenzengleichungen. und Polynome

Differenzengleichungen. und Polynome Lineare Differenzengleichungen und Polynome Franz Pauer Institut für Mathematik, Universität Innsbruck Technikerstr. 13/7, A-600 Innsbruck, Österreich franz.pauer@uibk.ac.at 1 Einleitung Mit linearen Differenzengleichungen

Mehr

Seite Dd-1 Dd-2 1C Dd-2. Dichtkegel mit Überwurfmutter und O-Ring schwere Reihe. 90 Bogen. Seite Dd-3 Dd-4 B2 Dd-4. Dichtkopf mit BSP-Überwurfmutter

Seite Dd-1 Dd-2 1C Dd-2. Dichtkegel mit Überwurfmutter und O-Ring schwere Reihe. 90 Bogen. Seite Dd-3 Dd-4 B2 Dd-4. Dichtkopf mit BSP-Überwurfmutter Armaturen-Übersicht DIN Metrisch C9 Dd-1 Dichtkegel mit und O-Ring schwere Reihe ISO 12151-2-SWS-S DKOS 0C Dd-1 Dichtkegel mit und O-Ring schwere Reihe ISO 12151-2 SWE 45 -S DKOS 45 Seite Dd-1 Dd-2 1C

Mehr

7 Die Determinante einer Matrix

7 Die Determinante einer Matrix 7 Die Determinante einer Matrix ( ) a11 a Die Determinante einer 2 2 Matrix A = 12 ist erklärt als a 21 a 22 det A := a 11 a 22 a 12 a 21 Es ist S 2 = { id, τ}, τ = (1, 2) und sign (id) = 1, sign (τ) =

Mehr

Mathematischer Vorkurs

Mathematischer Vorkurs Mathematischer Vorkurs Dr. Agnes Lamacz Mathematischer Vorkurs TU Dortmund Seite 1 / 170 Kapitel 11 Aussageformen Mathematischer Vorkurs TU Dortmund Seite 103 / 170 11.1 Denition: Aussageformen Eine Aussageform

Mehr

Beleuchtungen für die industrielle Bildverarbeitung

Beleuchtungen für die industrielle Bildverarbeitung Beleuchtungen für die industrielle Bildverarbeitung Teilkatalog Domlichter Version: 01/2013 SPECK SENSORSYSTEME GmbH www.led-beleuchtungen.com www.optosensoric.de Göschwitzer Str. 32 D-07745 Jena Fax.:

Mehr

Leseprobe zu. Bittner/Clausnitzer/Föhlisch Das neue Verbrauchervertragsrecht

Leseprobe zu. Bittner/Clausnitzer/Föhlisch Das neue Verbrauchervertragsrecht Leseprobe zu Bittner/Clausnitzer/Föhlisch Das neue Verbrauchervertragsrecht Leitfaden für die Beratungspraxis 2014, ca. 272 Seiten, Monographie / Praxisbuch / Ratgeber ISBN 978 3 504 47107 1 39,80 Seite

Mehr

Beispiel vor dem Beweis:

Beispiel vor dem Beweis: Beispiel vor dem Beweis: Beispiel vor dem Beweis: A = ¼3 6 2 3 11 2½ Beispiel vor dem Beweis: 2½ 2½ ¼3 6 A = 2 3 11 311 E 12 A = 3 6 Beispiel vor dem Beweis: 2½ 2½ ¼3 6 A = 2 3 11 311 E 12 A = 3 6 3 11

Mehr

Oliver Marc Hartwich. Wettbewerb, Werbung und Recht

Oliver Marc Hartwich. Wettbewerb, Werbung und Recht Oliver Marc Hartwich Wettbewerb, Werbung und Recht Eine Kritik des Rechts des unlauteren Wettbewerbs aus historischer, rechtsvergleichender und ökonomischer Sicht zusammengeführt am Beispiel der vergleichenden

Mehr

Programmieren in C. Rekursive Funktionen. Prof. Dr. Nikolaus Wulff

Programmieren in C. Rekursive Funktionen. Prof. Dr. Nikolaus Wulff Programmieren in C Rekursive Funktionen Prof. Dr. Nikolaus Wulff Rekursive Funktionen Jede C Funktion besitzt ihren eigenen lokalen Satz an Variablen. Dies bietet ganze neue Möglichkeiten Funktionen zu

Mehr

Einführung in die Kodierungstheorie

Einführung in die Kodierungstheorie Einführung in die Kodierungstheorie Einführung Vorgehen Beispiele Definitionen (Code, Codewort, Alphabet, Länge) Hamming-Distanz Definitionen (Äquivalenz, Coderate, ) Singleton-Schranke Lineare Codes Hamming-Gewicht

Mehr

BADEN-WÜRTTEMBERG. Prüfung der Fachhochschulreife

BADEN-WÜRTTEMBERG. Prüfung der Fachhochschulreife MINISTERIUM FÜR KULTUS, JUGEND UND SPORT BADEN-WÜRTTEMBERG Prüfung der Fachhochschulreife an Berufskollegs zum Erwerb der Fachhochschulreife u.a. I Prüfungsfach I Mathematik Püfungstag 03. Juni 005 Bearbeitungszeit

Mehr

Austausch- bzw. Übergangsprozesse und Gleichgewichtsverteilungen

Austausch- bzw. Übergangsprozesse und Gleichgewichtsverteilungen Austausch- bzw. Übergangsrozesse und Gleichgewichtsverteilungen Wir betrachten ein System mit verschiedenen Zuständen, zwischen denen ein Austausch stattfinden kann. Etwa soziale Schichten in einer Gesellschaft:

Mehr

Lineare Gleichungssysteme

Lineare Gleichungssysteme Lineare Gleichungssysteme Sei K ein Körper, a ij K für 1 i m, 1 j n. Weiters seien b 1,..., b m K. Dann heißt a 11 x 1 + a 12 x 2 +... + a 1n x n = b 1 a 21 x 1 + a 22 x 2 +... + a 2n x n = b 2... a m1

Mehr

Ergänzungen zur Analysis I

Ergänzungen zur Analysis I 537. Ergänzungsstunde Logik, Mengen Ergänzungen zur Analysis I Die Behauptungen in Satz 0.2 über die Verknüpfung von Mengen werden auf die entsprechenden Regelnfür die Verknüpfung von Aussagen zurückgeführt.

Mehr

Praxisorientierte Einführung in C++ Lektion: "Die Compiler-Chain (Vom Quellcode zum ausführbaren Programm)"

Praxisorientierte Einführung in C++ Lektion: Die Compiler-Chain (Vom Quellcode zum ausführbaren Programm) Praxisorientierte Einführung in C++ Lektion: "Die Compiler-Chain (Vom Quellcode zum ausführbaren Programm)" Christof Elbrechter Neuroinformatics Group, CITEC April 24, 2014 Christof Elbrechter Praxisorientierte

Mehr

Weiterbildung für Ingenieure Numerische Methoden für Differentialgleichungen Prinzipien und Praxis Taubert, Heitmann Universität Hamburg WS03/04

Weiterbildung für Ingenieure Numerische Methoden für Differentialgleichungen Prinzipien und Praxis Taubert, Heitmann Universität Hamburg WS03/04 Weiterbildung für Ingenieure Numerische Methoden für Differentialgleichungen Prinzipien und Praxis Taubert, Heitmann Universität Hamburg WS03/04 Linearisierung 1 K. Taubert LINEARISIERUNG und das VERHALTEN

Mehr

2 Lösungen "Peptide de novo Sequencing"

2 Lösungen Peptide de novo Sequencing Lösungen "Peptide de novo Sequencing". Algorithm : PeptideSequencingOnlySux Input: a spectrum M with array of masses M = {m, m,, m n }, Σ, µ : Σ R >0 Output: the peptide string of the spectrum begin peptide

Mehr

dientdannzurklassikationneuerproblemstellungenunddamitzurbestimmungeinerspeziellsten

dientdannzurklassikationneuerproblemstellungenunddamitzurbestimmungeinerspeziellsten LernenvonAbstraktionshierarchienzurOptimierungderAuswahl vonmaschinellabstrahiertenplanen RalphBergmannundWolfgangWilke FBInformatik-AG-Richter UniversitatKaiserslautern MitHilfevon\Multistrategy"Ansatzen,dieerklarungsbasiertesundinduktivesLernenintegrieren,ist

Mehr

Vorlesung Analysis I / Lehramt

Vorlesung Analysis I / Lehramt Vorlesung Analysis I / Lehramt TU Dortmund, Wintersemester 2012/ 13 Winfried Kaballo Die Vorlesung Analysis I für Lehramtsstudiengänge im Wintersemester 2012/13 an der TU Dortmund basiert auf meinem Buch

Mehr

Wirtschaftsmathematik für International Management (BA) und Betriebswirtschaft (BA)

Wirtschaftsmathematik für International Management (BA) und Betriebswirtschaft (BA) Wirtschftsmthemtik für Interntionl Mngement (BA) und Betriebswirtschft (BA) Wintersemester 2013/14 Stefn Etschberger Hochschule Augsburg Mthemtik: Gliederung 1 Aussgenlogik 2 Linere Algebr 3 Linere

Mehr

Fortgeschrittene Konzepte

Fortgeschrittene Konzepte advanced.nb 1 Fortgeschrittene Konzepte Funktionen und Optionen Optionen in eigenen Funktionsdefinitionen ClearAll"Global " Sin2x Sin3x PlotSinx,,,x, 0, 2Π 2 3 1.0 0.5 1 2 3 4 5 6 0.5 1.0 advanced.nb 2

Mehr

Ringe und Moduln. ausgearbeitet von. Corinna Dohle Matrikelnummer 6299128 corinna@math.upb.de

Ringe und Moduln. ausgearbeitet von. Corinna Dohle Matrikelnummer 6299128 corinna@math.upb.de Ringe und Moduln ausgearbeitet von Corinna Dohle Matrikelnummer 6299128 corinna@math.upb.de Seminar Darstellungstheorie Prof. Dr. H. Krause, PD Dr. D. Kussin Wintersemester 2007/2008 Grundlagen 1 Grundlagen

Mehr

Literatur zu geometrischen Konstruktionen

Literatur zu geometrischen Konstruktionen Literatur zu geometrischen Konstruktionen Hadlock, Charles Robert, Field theory and its classical problems. Carus Mathematical Monographs, 19. Mathematical Association of America, Washington, D.C., 1978.

Mehr

Stochastische Eingangsprüfung, 17.05.2008

Stochastische Eingangsprüfung, 17.05.2008 Stochastische Eingangsprüfung, 17.5.8 Wir gehen stets von einem Wahrscheinlichkeitsraum (Ω, A, P) aus. Aufgabe 1 ( Punkte) Sei X : Ω [, ) eine integrierbare Zufallsvariable mit XdP = 1. Sei Q : A R, Q(A)

Mehr

3.2 Black-Scholes Analyse

3.2 Black-Scholes Analyse 3.. BLACK-SCHOLES ANALYSE 39 3. Black-Scholes Analyse Allgemeine Vorüberlegungen Eine Aktie ist eine Anlage ähnlich einem Kredit. Der Anleger bekommt eine Verzinsung, da Kapital ein Arbeitsfaktor ist.

Mehr

Eine zweidimensionale Stichprobe

Eine zweidimensionale Stichprobe Eine zweidimensionale Stichprobe liegt vor, wenn zwei qualitative Merkmale gleichzeitig betrachtet werden. Eine Urliste besteht dann aus Wertepaaren (x i, y i ) R 2 und hat die Form (x 1, y 1 ), (x 2,

Mehr

Analyse von Zeitreihen in der Umweltphysik und Geophysik Stochastische Prozesse

Analyse von Zeitreihen in der Umweltphysik und Geophysik Stochastische Prozesse Analyse von Zeitreihen in der Umweltphysik und Geophysik Stochastische Prozesse Yannik Behr Gliederung 1 Stochastische Prozesse Stochastische Prozesse Ein stochastischer Prozess ist ein Phänomen, dessen

Mehr

Theoretische Grundlagen der Informatik

Theoretische Grundlagen der Informatik Theoretische Grundlagen der Informatik Vorlesung am 12.01.2012 INSTITUT FÜR THEORETISCHE 0 KIT 12.01.2012 Universität des Dorothea Landes Baden-Württemberg Wagner - Theoretische und Grundlagen der Informatik

Mehr

T-PIECES T-STÜCKE. 02/2016 www.dockweiler.com

T-PIECES T-STÜCKE. 02/2016 www.dockweiler.com T-PIECES T-STÜCKE 02/206 www.dockweiler.com 2 DT-4..2- (DT-9) utomatic Tube Weld: Straight Tee Mit nschweißenden: T-Stück ll prices ex works lle Preise ab Werk Order Code / rtikel-nr. Inch mm Inch mm SF

Mehr

Empfindlichkeit und Rauschmaß eines DVB T Sticks

Empfindlichkeit und Rauschmaß eines DVB T Sticks Empfindlichkeit und Rauschmaß eines DVB T Sticks Messung kritischer Spezifikationen eines Salcar Stick DVB T RTL 2832U&R820T SDR Salcar Stick, oder ähnlich Blockschaltbild des R820T Tuners Aufbau für Empfindlichkeitsmessung:

Mehr

Stützen für Fördersysteme

Stützen für Fördersysteme Stützen für Fördersysteme Inhalt Führungsprofile, Befestigungswinkel und Füße...317 Stützenvarianten...31 Tragprofile...319 Verbindungswinkel - Auswahlmöglichkeiten...320 Verbindungswinkel für Tropfrinnen...320

Mehr

Dun & Bradstreet Compact Report

Dun & Bradstreet Compact Report Dun & Bradstreet Compact Report Identification & Summary (C) 20XX D&B COPYRIGHT 20XX DUN & BRADSTREET INC. - PROVIDED UNDER CONTRACT FOR THE EXCLUSIVE USE OF SUBSCRIBER 86XXXXXX1. ATTN: Example LTD Identification

Mehr

Seminar Analysis Konvexe Funktionen und einige wichtige Ungleichungen

Seminar Analysis Konvexe Funktionen und einige wichtige Ungleichungen Seminar Analysis Konvexe Funktionen und einige wichtige Ungleichungen Michael Schaeer 3.04.03 Abstract This seminar is about convex functions and several imortant ineualities. At the beginning the term

Mehr

Vorkurs: Mathematik für Informatiker Steven Köhler, Anja Moldenhauer, Marcel Morisse

Vorkurs: Mathematik für Informatiker Steven Köhler, Anja Moldenhauer, Marcel Morisse Vorkurs: Mathematik für Informatiker Steven Köhler, Anja Moldenhauer, Marcel Morisse Wintersemester 2014/15 Aufgaben I-1. Es seien die folgenden Mengen A = {5,7,9}, B = {5,6,7} und C = {1,3,5,7,9} gegeben.

Mehr

lineare-algeba.wxmx 1 / 7 Mathematik in wxmaxima www.mathematik-verstehen.de Haftendorn Dez 2010

lineare-algeba.wxmx 1 / 7 Mathematik in wxmaxima www.mathematik-verstehen.de Haftendorn Dez 2010 lineare-algeba.wxmx / Lineare Algebra Mathematik in wxmaxima www.mathematik-verstehen.de Haftendorn Dez. Handling Achtung: Durch Anklicken der linken Zellmarkierung kann man die Abschnitte und auch einzelne

Mehr

15ab 21bc 9b = 3b 5a 7c 3

15ab 21bc 9b = 3b 5a 7c 3 4 4.1 Einführung Haben alle Summanden einer algebraischen Summe einen gemeinsamen Faktor, so kann man diesen gemeinsamen Faktor ausklammern. Die Summe wird dadurch in ein Produkt umgewandelt. Tipp: Kontrolle

Mehr

ZIEGELWERK Martin Pichler EN 771 1:2011

ZIEGELWERK Martin Pichler EN 771 1:2011 Maße: Länge L 200 mm 500 mm 12,5 N/mm² 14,2 N/mm² Ebenheit [

Mehr

Quadratische Gleichungen

Quadratische Gleichungen Quadratische Gleichungen Aufgabe: Versuche eine Lösung zu den folgenden Zahlenrätseln zu finden:.) Verdoppelt man das Quadrat einer Zahl und addiert, so erhält man 00..) Addiert man zum Quadrat einer Zahl

Mehr

Herzlich Willkommen ! " $' #$% (!)% " * +,'-. ! 0 12" 12'" " #$%"& /!' '- 2! 2' 3 45267 2-5267

Herzlich Willkommen !  $' #$% (!)%  * +,'-. ! 0 12 12'  #$%& /!' '- 2! 2' 3 45267 2-5267 Page 1/1 Herzlich Willkommen! " #$%"&! " $' #$% (!)% " * +,'-. /!' '-! 0 12" 12'" 2! 2' 3 45267 2-5267 -26 89 : 9; ;/!!' 0 '6'!!2' 2(' '' ' &! =>! = / 5,?//'6 20%! ' 6', 62 '! @ @! &> $'( #'/

Mehr

Mathematics. - Ueber die Difterentialkovariante erster Ordnung der binären kubischen Difterentialform. Von P. G. MOLENAAR.

Mathematics. - Ueber die Difterentialkovariante erster Ordnung der binären kubischen Difterentialform. Von P. G. MOLENAAR. Mathematics. - Ueber die Difterentialkovariante erster Ordnung der binären kubischen Difterentialform. Von P. G. MOLENAAR. (Communicated by Prof. R. WEITZENBÖCK.) (Communicated at the meeting of December

Mehr

Division Für diesen Abschnitt setzen wir voraus, dass der Koeffizientenring ein Körper ist. Betrachte das Schema

Division Für diesen Abschnitt setzen wir voraus, dass der Koeffizientenring ein Körper ist. Betrachte das Schema Division Für diesen Abschnitt setzen wir voraus, dass der Koeffizientenring ein Körper ist. Betrachte das Schema 2x 4 + x 3 + x + 3 div x 2 + x 1 = 2x 2 x + 3 (2x 4 + 2x 3 2x 2 ) x 3 + 2x 2 + x + 3 ( x

Mehr

Rekursion und Iteration - Folgen und Web-Diagramme

Rekursion und Iteration - Folgen und Web-Diagramme Rekursion und Iteration - Folgen und Web-Diagramme Ac Einführungsbeispiel Quadratpflanze Ein Quadrat mit der Seitenlänge m wächst wie in der Grafik beschrieben: Figur Figur2 Figur3 Täglich kommt eine Generation

Mehr

Beschluss (360-4005.20-002/05-ABG) über die Festsetzung der erstattungsfähigen notwendigen Kosten der Verfahrensbeteiligten im Nachprüfungsverfahren

Beschluss (360-4005.20-002/05-ABG) über die Festsetzung der erstattungsfähigen notwendigen Kosten der Verfahrensbeteiligten im Nachprüfungsverfahren Beschluss (360-4005.20-002/05-ABG) über die Festsetzung der erstattungsfähigen notwendigen Kosten der Verfahrensbeteiligten im Nachprüfungsverfahren I. Kostenfestsetzungsverfahren, 128 Abs.1 ff. GWB auf

Mehr

D"&..&%"' 1%&&0 %%" 1&-"&& 1%

D&..&%' 1%&&0 %% 1&-&& 1% 13! % % % &"'& &( &%") *+ %,'-%&"-"'". /&".%0 %.1&.%% "2/ 31% ""%&- "#$%&&'()!* &-"% "2"&& "2 & &&5&%. +%,,%-(* &&%. %2"% 8"./"9"/&%&*.%&%"',(.)* :"&&&.0.%&%-%&(+2% &&% %"%&- ;,/01%(* "&

Mehr

Elementare Zahlentheorie (Version 1)

Elementare Zahlentheorie (Version 1) Elementare Zahlentheorie (Version (Winter Semester, 2005-6 Zur Notation N ist die Menge der natürlichen Zahlen:, 2, 3, 4, 5,... und so weiter. Z ist die Menge aller ganzen Zahlen:..., 4, 3, 2,, 0,, 2,

Mehr

Fehlerkorrektur in der Datenübertragung

Fehlerkorrektur in der Datenübertragung oder Was machen Irving Reed und Gustave Solomon auf dem Ochsenkopf? Alfred Wassermann Universität Bayreuth 28. November 2008 Hamming- WirlebenineinerInformationsgesellschaft FehlerfreieNachrichtenübertragungistvongrosser

Mehr

2 3 x3 17. x k dx = x k x k+1 k +1. Mit jeder weiteren partiellen Integration reduziert sich der Grad des Faktors x n, induktiv erhalten wir also

2 3 x3 17. x k dx = x k x k+1 k +1. Mit jeder weiteren partiellen Integration reduziert sich der Grad des Faktors x n, induktiv erhalten wir also Universität Konstanz Fachbereich Mathematik und Statistik Repetitorium Analysis 0 Dr DK Huynh Blatt 8 Aufgabe 6 Bestimmen Sie (a) (x + x 7x+)dx (c) (f) x n exp(x)dx (n N fest) sin (x)dx (g) (b) (d) ln(x)dx

Mehr

Angebotsformular. Hilfsmittelbezeichnung. Motorisch verstellbare Betten / Niederflurbetten, Einlegerahmen

Angebotsformular. Hilfsmittelbezeichnung. Motorisch verstellbare Betten / Niederflurbetten, Einlegerahmen Angebotsformular zur öffentlichen Bekanntmachung der AOK Bayern, einen Vertrag über die Versorgung mit Betten, Mobilitätshilfen und Treppenfahrzeugen schließen zu wollen AC / TK 15 020XX AC / TK 15 020YY

Mehr

Nürnberg. Augsburg. München

Nürnberg. Augsburg. München IT T OIT-- @ ß 77 T -13- Fx-111 : F 121 : 121 -: 221 : 221 32 73 T -3- Tx: - I ö - L L T ä F ö F : x : - y - OIT (ß -F O- -- O: 3 : 1 ( y Jö J 2 OIT 3 L! T F: ß: : : : : I 1 x 22 ( x ö 1 - : F * F : @

Mehr

Hinweise und Informationen zum Inhalt der Musterseiten dieser Datei

Hinweise und Informationen zum Inhalt der Musterseiten dieser Datei Hinweise und Informationen zum Inhalt der Musterseiten dieser Datei D ie au sg ew äh lte n Se ite n au s de n ve rs ch ie de ne n O rd ne rn de r C D so lle n ei n w en ig di e Ba nd br ei te de r ve rs

Mehr

Dokumentation Metronom

Dokumentation Metronom Beuth Hochschule für Technik Berlin Fachbereich VII Elektrotechnik Mechatronik Optometrie Studiengang Bachelor Elektrotechnik Dokumentation Metronom Projekt im Labor Mikrocomputertechnik Teilnehmer: Benjamin

Mehr

Ein (7,4)-Code-Beispiel

Ein (7,4)-Code-Beispiel Ein (7,4)-Code-Beispiel Generator-Polynom: P(X) = X 3 + X 2 + 1 Bemerkung: Es ist 7 = 2^3-1, also nach voriger Überlegung sind alle 1-Bit-Fehler korrigierbar Beachte auch d min der Codewörter ist 3, also

Mehr

Erweiterung zur bestehenden Bedienungsanleitung für analoge Endgeräte an Siemens-Telefonanlagen

Erweiterung zur bestehenden Bedienungsanleitung für analoge Endgeräte an Siemens-Telefonanlagen Erweiterung zur bestehenden Bedienungsanleitung für analoge Endgeräte an Siemens-Telefonanlagen Die neuen Funktionen stehen allen Teilnehmern an folgenden Anlagen zur Verfügung: 428 11 xxxx Bereich Bahrenfelder

Mehr

1. Pflicht-Übung Num. Mathematik 2 SFT (SS02)

1. Pflicht-Übung Num. Mathematik 2 SFT (SS02) 1. Pflicht-Übung Num. Mathematik 2 SFT (SS02) von Roland Steffen SFT1 "!$#$&%&')(* +-,.*0/123 45#0/6 47 89 00 : $; < Quellcode: /* Löst ein spezielles lineares GLS (A*x=b; tridiagonale Koeffizientenmatrix

Mehr

F ä h r e n b l i c k H o r g e n W o h n e n i m A t t i k a E r s t v e r m i e t u n g L a g e H o rg e n z ä h l t h e u t e z u e i n e r b e g e h r t e n Wo h n a d r e s s e a m Z ü r i c h s e

Mehr

EyeCheck Smart Cameras

EyeCheck Smart Cameras EyeCheck Smart Cameras 2 3 EyeCheck 9xx & 1xxx Serie Technische Daten Speicher: DDR RAM 128 MB FLASH 128 MB Schnittstellen: Ethernet (LAN) RS422, RS232 (nicht EC900, EC910, EC1000, EC1010) EtherNet / IP

Mehr

x mm 400 1) 400 1) 400 1) 400 1) α / β 6,5/6,5 6,5/6,5 6,5/6,5 6,5/6,5 h3 mm 3000 2) 3000 2) 3000 2) 3000 2)

x mm 400 1) 400 1) 400 1) 400 1) α / β 6,5/6,5 6,5/6,5 6,5/6,5 6,5/6,5 h3 mm 3000 2) 3000 2) 3000 2) 3000 2) Technische Daten Reihe ME 1,5 bis 3 tonnen Elektro Gabelstapler MANITOU MANITOU MANITOU MANITOU ME315 ME316 ME318 ME320 Q t 1,5 1,6 1,8 2,0 c mm 500 500 500 500 x mm 400 1) 400 1) 400 1) 400 1) y mm 1250

Mehr

ERGÄNZUNGEN ZUR ANALYSIS II MITTELWERTSATZ UND ANWENDUNGEN

ERGÄNZUNGEN ZUR ANALYSIS II MITTELWERTSATZ UND ANWENDUNGEN ERGÄNZUNGEN ZUR ANALYSIS II MITTELWERTSATZ UND ANWENDUNGEN CHRISTIAN HARTFELDT. Zweiter Mittelwertsatz Der Mittelwertsatz Satz VI.3.4) lässt sich verallgemeinern zu Satz.. Seien f, g : [a, b] R auf [a,

Mehr

Ein Beitrag zu der GUHA Methode in der dreiwertigen Logik

Ein Beitrag zu der GUHA Methode in der dreiwertigen Logik KYBERNETIKA JAHRGANG 11 (1975), HEFT 2 Ein Beitrag zu der GUHA Methode in der dreiwertigen Logik JAN RAUCH In der vorliegenden Arbeit werden zu jedem dreiwertigen Modell (Modell mit unvollständiger Information)

Mehr

M A G A Z I N I N F O R M AT I O N E N Z U M E I C H W E S E N A u s g a b e 2/ 2 0 1 5 B T E G E W E R K S C H A FT M E S S- U N D E I C H W E S E N ve r B u n d e n i n T e c h n i k & E i c h u n g

Mehr

Rekursionen. Georg Anegg 25. November 2009. Methoden und Techniken an Beispielen erklärt

Rekursionen. Georg Anegg 25. November 2009. Methoden und Techniken an Beispielen erklärt Methoden und Techniken an Beispielen erklärt Georg Anegg 5. November 009 Beispiel. Die Folge {a n } sei wie folgt definiert (a, d, q R, q ): a 0 a, a n+ a n q + d (n 0) Man bestimme eine explizite Darstellung

Mehr

Charakteristikenmethode im Beispiel

Charakteristikenmethode im Beispiel Charakteristikenmethode im Wir betrachten die PDE in drei Variablen xu x + yu y + (x + y )u z = 0. Das charakteristische System lautet dann ẋ = x ẏ = y ż = x + y und besitzt die allgemeine Lösung x(t)

Mehr

Skalare Differentialgleichungen

Skalare Differentialgleichungen Kapitel 2 Skalare Differentialgleichungen 2.1 Skalare lineare Differentialgleichungen 2.2 Bernoulli und Riccati Differentialgleichungen 2.3 Differentialgleichungen mit getrennten Variablen 2.4 Exakte Differentialgleichungen

Mehr

1. Man schreibe die folgenden Aussagen jeweils in einen normalen Satz um. Zum Beispiel kann man die Aussage:

1. Man schreibe die folgenden Aussagen jeweils in einen normalen Satz um. Zum Beispiel kann man die Aussage: Zählen und Zahlbereiche Übungsblatt 1 1. Man schreibe die folgenden Aussagen jeweils in einen normalen Satz um. Zum Beispiel kann man die Aussage: Für alle m, n N gilt m + n = n + m. in den Satz umschreiben:

Mehr

Erinnerung/Zusammenfassung zu Abbildungsmatrizen

Erinnerung/Zusammenfassung zu Abbildungsmatrizen Erinnerung/Zusammenfassung zu Abbildungsmatrizen Thomas Coutandin (cthomas@student.ethz.ch) 7. November 2 Abbildungsmatrizen Im Folgenden betrachten wir stets endlich dimensionale K-Vektorräume (K irgend

Mehr

Hauptspeicherinhalt. Ton. Vektorgrafik Bitmapgrafik Digit. Video. 1. Darstellung von Daten im Rechner. Abb. 1.1: Einteilung der Daten

Hauptspeicherinhalt. Ton. Vektorgrafik Bitmapgrafik Digit. Video. 1. Darstellung von Daten im Rechner. Abb. 1.1: Einteilung der Daten Hauptspeicherinhalt Programmcode Daten numerisch logisch alphanumerisch Ton Grafik Ganze Zahlen Gleitkommazahlen Zeichen Zeichenketten vorzeichenlos mit Vorzeichen Vektorgrafik Bitmapgrafik Digit. Video

Mehr

Übungen zu C++ Kapitel 1

Übungen zu C++ Kapitel 1 Übungen zu C++ Kapitel 1 Aufgabe 1 Ergänze den Text. a) Die sechs logischen Einheiten eines Computers sind Eingabe-Einheit, Ausgabe-Einheit, RAM, ALU, CPU, Plattenspeicher. b) Die Programme, welche Hochsprachenprogramme

Mehr

Delisting, Rückzug aus dem amtlichen Handel oder dem geregelten Markt auf Wunsch des Emittenten aus kapitalmarktrechtlicher Sicht

Delisting, Rückzug aus dem amtlichen Handel oder dem geregelten Markt auf Wunsch des Emittenten aus kapitalmarktrechtlicher Sicht Michael Radtke Delisting, Rückzug aus dem amtlichen Handel oder dem geregelten Markt auf Wunsch des Emittenten aus kapitalmarktrechtlicher Sicht PETER LANG Europäischer Verlag der Wissenschaften Inhaltsübersicht

Mehr

Integral-Iterationsverfahren und die exakten Lösungen der partiellen Differentialgleichungen

Integral-Iterationsverfahren und die exakten Lösungen der partiellen Differentialgleichungen Integral-Iterationsverfahren und die exakten Lösungen der partiellen Differentialgleichungen Dr. rer. nat. Kuang-lai Chao Göttingen, den 16. Juni 2007 Abstract The integral iterative ethod and exact solutions

Mehr

Programmierung 1 - Repetitorium

Programmierung 1 - Repetitorium WS 2002/2003 Programmierung 1 - Repetitorium Andreas Augustin und Marc Wagner Homepage: http://info1.marcwagner.info Donnerstag, den 10.04.03 Kapitel 7 Korrektheit 7.1 Abstrakte Prozeduren Abstrakte Prozedur

Mehr

Einführung in das wissenschaftliche Arbeiten

Einführung in das wissenschaftliche Arbeiten 4. Vorlesung Tipps zur Erstellung der Bachelorarbeit markus.knappitsch@uni-muenster.de Institut für Numerische und Angewandte Mathematik Universität Münster 11. Mai 2011 4. Vorlesung: Tipps zur Erstellung

Mehr

3.3 Eigenwerte und Eigenräume, Diagonalisierung

3.3 Eigenwerte und Eigenräume, Diagonalisierung 3.3 Eigenwerte und Eigenräume, Diagonalisierung Definition und Lemma 3.3.1. Sei V ein K-Vektorraum, φ End K (V ), λ K. Wir defnieren den zu λ gehörigen Eigenraum von φ als Dies ist ein Unterraum von V.

Mehr

e d m m = D d (E e (m)) D d E e m f c = f(m) m m m 1 f(m 1 ) = c m m 1 m c = f(m) c m c m b b 0, 1 b r f(b, r) f f(b, r) := y b r 2 n, n = pq ggt (p, q) = 1 p q y n f K f(x + y) = f(x) + f(y) f(x y) =

Mehr

! nendes Berufsfeld und die Menschen, die dort arbeiten kennenzulernen. Erlebe ein Stück ihrer täglichen Arbeit mit!

! nendes Berufsfeld und die Menschen, die dort arbeiten kennenzulernen. Erlebe ein Stück ihrer täglichen Arbeit mit! Ty 2020 W W L v W L v W ö K WG I B ö W G K L F F Hy W Ty ö N! : D - B v: E 350 v v. T J ö. I P E B B. I. J v v E V v W. Kö K W K- - W V- T U F E! U B v j By Dy! E T ö -! B. E! ß Z - L....! H P Z F L v

Mehr

Arbeitsblätter neues St. Galler Management Modell (SGMM)

Arbeitsblätter neues St. Galler Management Modell (SGMM) Arbeitsblätter neues St. Galler Management Modell (SGMM) Status: leer Version: 1 Verfasser: Urs Frey Datum: xx. yy. 20zz Ort: St.Gallen AUFGABENSTELLUNG Füllen Sie die nachfolgenden Arbeitsblätter SGMM

Mehr

Advanced Encryption Standard. Copyright Stefan Dahler 20. Februar 2010 Version 2.0

Advanced Encryption Standard. Copyright Stefan Dahler 20. Februar 2010 Version 2.0 Advanced Encryption Standard Copyright Stefan Dahler 20. Februar 2010 Version 2.0 Vorwort Diese Präsentation erläutert den Algorithmus AES auf einfachste Art. Mit Hilfe des Wissenschaftlichen Rechners

Mehr

QUALITY-APPs Applikationen für das Qualitätsmanagement. Probieren und Studieren

QUALITY-APPs Applikationen für das Qualitätsmanagement. Probieren und Studieren QUALITY-APPs Applikationen für das Qualitätsmanagement Probieren und Studieren Der Netzplan (Activity Network Diagram AND) Planung und Steuerung erfolgreicher Projekte Autor: Jürgen P. Bläsing (nach einer

Mehr

Outsourcing bei Kreditinstituten: Rechtsfragen im Zusammenhang mit dem Bank- und Datenschutzrecht

Outsourcing bei Kreditinstituten: Rechtsfragen im Zusammenhang mit dem Bank- und Datenschutzrecht Melanie Gutmann Outsourcing bei Kreditinstituten: Rechtsfragen im Zusammenhang mit dem Bank- und Datenschutzrecht Wirtschaftliche Interessen der Banken im Spannungsverhältnis zum Geheimhaltungsinteresse

Mehr

Zusammenfassung zu Codierungstheorie

Zusammenfassung zu Codierungstheorie Zusammenfassung zu Codierungstheorie Sara Adams 5. Juli 2005 Diese Zusammenfassung basiert auf der Vorlesung Codierungstheorie gehalten im Sommersemester 2005 von Prof. Dr. Hans-Dietrich Gronau an der

Mehr