Forschungszentrum Karlsruhe

Save this PDF as:
 WORD  PNG  TXT  JPG

Größe: px
Ab Seite anzeigen:

Download "Forschungszentrum Karlsruhe"

Transkript

1 Forschungszentrum Karlsruhe in der Helmholtz-Gemelnschaft Wissenschaftliche Berichte FZKA7106 Biochemische Charakterisierung der Isoprensynthase aus der Graupappel (Populus x canescens (Ait.) Sm.) und ihre Expression in Arabidopsis thaliana L. Anette Bachl Institut für Meteorologie und Klimaforschung von der Mathematisch-Naturwissenschaftlichen Fakultät der Universität zu Köln genehmigte Dissertation Forschungszentrum Karlsruhe GmbH, Karlsruhe 2005

2 1 Einleitung Isoprenemission von Pflanzen und ihre Bedeutung für die Atmosphärenchemie Plastidäre Isoprenoidbiosynthese - Der MEP-Stoffwechsel Isoprensynthase - Das Schlüsselenzym der Isoprenbiosynthese Physiologische Funktion der Isoprenbildung bei Pflanzen Ziele der Arbeit 9 2 Material und Methoden Herkunft und Anzucht der verwendeten Organismen, Verwendete Bakterienstämme und ihre Kultivierung Escherichia co//-stämme Agrobacterium tumefaciens Verwendetes Pflanzenmaterial und dessen Anzucht Anzucht von Populus x canescens (Ait.)Sm Anzucht von Arabidopsis thaliana L Verwendete Vektoren und deren Eigenschaften Klonierungsvektoren (pcrii-topo; pcr2.1-topo, pbluescriptll SK) Expressionsvektoren (pgs72, pqe30, pqeöo, pqe60) Transformationsvektoren (pbinar, pmp90) Molekularbiologische Methoden Präparation von Nukleinsäuren Plasmidpräparation DNA-Extraktion aus A. thaliana " RNA-Extraktion aus Blättern und Protoplasten von A. thaliana AA Bestimmung der Konzentration und Reinheit von Nukleinsäuren Agarosegelelektrophorese von Nukleinsäuren Polymeraseketten-Reaktion zur DNA-Amplifikation Primerdesign Reaktionsansätze und Temperaturprogramme 22

3 2.2.3 Klonierung und Umklonierung TOPO TA Cloning Kit Restriktion Reinigung und Ligation der DNA Transformation von Bakterien Chemische Behandlung von E. coli TG1 mit CaCI 2 und Transformation Elektroporation und Transformation von A. tumefaciens Selektion transgener Klone DNA-Sequenzierung ' Cycle sequencing" mit Farbstoff-markierten Terminatoren Kapillarelektrophorese und Analyse der Sequenzdaten Transformation von A. thaliana Floral Dip"-Technik Selektion transgener A. thaliana-ur\\en Herstellung und Transformation von Protoplasten aus A.toa/Zana-Blättem Herstellen von Protoplasten aus A. thaliana-b\ä\tern Transiente Transformation der Protoplasten Quantitative PCR mit reverser Transkriptase Umschreiben der mrna in cdna mit reverser Transkriptase Quantitative PCR mit SYBR Green Proteinbiochemische Methoden Herstellung von Proteinextrakten Zellaufschluss von E. coli Reinigung His-Tag-markierter Isoprensynthase über Affinitätschromatographie Zellaufschluss von Blättern Bestimmung der Proteinkonzentration Messung der Isoprensynthaseaktivität 38

4 Synthese von DMADP Standardenzymtest der Isoprensynthase Nachweis von Isopren über gaschromatographische head space" Analyse Bestimmung des nativen Molekulargewichts der Isoprensynthase mittels Gelfiltration über Superdex 200 HR 10/ Bestimmung des DMADP-Gehalts in Blättern von A. thaliana Versuchsaufbau zur Messung der Isoprenemission von transgenen E. coli - Kulturen und A. thaliana In v/vo'nachweis der Isoprenbildung transgener E. coli Messung der Isopren- und Monoterpenemission von A. thaliana Küvettenaufbau Quantifizierung der Isopren- und Monoterpenemission von A. thaliana am GC-MS Verwendete Kits und Bioreagenzien Verwendete Chemikalien und sonstige Verbrauchsmaterialien 50 3 Ergebnisse Herstellen von Derivaten des/sps-gens Markierung der vollständigen ISPS mit einem C-terminalen HA-Epitop Markierung der vollständigen ISPS mit einem C-terminalen His-Tag Funktionsnachweis der rekombinanten /sps-derivate Klonierung des funktioneilen Gens der ISPS in Expressionsvektoren In wvo-nachweis von Isopren aus transgenen E. coli -Kulturen Vergleich der biochemischen Eigenschaften rekombinanter und nativer ISPS Zeitabhängigkeit der Enzymaktivität heterolog exprimierter ISPS Substratabhängigkeit ph-abhängigkeit Temperaturabhängigkeit Natives Molekulargewicht der ISPS Zusammenfassende Tabelle der biochemischen Eigenschaften 73

5 3.4 Transformation von A. thaliana Nachweis der erfolgreichen Transformation von Agrobacterium tumefaciens Selektion transgener A. thaliana-lm\en über Kanamycinresistenz Genomischer Nachweis der Insertion des Resistenz- und des isps- Gens Nachweis über PCR Überprüfung der in A. thaliana inserierten Gensequenz der isps Nachweis der Genexpression der isps und der Isoprenemission transgener A. thaliana-pflanzen Qualitativer Nachweis der /sps-mrna über PCR Nachweis der Isoprenemission transgener A. thaliana-l\n\en Bestimmung der mrna-kopien der isps in transgenen Linien Nachweis der ISPS-Aktivität in Blattextrakten transgener A. thaliana- Linien Transiente Genexperession der isps in A. f/7a//ana-protoplasten Der DMADP-Gehalt von A. toa/zana-blättern 91 4 Diskussion MEP-Stoffwechsel und DMADP-Gehalt als Voraussetzung zur Expression des /sps-gens in A. thaliana Funktionsfähigkeit des /sps-genkonstruktes Höhe der Expression des /sps-gens in A. thaliana Biochemische Eigenschaften der Isoprensynthase und ihrer Derivate Ausblick 103

6 5 Literaturverzeichnis Anhang Verzeichnis der Abbildungen Verzeichnis der Tabellen Abkürzungsverzeichnis 120

Inhaltsverzeichnis... I. Ein Vorwort... VII. Synopse der Arbeit... IX. Synopsis of the thesis... XIII

Inhaltsverzeichnis... I. Ein Vorwort... VII. Synopse der Arbeit... IX. Synopsis of the thesis... XIII I INHALTSVERZEICHNIS Inhaltsverzeichnis... I Ein Vorwort... VII Synopse der Arbeit... IX Synopsis of the thesis... XIII A. Untersuchungen über die Stereoselektivität bakterieller, Pyruvat-abhängiger Aldolasen...

Mehr

Verzeichnis der Abbildungen und Tabellen... VIII Verzeichnis der Abkürzungen und Trivialnamen... XI I Einleitung... 1

Verzeichnis der Abbildungen und Tabellen... VIII Verzeichnis der Abkürzungen und Trivialnamen... XI I Einleitung... 1 Verzeichnis der Abbildungen und Tabellen... VIII Verzeichnis der Abkürzungen und Trivialnamen... XI I Einleitung... 1 1 Extremophile Organismen... 1 2 Halophile Mikroorganismen... 2 2.1 Lebensräume und

Mehr

Ein neues stärke-relevantes Enzym in Arabidopsis thaliana: Die Phosphoglukan-Wasser-Dikinase

Ein neues stärke-relevantes Enzym in Arabidopsis thaliana: Die Phosphoglukan-Wasser-Dikinase Ein neues stärke-relevantes Enzym in Arabidopsis thaliana: Die Phosphoglukan-Wasser-Dikinase RHOMBOS-VERLAG Bibliografische Information Der Deutschen Bibliothek Die Deutsche Bibliothek verzeichnet diese

Mehr

Heterologe Expression einer funktionellen Domäne des nikotinischen Acetylcholinrezeptors

Heterologe Expression einer funktionellen Domäne des nikotinischen Acetylcholinrezeptors Heterologe Expression einer funktionellen Domäne des nikotinischen Acetylcholinrezeptors Inauguraldissertation zur Erlangung der Doktorwürde am Fachbereich Biologie/Chemie/Pharmazie der Freien Universität

Mehr

1. Einleitung S. 1 1.1. Zelladhäsionsmoleküle S. 1 1.2. Die Immunglobulin-Superfamilie S. 2. 1.2.1. Das neurale Zelladhäsionsmolekül NCAM S.

1. Einleitung S. 1 1.1. Zelladhäsionsmoleküle S. 1 1.2. Die Immunglobulin-Superfamilie S. 2. 1.2.1. Das neurale Zelladhäsionsmolekül NCAM S. Inhaltsverzeichnis 1. Einleitung S. 1 1.1. Zelladhäsionsmoleküle S. 1 1.2. Die Immunglobulin-Superfamilie S. 2 1.2.1. Das neurale Zelladhäsionsmolekül NCAM S. 4 1.2.1.1. Molekulare Struktur von NCAM S.

Mehr

Inhaltsverzeichnis. 1 Einleitung... 1

Inhaltsverzeichnis. 1 Einleitung... 1 Inhaltsverzeichnis 1 Einleitung... 1 1.1 G-Protein-gekoppelte Rezeptoren... 3 1.1.1 Klassifizierung und Struktur von G-Protein-gekoppelten Rezeptoren... 6 1.1.2 Purinerge Rezeptoren... 12 1.1.3 Pharmazeutische

Mehr

Zweigbibliothek Medizin

Zweigbibliothek Medizin Sächsische Landesbibliothek - Staats- und Universitätsbibliothek Dresden (SLUB) Zweigbibliothek Medizin Diese Hochschulschrift finden Sie original in Printform zur Ausleihe in der Zweigbibliothek Medizin

Mehr

Methoden der Gentechnik

Methoden der Gentechnik Methoden der Gentechnik *** DNA-Rekombination und Klonierung *** 1. Allgemeine Grundprinzipien 1.1. Wesen der Gentechnik 1.2. Allgemeine Ziele der Gentechnik 1.3. Molekulare Voraussetzungen 1.4. Wichtige

Mehr

Transgene Organismen

Transgene Organismen Transgene Organismen Themenübersicht 1) Einführung 2) Komplementäre DNA (cdna) 3) Vektoren 4) Einschleusung von Genen in Eukaryontenzellen 5) Ausmaß der Genexpression 6) Genausschaltung (Gen-Knockout)

Mehr

Abkürzungsverzeichnis. 1. Einleitung 1. 2. Material und Methoden 8

Abkürzungsverzeichnis. 1. Einleitung 1. 2. Material und Methoden 8 Inhaltsverzeichnis I Abkürzungsverzeichnis VI 1. Einleitung 1 1.1 Stabilisierung von Makromolekülen 1 1.2 Natürliche Umgebungen von Proteinen 4 1.3 Künstliche Umgebungen von Proteinen 5 1.4 Ziel der vorliegenden

Mehr

Inhalt 1 Modellorganismen

Inhalt 1 Modellorganismen Inhalt 1 Modellorganismen....................................... 1 1.1 Escherichia coli....................................... 1 1.1.1 Historisches...................................... 3 1.1.2 Lebenszyklus.....................................

Mehr

Magnesium-ProtoporphyrinIX-Chelatase: Ein Schlüsselenzym in der Tetrapyrrolbiosynthese

Magnesium-ProtoporphyrinIX-Chelatase: Ein Schlüsselenzym in der Tetrapyrrolbiosynthese Magnesium-ProtoporphyrinIX-Chelatase: Ein Schlüsselenzym in der Tetrapyrrolbiosynthese Vom Fachbereich Biologie der Universität Hannover zur Erlangung des Grades Doktor der Naturwissenschaften Dr. rer.

Mehr

1 Einleitung... 13. 1.1 Staphylokokken... 13. 1.2 Koagulase-negative Staphylokokken... 13. 1.4 MSCRAMM-Proteine... 16. 1.5 LPXTG-Motive...

1 Einleitung... 13. 1.1 Staphylokokken... 13. 1.2 Koagulase-negative Staphylokokken... 13. 1.4 MSCRAMM-Proteine... 16. 1.5 LPXTG-Motive... Inhaltsverzeichnis 1 Einleitung... 13 1.1 Staphylokokken... 13 1.2 Koagulase-negative Staphylokokken... 13 1.3 Staphylococcus saprophyticus... 14 1.4 MSCRAMM-Proteine... 16 1.5 LPXTG-Motive... 16 1.6 Oberflächenassoziierte

Mehr

Verzeichnis der Abkürzungen... 6. 1. Einleitung... 9

Verzeichnis der Abkürzungen... 6. 1. Einleitung... 9 Inhaltsverzeichnis Verzeichnis der Abkürzungen... 6 1. Einleitung... 9 1.1 Probiotika...9 1.1.1 Definition und Historisches...9 1.1.2 Klinische Bedeutung probiotisch wirksamer Bakterienstämme...9 1.1.3

Mehr

Corynebacterium glutamicum

Corynebacterium glutamicum Biochemische und molekularbiologische Untersuchungen zu AmtR, dem Stickstoffregulator in Corynebacterium glutamicum Der Naturwissenschaftlichen Fakultät der Friedrich-Alexander-Universität Erlangen-Nürnberg

Mehr

Inhaltsverzeichnis. 1. Einleitung... 9. 2. Material und Methoden... 32

Inhaltsverzeichnis. 1. Einleitung... 9. 2. Material und Methoden... 32 Inhaltsverzeichnis 1. Einleitung... 9 1.1 Posttranslationale Modifikationen... 10 1.2 N-Glykosylierung... 11 1.3 O-Glykosylierung... 12 1.4 Veränderungen der Glykosylierung bei der Tumorentstehung... 13

Mehr

Interaktionen von Pu-Signaltransduktionsproteinen im Stickstoffmetabolismus der Organismen Bacillus subtilis und Synechococcus elongatus

Interaktionen von Pu-Signaltransduktionsproteinen im Stickstoffmetabolismus der Organismen Bacillus subtilis und Synechococcus elongatus Interaktionen von Pu-Signaltransduktionsproteinen im Stickstoffmetabolismus der Organismen Bacillus subtilis und Synechococcus elongatus Inaugural-Dissertation zur Erlangung des Doktorsgrades der Naturwissenschaften

Mehr

Molekularbiologie/ Genomics

Molekularbiologie/ Genomics Cornel Mülhardt Molekularbiologie/ Genomics 5. Auflage ELSEVIER SPEKTRUM AKADEMISCHER VERLAG Spektrum k-zlakademischer VERLAG Inhalt 1 Was ist denn "Molekularbiologie", bitteschön? 1 1.1 Das Substrat der

Mehr

Pflanzenbiotechnologie

Pflanzenbiotechnologie Pflanzenbiotechnologie 1. Nicht molekular basierte Methoden = klassische Züchtungsforschung - beruft sich auf Spontanmutationen und Kreuzung von Eigenschaften = Austausch des gesamten Allels (= Genoms)

Mehr

Eline Biedermann (Autor) Untersuchungen zur Charakterisierung von Prenyltransferasen aus Hypericum-Arten nach Expression in Nicotiana benthamiana

Eline Biedermann (Autor) Untersuchungen zur Charakterisierung von Prenyltransferasen aus Hypericum-Arten nach Expression in Nicotiana benthamiana Eline Biedermann (Autor) Untersuchungen zur Charakterisierung von Prenyltransferasen aus Hypericum-Arten nach Expression in Nicotiana benthamiana https://cuvillier.de/de/shop/publications/7653 Copyright:

Mehr

Cornel Mülhardt. Genomics. 6. Auflaqe. Spektrum k - / l AKADEMISCHER VERLAG

Cornel Mülhardt. Genomics. 6. Auflaqe. Spektrum k - / l AKADEMISCHER VERLAG I Cornel Mülhardt Genomics 6. Auflaqe Spektrum k - / l AKADEMISCHER VERLAG Inhalt 1 Was ist denn "Molekularbiologie", bitteschön? 1 1.1 Das Substrat der Molekularbiologie, oder: Molli-World für Anfänger...

Mehr

Abbildungsverzeichnis

Abbildungsverzeichnis I INHALTSVERZEICHNIS Abkürzungen VI Abbildungsverzeichnis VIII I. Einleitung 1. Neurone und Axonwachstum 1 2. Oligodendrozyten und Myelin 3 3. Das Proteolipid Protein (PLP) 6 4. Mutationen im PLP-Gen und

Mehr

Gentechnologie für Einsteiger

Gentechnologie für Einsteiger T. A. Brown Gentechnologie für Einsteiger 3. Auflage Aus dem Englischen übersetzt von Sebastian Vogel Spektrum Akademischer Verlag Heidelberg Berlin Vorwort Vorwort zur dritten englischen Auflage Vorwort

Mehr

Kursinhalte der Weiterbildung Molekulare Biotechnologie (MNr.: 237 / 0411 / 2010)

Kursinhalte der Weiterbildung Molekulare Biotechnologie (MNr.: 237 / 0411 / 2010) Kursinhalte der Weiterbildung Molekulare Biotechnologie (MNr.: 237 / 0411 / 2010) Schwerpunkte im Bereich BIOANALYTIK Polyacrylamidelektrophorese von Nukleinsäuren im Vertikalsystem Agarosegelelektrophorese

Mehr

Entwicklung und Anwendung von Methoden zur Differenzierung von Funktionen und Strukturen bakterieller Populationen des Bodens

Entwicklung und Anwendung von Methoden zur Differenzierung von Funktionen und Strukturen bakterieller Populationen des Bodens 6 Entwicklung und Anwendung von Methoden zur Differenzierung von Funktionen und Strukturen bakterieller Populationen des Bodens Von der Gemeinsamen Naturwissenschaftlichen Fakultät der Technischen Universität

Mehr

Inhalt. 3 Das Werkzeug... 47 3.1 Restriktionsenzyme... 47 3.2 Gele... 58 3.2.1 Agarosegele... 58

Inhalt. 3 Das Werkzeug... 47 3.1 Restriktionsenzyme... 47 3.2 Gele... 58 3.2.1 Agarosegele... 58 Inhalt 1 Was ist denn Molekularbiologie, bitteschön?...................... 1 1.1 Das Substrat der Molekularbiologie, oder: Molli-World für Anfänger.... 2 1.2 Was brauche ich zum Arbeiten?..................................

Mehr

Transkriptionelle Repression als molekulare Grundlage der anti-inflammatorischen Wirkung von Glucocorticoiden

Transkriptionelle Repression als molekulare Grundlage der anti-inflammatorischen Wirkung von Glucocorticoiden Forschungszentrum Karlsruhe Technik und Umwelt Wissenschaftliche Berichte FZKA 6087 Transkriptionelle Repression als molekulare Grundlage der anti-inflammatorischen Wirkung von Glucocorticoiden Stefanie

Mehr

Zweigbibliofhek Medizin

Zweigbibliofhek Medizin Sächsische Landesbibliothek - Staats- und Universitätsbibliothek Dresden (SLUB) Zweigbibliothek Medizin Diese Dissertation finden Sie original in Printform zur Ausleihe in der Zweigbibliofhek Medizin Nähere

Mehr

https://cuvillier.de/de/shop/publications/3308

https://cuvillier.de/de/shop/publications/3308 Frank Falinski (Autor) Überproduktion von Subkomplexen der F420H2- Dehydrogenase aus Archaeoglobus fulgidus und abschließende Untersuchungen zur Verbereitung von Methanophenazin in methanogenen Archaea

Mehr

Praktikum der Molekulargenetik

Praktikum der Molekulargenetik Ulrich Kück (Hrsg.) Praktikum der Molekulargenetik unter der Mitarbeit von A. Bunse, H. Holländer-Czytko, S. Jeske, C. Klämbt, R. Klapper, I. Kubigsteltig, F. Meinhardt, J. Nickelsen, M. Nowrousian, S.

Mehr

1. EINLEITUNG Der eukaryontische Translationsinitiationsfaktor 5A (eif5a) Der Polyaminbiosyntheseinhibitor Agmatin...

1. EINLEITUNG Der eukaryontische Translationsinitiationsfaktor 5A (eif5a) Der Polyaminbiosyntheseinhibitor Agmatin... 1. EINLEITUNG... 14 1.1 Lebenszyklus der Malaria Erreger Plasmodium falciparum und Plasmodium vivax... 16 1.2 Molekulares Targeting... 18 1.2.1 Die alternative Fettesäurebiosynthese II in Plasmodium falciparum...

Mehr

Anhang Anhang 8.1 Konstruktion transgener SQD1 -Pflanzen

Anhang Anhang 8.1 Konstruktion transgener SQD1 -Pflanzen Anhang 92 8 Anhang 8.1 Konstruktion transgener SQD1-Pflanzen Mutagenese und ein dadurch entstehender Phänotyp eines Organismus kann Aufschluß über die Funktion eines betroffenen Gens geben. Die Erzeugung

Mehr

Klonierung von S2P Rolle der M19-Zellen. POL-Seminar der Biochemie II 13.02.2007 Sebastian Gabriel

Klonierung von S2P Rolle der M19-Zellen. POL-Seminar der Biochemie II 13.02.2007 Sebastian Gabriel Klonierung von S2P Rolle der M19-Zellen POL-Seminar der Biochemie II 13.02.2007 Sebastian Gabriel Inhalt 1. Was ist eine humane genomische DNA-Bank? 2. Unterschied zwischen cdna-bank und genomischer DNA-Bank?

Mehr

Rekombinante Antikorperfragmente fur die. Zoonosediagnostik

Rekombinante Antikorperfragmente fur die. Zoonosediagnostik Rekombinante Antikorperfragmente fur die Zoonosediagnostik Von der Fakultat fur Lebenswissenschaften der Technischen Universitat Carolo-Wilhelmina zu Braunschweig zur Erlangung des Grades eines Doktors

Mehr

Abkürzungsverzeichnis... 7. Inhaltsverzeichnis... 11. Abbildungsverzeichnis... 17. 1 Einleitung... 21 1.1 Proteomik... 21 1.1.1 Proteom...

Abkürzungsverzeichnis... 7. Inhaltsverzeichnis... 11. Abbildungsverzeichnis... 17. 1 Einleitung... 21 1.1 Proteomik... 21 1.1.1 Proteom... Inhaltsverzeichnis Abkürzungsverzeichnis... 7 Inhaltsverzeichnis... 11 Abbildungsverzeichnis... 17 1 Einleitung... 21 1.1 Proteomik... 21 1.1.1 Proteom... 21 1.1.2 Protein-Protein Interaktionen allgemein...

Mehr

Platzhalter für Bild

Platzhalter für Bild Instrumentelle Bioanalytik in der Molekularbiologie Anke Neumann Platzhalter für Bild KIT die Kooperation von Forschungszentrum Karlsruhe GmbH und Universität Karlsruhe (TH) www.kit.edu Motivation und

Mehr

Prüfungsfragenkatalog für für Grundlagen der Gentechnik und Biotechnologie (Prof. Prof. Rudolf Bauer und Prof. Karin Ardjomand-Wölkart)

Prüfungsfragenkatalog für für Grundlagen der Gentechnik und Biotechnologie (Prof. Prof. Rudolf Bauer und Prof. Karin Ardjomand-Wölkart) Prüfungsfragenkatalog für für Grundlagen der Gentechnik und Biotechnologie (Prof. Prof. Rudolf Bauer und Prof. Karin Ardjomand-Wölkart) Stand: September 2014 Termin: 29.09.2014 1. Was ist Western Blot?

Mehr

MOSC-Proteine aus Escherichia coli, Homo sapiens, Mus musculus und. Arabidopsis thaliana

MOSC-Proteine aus Escherichia coli, Homo sapiens, Mus musculus und. Arabidopsis thaliana Untersuchung Molybdäncofaktor-haltiger MOSC-Proteine aus Escherichia coli, Homo sapiens, Mus musculus und Arabidopsis thaliana Von der Fakultät für Lebenswissenschaften der Technischen Universität Carolo-Wilhelmina

Mehr

Aufbau eines Assays zur Optimierung einer Polymerase für die Generierung hochgradig fluoreszenz-markierter DNA

Aufbau eines Assays zur Optimierung einer Polymerase für die Generierung hochgradig fluoreszenz-markierter DNA Aufbau eines Assays zur Optimierung einer Polymerase für die Generierung hochgradig fluoreszenz-markierter DNA Von der Naturwissenschaftlichen Fakultät der Technischen Universität Carolo-Wilhelmina zu

Mehr

Untersuchungen zur Funktion von Stärke-Synthasen in der Kartoffel (Solanum tuberosum L.)

Untersuchungen zur Funktion von Stärke-Synthasen in der Kartoffel (Solanum tuberosum L.) Untersuchungen zur Funktion von Stärke-Synthasen in der Kartoffel (Solanum tuberosum L.) Inaugural-Dissertation Erlangung der Doktorwürde im Fachbereich Biologie der Freien Univeisität Berlin vorgelegt

Mehr

Regulation der Carotinoidbiosynthese in Nostoc PCC Dissertation Zur Erlangung des Doktorgrades der Naturwissenschaften

Regulation der Carotinoidbiosynthese in Nostoc PCC Dissertation Zur Erlangung des Doktorgrades der Naturwissenschaften Regulation der Carotinoidbiosynthese in Nostoc PCC 7120 Dissertation Zur Erlangung des Doktorgrades der Naturwissenschaften vorgelegt beim Fachbereich Biowissenschaften der Johann Wolfgang Goethe-Universität

Mehr

Hochdurchsatz Generierung und Analyse von Arabidopsis thaliana-proteinen

Hochdurchsatz Generierung und Analyse von Arabidopsis thaliana-proteinen MAX-PLANCK-INSTITUT FÜR MOLEKULARE GENETIK Hochdurchsatz Generierung und Analyse von Arabidopsis thaliana-proteinen Dissertation zur Erlangung der Doktorwürde des Fachbereichs Biologie, Chemie, Pharmazie

Mehr

Gentechnologie fur Einsteiger

Gentechnologie fur Einsteiger T. A. Brown Gentechnologie fur Einsteiger 6. Auflage ubersetzt von Sebastian Grundprinzipien der Klonierung und 1 1 Klonierung und DNA-Analyse so wichtig? 3 Friihe Entwicklungen in der Genetik 4 1.2 Die

Mehr

https://cuvillier.de/de/shop/publications/6534

https://cuvillier.de/de/shop/publications/6534 Katja Breitenbücher (Autor) Etablierung und Optimierung der In-vitro-Kultur und Transformation der Apfelunterlagen M9 und M26 (Malus x domestica Borkh.) https://cuvillier.de/de/shop/publications/6534 Copyright:

Mehr

Thema Gentechnologie. Erwin R. Schmidt Institut für Molekulargenetik Gentechnologische Sicherheitsforschung & Beratung

Thema Gentechnologie. Erwin R. Schmidt Institut für Molekulargenetik Gentechnologische Sicherheitsforschung & Beratung Thema Gentechnologie Erwin R. Schmidt Institut für Molekulargenetik Gentechnologische Sicherheitsforschung & Beratung Die Genklonierung in Bakterien Vektor-DNA Spender-DNA Restriktionsenzym Rekombinante

Mehr

Cornel Mülhardt. Molekularbiologie/ Genomics

Cornel Mülhardt. Molekularbiologie/ Genomics Cornel Mülhardt Molekularbiologie/ Genomics 1 Was ist denn Molekularbiologie", bitteschön? 1 1.1 Das Substrat der Molekularbiologie, oder : Molli-World für Anfänger 2 1.2 Was brauche ich zum Arbeiten?

Mehr

Grundideen der Gentechnik

Grundideen der Gentechnik Grundideen der Gentechnik Die Gentechnik kombiniert Biotechnik und Züchtung. Wie in der Züchtung wird die Erbinformation eines Lebewesen verändert. Dabei nutzte man in den Anfängen der Gentechnik vor allem

Mehr

2) Veröffentlichungsnummer: PATENTANMELDUNG

2) Veröffentlichungsnummer: PATENTANMELDUNG Europäisches Patentamt European Patent Office Dffice europeen des brevets 2) Veröffentlichungsnummer: 0 368 342 A2 EUROPAISCHE PATENTANMELDUNG 2) Anmeldenummer: 89120894.4 ) Anmeldetag: 10.11.89 it) Int.

Mehr

RUHR-UNIVERSITÄT BOCHUM

RUHR-UNIVERSITÄT BOCHUM RUHR-UNIVERSITÄT BOCHUM Fakultät für Chemie Titel der Lehreinheit (LE) Modulpraktika Biochemie im Schwerpunkt Molekulare Biologie und Biotechnologie der Pflanzen und Mikroorganismen Molekularbiologie von

Mehr

Tier-Biotechnologie. Teil II: Genomanalyse sowie gendiagnostische Verfahren. 61

Tier-Biotechnologie. Teil II: Genomanalyse sowie gendiagnostische Verfahren. 61 Tier-Biotechnologie Inhaltsverzeichnis Vorwort. 9 Mitarbeiter. 10 Einführung in die Tier-Biotechnologie. 11 Teil I: Zellkultur- und Bioverfahrenstechniken. 23 1 Kultivierung tierischer Zellen. 25 1.1 Voraussetzungen

Mehr

Molecular Farming-Produktion von therapeutischen Eiweißen in Pflanzen

Molecular Farming-Produktion von therapeutischen Eiweißen in Pflanzen Molecular Farming-Produktion von therapeutischen Eiweißen in Pflanzen Zellbiologische und methodische Grundlagen Spinnenseidenproteine aus Pflanzen Vogelgrippevakzine aus Pflanzen Therapeutische antibakterielle

Mehr

Vorlesung LV-Nr Molekularbiologie für Agrarwissenschaften. J. Glößl, SS 2007

Vorlesung LV-Nr Molekularbiologie für Agrarwissenschaften. J. Glößl, SS 2007 Vorlesung LV-Nr. 954.104 Molekularbiologie für Agrarwissenschaften J. Glößl, SS 2007 Thematik: Molekularbiologische Methoden Teil 2 Die ppt Folien wurden freundlicherweise von Prof. Florian Rüker aus der

Mehr

Gentechnische Methoden

Gentechnische Methoden Desmond S. T. Nicholl Gentechnische Methoden 2. Auflage Aus dem Englischen übersetzt von Renate FitzRoy und Kurt Beginnen Spektrum Akademischer Verlag Heidelberg Berlin Inhalt Vorwort XI 1. 1.1 1.2 1.3

Mehr

DNA- Rekombinationstechnik. Gentechnik

DNA- Rekombinationstechnik. Gentechnik DNA- Rekombinationstechnik Gentechnik 1 Verwendung von Plasmiden in der Gentechnik Campbell 19.1 2 Die wichtigsten Schritte bei der DNA-Klonierung (Plasmid) Transformation 3 Durch Klonierung kann man DNA-Fragmente

Mehr

3 Ergebnisse. 3.1 Isolierung von leukozytärer Gesamt-RNA

3 Ergebnisse. 3.1 Isolierung von leukozytärer Gesamt-RNA 3 Ergebnisse 3.1 Isolierung von leukozytärer Gesamt-RNA Um Ausgangsmaterial zur Isolierung von CD44-RNA zu erhalten, wurde aus einem Buffy coat (siehe Abschnitt Materialen und Methoden ) der Leukozytenanteil

Mehr

Untersuchungen zur differenziellen Genexpression im ZNS von Noradrenalintransporter-Knockout- und Wildtyp-Mäusen

Untersuchungen zur differenziellen Genexpression im ZNS von Noradrenalintransporter-Knockout- und Wildtyp-Mäusen Untersuchungen zur differenziellen Genexpression im ZNS von Noradrenalintransporter-Knockout- und Wildtyp-Mäusen Inaugural-Dissertation zur Erlangung des Doktorgrades (Dr. rer. nat.) der Mathematisch-Naturwissenschaftlichen

Mehr

Biochemie und. chemischer Mechanismus

Biochemie und. chemischer Mechanismus Dissertation zur Erlangung des Doktorgrades der Fakultät für Chemie und Pharmazie der Ludwig-Maximilians-Universität München Biochemie und chemischer Mechanismus der Thiomethylierung von RNA Dorothea Maria

Mehr

VERZEICHNIS DER ABBILDUNGEN UND TABELLEN VERZEICHNIS DER ABKÜRZUNGEN UND TRIVIALNAMEN

VERZEICHNIS DER ABBILDUNGEN UND TABELLEN VERZEICHNIS DER ABKÜRZUNGEN UND TRIVIALNAMEN INHALTSVERZEICHNIS I VERZEICHNIS DER ABBILDUNGEN UND TABELLEN VII VERZEICHNIS DER ABKÜRZUNGEN UND TRIVIALNAMEN XIII 1 EINLEITUNG 1 1.1 Osmoadaption halophiler Mikroorganismen 2 1.1.1 Salt-in-cytoplasm

Mehr

antimikrobielle Barriere

antimikrobielle Barriere Die intestinale Mukusschicht als antimikrobielle Barriere Dissertation zur Erlangung des Doktorgrades der Naturwissenschaften (Dr. rer. nat.) Fakultät Naturwissenschaften Universität Hohenheim Institut

Mehr

Veröffentlichungen aus dem Technologiezentrum Wasser Band 67 Anaerober CKW-Abbau: Molekularbiologie, Substanzspektrum, Isotopenfraktionierung

Veröffentlichungen aus dem Technologiezentrum Wasser Band 67 Anaerober CKW-Abbau: Molekularbiologie, Substanzspektrum, Isotopenfraktionierung Veröffentlichungen aus dem Technologiezentrum Wasser Band 67 Anaerober CKW-Abbau: Molekularbiologie, Substanzspektrum, Isotopenfraktionierung Inhaltsverzeichnis 1. Einleitung... 1 1.1. Wissenschaftliche

Mehr

Dissertation. von Daniel Heiko Niemiiller aus Osterholz-Scharmbeck

Dissertation. von Daniel Heiko Niemiiller aus Osterholz-Scharmbeck Vergleichende Lokalisation der Homospermidin-Synthase, Eingangsenzym der Pyrrolizidin-Alkaloid-Biosynthese, in verschiedenen Vertretern der Boraginaceae Von der Fakultat fur Lebenswissenschaften der Technischen

Mehr

Maike van Ohlen (Autor) Pieris rapae und das Glucosinolat-Myrosinase-System Cyanidentgiftung in Lepidoptera

Maike van Ohlen (Autor) Pieris rapae und das Glucosinolat-Myrosinase-System Cyanidentgiftung in Lepidoptera Maike van Ohlen (Autor) Pieris rapae und das Glucosinolat-Myrosinase-System Cyanidentgiftung in Lepidoptera https://cuvillier.de/de/shop/publications/6781 Copyright: Cuvillier Verlag, Inhaberin Annette

Mehr

Grundlagen der Klonierung. Analytische Methoden der Biologie SS09 7 Klonierung und Gentechnik. Modul

Grundlagen der Klonierung. Analytische Methoden der Biologie SS09 7 Klonierung und Gentechnik. Modul Restriktion und Ligation: Restriktion und Ligation: Grundlagen der Klonierung Modul 2303-021 1 Restriktion und Ligation Verknüpfung von Fragmenten unterschiedlicher DNA Herkunft Restriktion und Ligation

Mehr

Inhalt. Inhaltsverzeichnis

Inhalt. Inhaltsverzeichnis Inhaltsverzeichnis I Abbildungsverzeichnis VI Tabellenverzeichnis VIII Abkürzungsverzeichnis IX 1 Einleitung 1 2 Material und Methoden 10 2.1 Liste der verwendeten Geräte und Feinchemikalien 10 2.1.1 Geräte

Mehr

Aus der Klinik für Vögel, Reptilien, Amphibien und Fische der Justus Liebig Universität Gießen. Betreuer: Prof. Dr. E. F. Kaleta

Aus der Klinik für Vögel, Reptilien, Amphibien und Fische der Justus Liebig Universität Gießen. Betreuer: Prof. Dr. E. F. Kaleta Aus der Klinik für Vögel, Reptilien, Amphibien und Fische der Justus Liebig Universität Gießen Betreuer: Prof. Dr. E. F. Kaleta Morphologische und molekularbiologische Untersuchungen (PCR und REA der 5,8S

Mehr

Tierärztliche Hochschule Hannover

Tierärztliche Hochschule Hannover Tierärztliche Hochschule Hannover Beurteilung der Entwicklungskompetenz boviner Oozyten aus Follikeln mit unterschiedlicher Durchblutung der Follikelwand INAUGURAL-DISSERTATION zur Erlangung des Grades

Mehr

Praktikum Biochemie Biotechnologie (Molekularbiologie & Biochemie) Bettina Siebers

Praktikum Biochemie Biotechnologie (Molekularbiologie & Biochemie) Bettina Siebers Praktikum Biochemie Biotechnologie (Molekularbiologie & Biochemie) Bettina Siebers Protein Expression Genomische DNA PCR Vektormolekül (Plasmid) Escherichia coli Reinigung Protein (1) Plasmidpräparation

Mehr

Molekularbiologische / gentechnische Methoden

Molekularbiologische / gentechnische Methoden Molekularbiologische / gentechnische Methoden MPM 1 Wie lässt sich ein spezifisches Gen/Genprodukt molekular analysieren? Fundamentales Problem: Komplexität biologischer Systeme MPM 2 Ein Ausschnitt aus

Mehr

Titel und Inhaltsverzeichnis. Inhaltsverzeichnis

Titel und Inhaltsverzeichnis. Inhaltsverzeichnis Inhaltsverzeichnis 1 Einleitung... 1 1.1 Die ursprüngliche Idee dieser Arbeit: Die Anwendung der Oberflächenanalytik auf Protein-Protein-Interaktionen... 1 1.2 Maßgeschneiderte Oberflächen- die Bedeutung

Mehr

https://cuvillier.de/de/shop/publications/1657

https://cuvillier.de/de/shop/publications/1657 Christian Landmann (Autor) Funktionelle Charakterisierung von Enzymen des Sekundärstoffwechsels in Lavendel (Lavandula angustifolia) und Erdbeere (Fragaria x ananassa) https://cuvillier.de/de/shop/publications/1657

Mehr

Genetik Praktikumsklausur SS2005

Genetik Praktikumsklausur SS2005 Genetik Praktikumsklausur SS2005 1. Aufgabe: Der Genotyp AbaB wird geselbstet, dabei werden 256 Nachkommen gebildet. Davon erhalten 16 Pflanzen den Genotyp ABAB a) gekoppelt b) nicht gekoppelt c) teilweise

Mehr

1 Einleitung... 1. 1.4 Glucoserepression...3. 1.8 Zielsetzung... 24. 2 Material und Methoden... 25

1 Einleitung... 1. 1.4 Glucoserepression...3. 1.8 Zielsetzung... 24. 2 Material und Methoden... 25 Inhaltsverzeichnis 1 Einleitung... 1 1.1 Zuckerstoffwechsel von Saccharomyces cerevisiae... 1 1.2 Glucoseinaktivierung... 2 1.3 Glucoseinduzierter gezielter mrna-abbau... 3 1.4 Glucoserepression...3 1.5

Mehr

Rekombinante Wirkstoffe. Prof. Dr. Theo Dingermann Institut für Pharmazeutische Biologie Goethe-Universität Frankfurt Dingermann@em.uni-frankfurt.

Rekombinante Wirkstoffe. Prof. Dr. Theo Dingermann Institut für Pharmazeutische Biologie Goethe-Universität Frankfurt Dingermann@em.uni-frankfurt. Rekombinante Wirkstoffe Prof. Dr. Theo Dingermann Institut für Pharmazeutische Biologie Goethe-Universität Frankfurt Dingermann@em.uni-frankfurt.de Praktische Definitionen Gentechnik Unmittelbare neukombination

Mehr

Rekombinante Antikorper. fur,,lab-on-chip"

Rekombinante Antikorper. fur,,lab-on-chip Rekombinante Antikorper fur,,lab-on-chip" Von der Fakultat fur Lebenswissenschaften der Technischen Universitat Carolo-Wilhelmina zu Braunschweig zur Erlangung des Grades einer Doktorin der Naturwissenschaften

Mehr

Analyse des Genoms des Pseudomonas-Phagen 0CTX, insbesondere der Steuerung der späten Gene

Analyse des Genoms des Pseudomonas-Phagen 0CTX, insbesondere der Steuerung der späten Gene Analyse des Genoms des Pseudomonas-Phagen 0CTX, insbesondere der Steuerung der späten Gene Frank Wilhelm Langewische Inhaltsverzeichnis Verzeichnis der Abbildungen Verzeichnis der Tabellen Verzeichnis

Mehr

Linking Transcription to the Metabolic State

Linking Transcription to the Metabolic State Towards Systems Biology of the Chloroplast under Stress: Linking Transcription to the Metabolic State Dissertation Zur Erlangung des Akademischen Grades Doktor der Naturwissenschaften (Dr. rer. nat.) Fakultat

Mehr

Untersuchungen zu molekularen, strukturellen und biokatalytischen Aspekten des Vitamin B1-abhängigen Enzyms Transketolase A aus Escherichia coli.

Untersuchungen zu molekularen, strukturellen und biokatalytischen Aspekten des Vitamin B1-abhängigen Enzyms Transketolase A aus Escherichia coli. Untersuchungen zu molekularen, strukturellen und biokatalytischen Aspekten des Vitamin B1-abhängigen Enzyms Transketolase A aus Escherichia coli. Dissertation zur Erlangung des akademischen Grades doctor

Mehr

Pharmakologische Untersuchungen zur Neuropeptid Y Yi-, Y 2 - und Ys-Rezeptorselektivität peptidischer und nichtpeptidischer Liganden:

Pharmakologische Untersuchungen zur Neuropeptid Y Yi-, Y 2 - und Ys-Rezeptorselektivität peptidischer und nichtpeptidischer Liganden: o Pharmakologische Untersuchungen zur Neuropeptid Y Yi-, Y 2 - und Ys-Rezeptorselektivität peptidischer und nichtpeptidischer Liganden: Klonierung und funktioneile Expression des humanen Ys-Rezeptors in

Mehr

Inhaltsverzeichnis... I. Abbildungs- und Tabellenverzeichnis... VI. Abkürzungsverzeichnis... IX. 1 Einleitung... 1

Inhaltsverzeichnis... I. Abbildungs- und Tabellenverzeichnis... VI. Abkürzungsverzeichnis... IX. 1 Einleitung... 1 I... I Abbildungs- und Tabellenverzeichnis... VI Abkürzungsverzeichnis... IX 1 Einleitung... 1 1.1 Untersuchte uro-rektale Fehlbildungen... 1 1.1.1 Blasenekstrophie-Epispadie-Komplex (BEEK)... 1 1.1.1.1

Mehr

0 INHALTSVERZEICHNIS... 3

0 INHALTSVERZEICHNIS... 3 0 INHALTSVERZEICHNIS... 3 1 EINLEITUNG... 8 1.1 RELEVANZ TROPISCHER REGENWÄLDER FÜR DIE VIRUSDIVERSITÄT... 8 1.2 EINFLUSS DES MENSCHEN AUF DAS AUFTRETEN NEUARTIGER ERREGER... 8 1.3 MOSKITOS ALS VIRUSRESERVOIR...

Mehr

Herstellung und Charakterisierung von zellpermeablem Interferon-α des Waldmurmeltieres (Marmota monax)

Herstellung und Charakterisierung von zellpermeablem Interferon-α des Waldmurmeltieres (Marmota monax) Aus der Abteilung Innere Medizin II der Medizinischen Universitätsklinik der Albert-Ludwigs-Universität Freiburg im Breisgau Herstellung und Charakterisierung von zellpermeablem Interferon-α des Waldmurmeltieres

Mehr

Stammzüchtung. Selektion von natürlichen Varianten. Ungerichtete genetische Veränderungen zufallsverteilte induzierte Mutagenese

Stammzüchtung. Selektion von natürlichen Varianten. Ungerichtete genetische Veränderungen zufallsverteilte induzierte Mutagenese Stammzüchtung Selektion von natürlichen Varianten Ungerichtete genetische Veränderungen zufallsverteilte induzierte Mutagenese Kreuzungen genetische Rekombination Sexuelle Kreuzungen Induzierte Zellfusion

Mehr

Expression und funktionelle Charakterisierung des Schlüsselenzyms der Sialinsäurebiosynthese, UDP-GlcNAc-2-Epimerase/ManNAc-Kinase

Expression und funktionelle Charakterisierung des Schlüsselenzyms der Sialinsäurebiosynthese, UDP-GlcNAc-2-Epimerase/ManNAc-Kinase Institut für Molekularbiologie und Biochemie der Freien Universität Berlin Abteilung Biochemie Fachbereich Humanmedizin Abteilungsleiter: Prof. Dr. W. Reutter Expression und funktionelle Charakterisierung

Mehr

Entwicklung und chemische Analytik eines glycerinbasierten Kühlschmierstoffs für die Metallbearbeitung

Entwicklung und chemische Analytik eines glycerinbasierten Kühlschmierstoffs für die Metallbearbeitung Entwicklung und chemische Analytik eines glycerinbasierten Kühlschmierstoffs für die Metallbearbeitung Von der Fakultät für Lebenswissenschaften der Technischen Universität Carolo-Wilhelmina zu Braunschweig

Mehr

Kerstin Brachhold (Autor) Das Basalapparat-Subproteom von Chlamydomonas reinhardtii

Kerstin Brachhold (Autor) Das Basalapparat-Subproteom von Chlamydomonas reinhardtii Kerstin Brachhold (Autor) Das Basalapparat-Subproteom von Chlamydomonas reinhardtii https://cuvillier.de/de/shop/publications/1867 Copyright: Cuvillier Verlag, Inhaberin Annette Jentzsch-Cuvillier, Nonnenstieg

Mehr

Stammzüchtung. Selektion von natürlichen Varianten. Ungerichtete genetische Veränderungen zufallsverteilte induzierte Mutagenese

Stammzüchtung. Selektion von natürlichen Varianten. Ungerichtete genetische Veränderungen zufallsverteilte induzierte Mutagenese Stammzüchtung Selektion von natürlichen Varianten Ungerichtete genetische Veränderungen zufallsverteilte induzierte Mutagenese Kreuzungen genetische Rekombination Sexuelle Kreuzungen Induzierte Zellfusion

Mehr

Entwicklung und Validierung eines automatisierten DNA-Mikroarrays zur Detektion von humanpathogenen Bakterien in Trinkwasser

Entwicklung und Validierung eines automatisierten DNA-Mikroarrays zur Detektion von humanpathogenen Bakterien in Trinkwasser TECHNISCHE UNIVERSITÄT MÜNCHEN Lehrstuhl für Analytische Chemie Institut für Wasserchemie und Chemische Balneologie Entwicklung und Validierung eines automatisierten DNA-Mikroarrays zur Detektion von humanpathogenen

Mehr

6. Übung. a) Meiose. b) Reverse TranskripEon. 1) λ- Phage f. c) Prokaryont. d) KonjugaEon. e) Mitochondrien. 4) A. thaliana a, e, g.

6. Übung. a) Meiose. b) Reverse TranskripEon. 1) λ- Phage f. c) Prokaryont. d) KonjugaEon. e) Mitochondrien. 4) A. thaliana a, e, g. 6. Übung 1) Ordnen Sie die unten gelisteten Modellsysteme den Begriffen zu. Anmerkung: Mehrfachzuordnungen sind möglich und einer der Begriffe passt zu keinem der genannten Modellsysteme a) Meiose 1) λ-

Mehr

Molekulare Mechanismen der Signaltransduktion. 06 - Kartierung des AXR1 Gens + early auxin-induced genes Folien: http://tinyurl.

Molekulare Mechanismen der Signaltransduktion. 06 - Kartierung des AXR1 Gens + early auxin-induced genes Folien: http://tinyurl. Molekulare Mechanismen der Signaltransduktion 06 - Kartierung des AXR1 Gens + early auxin-induced genes Folien: http://tinyurl.com/modul-mms bisheriges Modell auxin auxin AXR1 auxin response AXR1 potentieller

Mehr

Jens Tilsner (Autor) Aminosäuretransport in Raps unter besonderer Berücksichtigung des Entwicklungsstadiums der Pflanze und der Stickstoffdüngung

Jens Tilsner (Autor) Aminosäuretransport in Raps unter besonderer Berücksichtigung des Entwicklungsstadiums der Pflanze und der Stickstoffdüngung Jens Tilsner (Autor) Aminosäuretransport in Raps unter besonderer Berücksichtigung des Entwicklungsstadiums der Pflanze und der Stickstoffdüngung https://cuvillier.de/de/shop/publications/3133 Copyright:

Mehr

1 Molekulare Lebensmittelanalytik... 1 Ulrich Busch 1.1 Einleitung... 1

1 Molekulare Lebensmittelanalytik... 1 Ulrich Busch 1.1 Einleitung... 1 Inhalt 1 Molekulare Lebensmittelanalytik... 1 Ulrich Busch 1.1 Einleitung... 1 2 Kultivierungsverfahren für Bakterien... 5 Ute Messelhäußer 2.1 Einleitung... 5 2.2 Anreicherungsverfahren... 7 2.2.1 Nichtselektive

Mehr

Synthese von eukaryotischen RNA-Modifikationen

Synthese von eukaryotischen RNA-Modifikationen Dissertation zur Erlangung des Doktorgrades der Fakultät für Chemie und Pharmazie der Ludwig-Maximilians-Universität München Synthese von eukaryotischen RNA-Modifikationen und Quantifizierung nicht kanonischer

Mehr

Antiretrovirale Therapie und Resistenz von HIV-1

Antiretrovirale Therapie und Resistenz von HIV-1 Aus dem Robert Koch-Institut, Berlin Dissertation Antiretrovirale Therapie und Resistenz von HIV-1 Susanne Duwe Juni 2002 Eingereicht am Fachbereich Biologie, Chemie, Pharmazie der Freien Universität Berlin

Mehr

Das Rcs-System und die RcsAB-Box: Identifikation eines neuen, essentiellen Operators für die. Regulation der enterobakteriellen Kapselbiosynthese

Das Rcs-System und die RcsAB-Box: Identifikation eines neuen, essentiellen Operators für die. Regulation der enterobakteriellen Kapselbiosynthese Das Rcs-System und die RcsAB-Box: Identifikation eines neuen, essentiellen Operators für die Regulation der enterobakteriellen Kapselbiosynthese Inaugural-Dissertation zur Erlangung der Doktorwürde vorgelegt

Mehr

Rekombinante Antikörper

Rekombinante Antikörper Frank Breitling und Stefan Dübel 2008 AGI-Information Management Consultants May be used for personal purporses only or by libraries associated to dandelon.com network. Rekombinante Antikörper Technische

Mehr

Die antivirale Therapie der chronischen Hepatitis B: Identifikation neuer Resistenzmutationen und Optimierung der Verlaufskontrolle

Die antivirale Therapie der chronischen Hepatitis B: Identifikation neuer Resistenzmutationen und Optimierung der Verlaufskontrolle Angefertigt am Fachbereich 08 - Biologie und Chemie in Zusammenarbeit mit dem Institut für Medizinische Virologie am Fachbereich 11- Medizin der Justus-Liebig-Universität Gießen Die antivirale Therapie

Mehr

3 GFP green fluorescent protein

3 GFP green fluorescent protein SCHNUPPERKURS GENTECHNIK 1 ExploHeidelberg 2 Klonierung des Phagen Lambda 3 GFP green fluorescent protein 4 Gens in a bottle Vanessa Hecht 1 ExploHeidelberg Stiftung Jugend und Wissenschaft GmbH Technologiepark

Mehr

Kapillarelektrophorese DNA-Sequenzierung

Kapillarelektrophorese DNA-Sequenzierung Kapillarelektrophorese DNA-Sequenzierung DNA Kettenanalyse oder DNA-Sequenzierung wird bei der Anordnung der Primärstruktur und Bestimmung der Nukleotid-Basensequenz verwendet. Die Analyse basiert auf

Mehr

TECHNISCHE UNIVERSITÄT MÜNCHEN. Department Chemie. Institut für Siliciumchemie. Doktors der Naturwissenschaften

TECHNISCHE UNIVERSITÄT MÜNCHEN. Department Chemie. Institut für Siliciumchemie. Doktors der Naturwissenschaften TECHNISCHE UNIVERSITÄT MÜNCHEN Department Chemie Institut für Siliciumchemie WACKER-Lehrstuhl für Makromolekulare Chemie Synthese und Charakterisierung von Süyl-substituierten Elektrolyten für Lithium-Batterien

Mehr

7. Anhang. 7. Anhang. Abbildung 7.1: Aminosäuresequenz AtMYC2 im Wildtyp und in jin1. Unterschiede zwischen den Sequenzen sind rot unterlegt.

7. Anhang. 7. Anhang. Abbildung 7.1: Aminosäuresequenz AtMYC2 im Wildtyp und in jin1. Unterschiede zwischen den Sequenzen sind rot unterlegt. 7. Anhang 10 20 30 40 50 60 70 80 90 100 jin1 MTDYRLQPTMNLWTTDDNASMMEAFMSSSDISTLWPPASTTTTTATTETTPTPAMEIPAQAGFNQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASV AtMYC2 MTDYRLQPTMNLWTTDDNASMMEAFMSSSDISTLWPPASTTTTTATTETTPTPAMEIPAQAGFNQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASV

Mehr